International Nuclear Information System (INIS)
Huckaby, J.L.; Edwards, J.A.; Evans, J.C.
1996-08-01
This report discusses comparison tests for two methods of collecting vapor samples from the Hanford Site high-level radioactive waste tank headspaces. The two sampling methods compared are the truck-mounted vapor sampling system (VSS) and the cart-mounted in-situ vapor sampling (ISVS). Three tanks were sampled by both the VSS and ISVS methods from the same access risers within the same 8-hour period. These tanks have diverse headspace compositions and they represent the highest known level of several key vapor analytes
Voluntary Service System (VSS)
Department of Veterans Affairs — Voluntary Service System (VSS) is a national-level application which replaced the site-based Voluntary Timekeeping System (VTK). VTK was used for many years at the...
Directory of Open Access Journals (Sweden)
Yunfen Shi
2018-01-01
Full Text Available Piggery wastewater is a kind of high concentration organic wastewater with high concentration of pollutants, large amount of emissions, and serious environmental pollution and is difficult to deal with. Piggery wastewater was treated with autothermal hyperthermia aerobic digestion process (ATAD and its biodegradation kinetics was studied. The ATAD system was automatically heated up and the reaction temperature rose from ambient temperature of 20°C to a maximum temperature of 64°C. Based on Arrhenius formula, the empirical model is obtained through dimensional analysis. The removal of volatile suspended solids (VSS was correlated with the initial VSS concentration, water inlet temperature, aeration rate, and agitation rate in the model. In the empirical model, the apparent activation energy was 2.827 kJ·mol−1. The exponentials for the initial VSS concentration, aeration rate, and stirring rate were 1.0587, −0.0976, and −0.1618, respectively. The correlation coefficient of the exponential factor was 0.9971. The VSS removal efficiency predicted by the model was validated with an actual test, showing a maximum relative deviation of 8.82%. Sludge systems show a lower diversity of microbial populations and Bacillus occupies a very important position in the reactor. The data obtained will be useful for optimizing piggery wastewater treatment process. The new model provided good theoretical guidance with good practicality.
RETRENCHMENT STRATEGY IN HUMAN RESOURCE MANAGEMENT: THE CASE OF VOLUNTARY SEPARATION SCHEME (VSS
Directory of Open Access Journals (Sweden)
T. Ramayah
2004-01-01
Full Text Available One of the major challenges of business leadership in this millennium is to manage continued improvement in a competitive position. In order to stay competitive, companies are trying to become more "mean and lean". To achieve this, many major corporations have adopted the "downsizing and rightsizing" strategy. Voluntary Separation Scheme (VSS has been a global phenomenon since the 1980's and is common particularly in larger companies. In this study, the reaction to the VSS program involving the employees of a government agency embracing privatisation was studied, specifically the influence of the basic needs and referent power on the choice of acceptance and non-acceptance of VSS. The second objective of this study was to evaluate the success or failure of the VSS from the workers perspective in particular, whether their decision met their needs. The results showed that basic needs had an influence on the acceptance and the non-acceptance of VSS, namely health needs, security needs and self-esteem needs. All the referent powers (subjective norms had an influence, but surprisingly close friends had the strongest influence. Differences were also found between the expectations and the perception of the workers who accepted or rejected the VSS. From the workers' perspective, it appeared that the VSS carried out in this organization was not a success.
Directory of Open Access Journals (Sweden)
Windarti Windarti
2016-06-01
Full Text Available Penelitian ini bertujuan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris menggunakan Vocabulary Self-Collection Strategy (VSS siswa kelas VII SMP Negeri 3 Kalasan. Metode penelitian yang digunakan yaitu penelitian tindakan kelas (PTK, yang terdiri dari dua siklus. Tiap siklus terdiri dari empat tahap, yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Subjek penelitian ini adalah 32 siswa kelas VII B SMP Negeri 3 Kalasan tahun ajaran 2013/2014. Teknik pengumpulan data yang digunakan yaitu observasi, tes, dan wawancara. Analisis data yang digunakan yaitu deskriptif kuantitatif dan deskriptif kualitatif. Hasil penelitian ini menunjukan bahwa penerapan strategi VSS dapat digunakan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris. Peningkatan hasil belajar siswa ditunjukkan dengan meningkatnya jumlah siswa yang lulus standar KKM pada siklus I dan II. Nilai rata-rata tes pada siklus I adalah 77,2. Nilai rata-rata tes pada siklus II adalah 82,4. Kesimpulan pada penelitian ini adalah bahwa penerapan strategi VSS dapat meningkatkan perolehan kosakata bahasa Inggris dalam pemahaman membaca siswa kelas VII SMP Negeri 3 Kalasan. Kata kunci: VSS, perolehan kosakata, pemahaman membaca bahasa Inggris. THE EFFORT TO IMPROVE VOCABULARY ACQUISITION IN ENGLISH READING COMPREHENSION USING VSS ON THE STUDENTS OF SMP Abstract This study aims to improve vocabulary acquisition in English reading comprehension using Vocabulary Self-Collection Strategy (VSS on the seventh grade students of SMP Negeri 3 Kalasan. This was an action reserch study consisting of two cycles. Each cycle consisted of four steps, namely planning, implementation, observation, and reflection. The research subjects were 32 seventh grade students of SMP 3 Kalasan in the academic year of 2013/2014. The data were collected through observation, tests, and interviews and analyzed by means of quantitative and qualitative descriptive
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure......We present a general treatment of all non-cryptographic (i.e., information-theoretically secure) linear veriable-secret-sharing (VSS) and distributed-commitment (DC) schemes, based on an underlying secret sharing scheme, pairwise checks between players, complaints, and accusations of the dealer...
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure...
Vapor and gas sampling of single-shell tank 241-B-102 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (the team) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-B-102. This document presents sampling data resulting from the April 18, 1996 sampling of SST 241-B-102. Analytical results will be presented in a separate report issued by Pacific Northwest National Laboratory (PNNL), which supplied and analyzed the sampling media. The team, consisting of Sampling and Mobile Laboratories (SML) and Special Analytical Studies (SAS) personnel, used the vapor sampling system (VSS) to collect representative samples of the air, gases, and vapors from the headspace of SST 241-B-102 with sorbent traps and SUMMA canisters
Tank 241-BY-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-108 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-108 using the vapor sampling system (VSS) on october 27, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 25.7 C. Air from the Tank BY-108 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 1, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Tank 241-BY-110 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Tank 241-BY-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-105 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-105 using the vapor sampling system (VSS) on July 7, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 26 C. Air from the Tank BY-105 headspace was withdrawn via a heated sampling probe mounted in riser 10A, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 65 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, Pacific Northwest Laboratories, and Oregon Graduate Institute of Science and Technology through a contract with Sandia National Laboratories. The 46 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 10 trip blanks provided by the laboratories
Improved Fractional Order VSS Inc-Cond MPPT Algorithm for Photovoltaic Scheme
Directory of Open Access Journals (Sweden)
R. Arulmurugan
2014-01-01
Full Text Available Nowadays a hot topic among the research community is the harnessing energy from the free sunlight which is abundant and pollution-free. The availability of cheap solar photovoltaic (PV modules has to harvest solar energy with better efficiency. The nature of solar modules is nonlinear and therefore the proper impedance matching is essential. The proper impedance matching ensures the extraction of the maximum power from solar PV module. Maximum power point tracking (MPPT algorithm is acting as a significant part in solar power generating system because it varies in the output power from a PV generating set for various climatic conditions. This paper suggested a new improved work for MPPT of PV energy system by using the optimized novel improved fractional order variable step size (FOVSS incremental conductance (Inc-Cond algorithm. The new proposed controller combines the merits of both improved fractional order (FO and variable step size (VSS Inc-Cond which is well suitable for design control and execution. The suggested controller results in attaining the desired transient reaction under changing operating points. MATLAB simulation effort shows MPPT controller and a DC to DC Luo converter feeding a battery load is achieved. The laboratory experimental results demonstrate that the new proposed MPPT controller in the photovoltaic generating system is valid.
Tank 241-C-101 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank C-101 headspace gas and vapor samples were collected and analyzed to help determine the potential risks of fugitive emissions to tank farm workers. Gas and vapor samples from the Tank C-101 headspace were collected on July 7, 1994 using the in situ sampling (ISS) method, and again on September 1, 1994 using the more robust vapor sampling system (VSS). Gas and vapor concentrations in Tank C-101 are influenced by its connections to other tanks and its ventilation pathways. At issue is whether the organic vapors in Tank C-101 are from the waste in that tank, or from Tanks C-102 or C-103. Tank C-103 is on the Organic Watch List; the other two are not. Air from the Tank C-101 headspace was withdrawn via a 7.9-m long heated sampling probe mounted in riser 8, and transferred via heated tubing to the VSS sampling manifold. The tank headspace temperature was determined to be 34.0 C, and all heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, Pacific Northwest Laboratories, and Oregon Graduate Institute of Science and Technology through a contract with Sandia National Laboratories. The 39 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks provided by the laboratories
International Nuclear Information System (INIS)
Clauss, T.W.; Ligotke, M.W.; McVeety, B.D.; Lucke, R.B.; Young, J.S.; McCulloch, M.; Fruchter, J.S.; Goheen, S.C.
1995-06-01
This report describes organic analyses results from ambient samples collected both upwind and through the vapor sampling system (VSS) near Hanford waste storage Tank 241-C-103 (referred to as Tank C-103). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed. Quantitative results were obtained for organic compounds. Five organic tentatively identified compounds (TICS) were observed above the detection limit of (ca.) 10 ppbv, but standards for most of these were not available at the time of analysis, and the reported concentrations are semiquantitative estimates. In addition, we looked for the 40 standard TO-14 analytes. We observed 39. Of these, only one was observed above the 2-ppbv calibrated instrument detection limit. Dichloromethane was above the detection limits using both methods, but the result from the TO-14 method is traceable to a standard gas mixture and is considered more accurate. Organic analytes were found only in the sample collected through the VSS, suggesting that these compounds were residual contamination from a previous sampling job. Detailed descriptions of the results appear in the text
International Nuclear Information System (INIS)
Huckaby, J.L.; Edwards, J.A.; Evans, J.C.
1996-05-01
The objective of this report is to evaluate the equivalency of two methods used to sample nonradioactive gases and vapors in the Hanford Site high-level waste tank headspaces. In addition to the comparison of the two sampling methods, the effects of an in-line fine particle filter on sampling results are also examined to determine whether results are adversely affected by its presence. This report discusses data from a January 1996 sampling
Desain dan Implementasi Aplikasi Video Surveillance System Berbasis Web-SIG
Directory of Open Access Journals (Sweden)
I M.O. Widyantara
2015-06-01
Full Text Available Video surveillance system (VSS is an monitoring system based-on IP-camera. VSS implemented in live streaming and serves to observe and monitor a site remotely. Typically, IP- camera in the VSS has a management software application. However, for ad hoc applications, where the user wants to manage VSS independently, application management software has become ineffective. In the IP-camera installation spread over a large area, an administrator would be difficult to describe the location of the IP-camera. In addition, monitoring an area of IP- Camera will also become more difficult. By looking at some of the flaws in VSS, this paper has proposed a VSS application for easy monitoring of each IP Camera. Applications that have been proposed to integrate the concept of web-based geographical information system with the Google Maps API (Web-GIS. VSS applications built with smart features include maps ip-camera, live streaming of events, information on the info window and marker cluster. Test results showed that the application is able to display all the features built well
An improved AE detection method of rail defect based on multi-level ANC with VSS-LMS
Zhang, Xin; Cui, Yiming; Wang, Yan; Sun, Mingjian; Hu, Hengshan
2018-01-01
In order to ensure the safety and reliability of railway system, Acoustic Emission (AE) method is employed to investigate rail defect detection. However, little attention has been paid to the defect detection at high speed, especially for noise interference suppression. Based on AE technology, this paper presents an improved rail defect detection method by multi-level ANC with VSS-LMS. Multi-level noise cancellation based on SANC and ANC is utilized to eliminate complex noises at high speed, and tongue-shaped curve with index adjustment factor is proposed to enhance the performance of variable step-size algorithm. Defect signals and reference signals are acquired by the rail-wheel test rig. The features of noise signals and defect signals are analyzed for effective detection. The effectiveness of the proposed method is demonstrated by comparing with the previous study, and different filter lengths are investigated to obtain a better noise suppression performance. Meanwhile, the detection ability of the proposed method is verified at the top speed of the test rig. The results clearly illustrate that the proposed method is effective in detecting rail defects at high speed, especially for noise interference suppression.
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Hildebrandt, Dieter
2014-01-01
Modern 3D geovisualization systems (3DGeoVSs) are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI) to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable ...
Phuong, Nguyen Khanh; Oanh, Tran Thi Mai; Phuong, Hoang Thi; Tien, Tran Van; Cashin, Cheryl
2015-01-01
Provider payment arrangements are currently a core concern for Vietnam's health sector and a key lever for expanding effective coverage and improving the efficiency and equity of the health system. This study describes how different provider payment systems are designed and implemented in practice across a sample of provinces and districts in Vietnam. Key informant interviews were conducted with over 100 health policy-makers, purchasers and providers using a structured interview guide. The results of the different payment methods were scored by respondents and assessed against a set of health system performance criteria. Overall, the public health insurance agency, Vietnam Social Security (VSS), is focused on managing expenditures through a complicated set of reimbursement policies and caps, but the incentives for providers are unclear and do not consistently support Vietnam's health system objectives. The results of this study are being used by the Ministry of Health and VSS to reform the provider payment systems to be more consistent with international definitions and good practices and to better support Vietnam's health system objectives.
Vapor space characterization of waste tank 241-C-101: Results from samples collected on 9/1/94
International Nuclear Information System (INIS)
Lucke, R.B.; Clauss, T.W.; Ligotke, M.W.
1995-11-01
This report describes results of the analyses of tank-headspace samples taken from the Hanford waste Tank 241-C-101 (referred to as Tank C-101) and the ambient air collected - 30 ft upwind near the tank and through the VSS near the tank. Pacific Northwest Laboratory (PNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and to analyze inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The sample job was designated S4056, and samples were collected by WHC on September 1, 1994, using the vapor sampling system (VSS). The samples were inspected upon delivery to the 326/23B laboratory and logged into PNL record book 55408 before implementation of PNL Technical Procedure PNL-TVP-07. Custody of the sorbent traps was transferred to PNL personnel performing the inorganic analysis and stored at refrigerated (≤ 10 degrees C) temperature until the time of analysis. The canisters were stored in the 326/23B laboratory at ambient (25 degrees C) temperature until the time of the analysis. Access to the 326/23B laboratory is limited to PNL personnel working on the waste-tank safety program. Analyses described in this report were performed at PNL in the 300 area of the Hanford Reservation. Analytical methods that were used are described in the text. In summary, sorbent traps for inorganic analyses containing sample materials were either weighed (for water analysis) or desorbed with the appropriate aqueous solutions (for NH 3 , NO 2 , and NO analyses). The aqueous extracts were analyzed either by selective electrode or by ion chromatography (IC). Organic analyses were performed using cryogenic preconcentration followed by gas chromatography/mass spectrometry (GC/MS)
Hernandez, J E; Bachmann, R T; Edyvean, R G J
2006-01-01
The measurement of biomass concentration is important in biological wastewater treatment. This paper compares the accuracy and costs of the traditional volatile suspended solids (VSS) and the proposed suspended organic carbon (SOC) methods. VSS and SOC values of a dilution system were very well correlated (R(2)=0.9995). VSS and SOC of 16 samples were determined, the mean SOC/VSS ratio (0.52, n=16, sigma=0.01) was close to the theoretical value (0.53). For costing analysis, two hypothetical cases were analysed. In case A, it is assumed that 108 samples are analysed annually from two continuous reactors. Case B represents a batch experiment to be carried out in 24 incubated serum bottles. The savings, when using the SOC method, were 11,987 pounds for case A and 90 pounds for case B. This study suggests the use of SOC method as a time saving and lower cost biomass concentration measurement.
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Directory of Open Access Journals (Sweden)
Dieter Hildebrandt
2014-12-01
Full Text Available Modern 3D geovisualization systems (3DGeoVSs are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable manner, while exploiting images as efficient, decoupled and interoperable representations. The software architecture of a 3DGeoVS and its underlying visualization model have strong effects on the system’s quality attributes and support various system life cycle activities. This article contributes a software reference architecture (SRA for 3DGeoVSs based on SSI that can be used to design, describe and analyze concrete software architectures with the intended primary benefit of an increase in effectiveness and efficiency in such activities. The SRA integrates existing, proven technology and novel contributions in a unique manner. As the foundation for the SRA, we propose the generalized visualization pipeline model that generalizes and overcomes expressiveness limitations of the prevalent visualization pipeline model. To facilitate exploiting image-based representations (IReps, the SRA integrates approaches for the representation, provisioning and styling of and interaction with IReps. Five applications of the SRA provide proofs of concept for the general applicability and utility of the SRA. A qualitative evaluation indicates the overall suitability of the SRA, its applications and the general approach of building 3DGeoVSs based on SSI.
International Nuclear Information System (INIS)
Evans, J.C.; Pool, K.H.; Thomas, B.L.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of waste storage tank 241-C-107 (Tank C-107) at the Hanford Site in Washington State. The results described in this report is the second in a series comparing vapor sampling of the tank headspace using the Vapor Sampling System (VSS) and In Situ Vapor Sampling (ISVS) system without high efficiency particulate air (HEPA) prefiltration. The results include air concentrations of water (H 2 O) and ammonia (NH 3 ), permanent gases, total non-methane organic compounds (TO-12), and individual organic analytes collected in SUMMA trademark canisters and on triple sorbent traps (TSTs). Samples were collected by Westinghouse Hanford Company (WHC) and analyzed by Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volume measurements provided by WHC
International Nuclear Information System (INIS)
Thomas, B.L.; Pool, K.H.; Evans, J.C.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of waste storage tank 241-BY-108 (Tank BY-108) at the Hanford Site in Washington State. The results described in this report is the second in a series comparing vapor sampling of the tank headspace using the Vapor Sampling System (VSS) and In Situ Vapor Sampling (ISVS) system without high efficiency particulate air (HEPA) prefiltration. The results include air concentrations of water (H 2 O) and ammonia (NH 3 ), permanent gases, total non-methane organic compounds (TO-12), and individual organic analytes collected in SUMMA trademark canisters and on triple sorbent traps (TSTs). Samples were collected by Westinghouse Hanford Company (WHC) and analyzed by Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volume measurements provided by WHC
PAVS: A New Privacy-Preserving Data Aggregation Scheme for Vehicle Sensing Systems.
Xu, Chang; Lu, Rongxing; Wang, Huaxiong; Zhu, Liehuang; Huang, Cheng
2017-03-03
Air pollution has become one of the most pressing environmental issues in recent years. According to a World Health Organization (WHO) report, air pollution has led to the deaths of millions of people worldwide. Accordingly, expensive and complex air-monitoring instruments have been exploited to measure air pollution. Comparatively, a vehicle sensing system (VSS), as it can be effectively used for many purposes and can bring huge financial benefits in reducing high maintenance and repair costs, has received considerable attention. However, the privacy issues of VSS including vehicles' location privacy have not been well addressed. Therefore, in this paper, we propose a new privacy-preserving data aggregation scheme, called PAVS, for VSS. Specifically, PAVS combines privacy-preserving classification and privacy-preserving statistics on both the mean E(·) and variance Var(·), which makes VSS more promising, as, with minimal privacy leakage, more vehicles are willing to participate in sensing. Detailed analysis shows that the proposed PAVS can achieve the properties of privacy preservation, data accuracy and scalability. In addition, the performance evaluations via extensive simulations also demonstrate its efficiency.
International Nuclear Information System (INIS)
McVeety, B.D.; Evans, J.C.; Clauss, T.W.; Pool, K.H.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-102 (Tank SX-102) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed under the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5046. Samples were collected by WHC on July 19, 1995, using the vapor sampling system (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Ligotke, M.W.; Pool, K.H.; Clauss, T.W.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-AX-103 (Tank AX-103) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5029. Samples were collected by WHC on June 21, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Evans, J.C.; McVeety, B.D.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-AX-101 (Tank AX-101) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) under the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5028. Samples were collected by WHC on June 15, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
McVeety, B.D.; Thomas, B.L.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-T-110 (Tank T-110) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5056. Samples were collected by WHC on August 31, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Evans, J.C.
1996-06-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-TX-111 (Tank TX-111) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5069. Samples were collected by WHC on October 12, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-109 (Tank SX-109) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5048. Samples were collected by WHC on August 1, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Thomas, B.L.; Clauss, T.W.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-104 (Tank SX-104) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5049. Samples were collected by WHC on July 25, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Clauss, T.W.; Pool, K.H.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage Tank 241-S-112 (Tank S-112) at the Hanford. Pacific Northwest National Laboratory (PNNL) is contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5044. Samples were collected by WHC on July 11, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-105 (Tank SX-105) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5047. Samples were collected by WHC on July 26, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
Two separate thoroscopic segmentectomies with vessel sealing system.
Watanabe, Atsushi; Miyajima, Masahiro; Kawaharada, Nobuyoshi; Higami, Tetsuya
2012-04-01
Total thoracoscopic segmentectomy is an appealing concept in terms of providing a parenchyma-sparing treatment. We describe our technique of two seperate total thoracoscopic segmentectomies by using a vessel sealing system (VSS). A 76-year old female with four gradually enlarging ground glass lesions on the right segment 2 (10 and 3 mm) and segment 6 (8 and 3 mm) was admitted to our institute for surgical diagnosis and treatment. Preoperative three-dimensional computed tomography showed that the A2 is composed of descending A2 and ascending A2, branch of V6 coursed to V2 and B1a originated from B2 and B1b from B3. Two separate segmentectomies were subsequently scheduled. Pulmonary vessel division was performed with VSS after proximal ligation. Intersegmental division by VSS and electrocautery was performed with the use of inflation-deflation demarcation line and the pulmonary veins along the intersegmental plane (V2a and V2c for segment 2 and V6b and V6c for segment 6) as guides to confirm the intersegmental plane after pulmonary artery and bronchial divisions. The intraoperative frozen-section examinations revealed adenocarcinoma in situ. Two separate segmentectomies were successfully completed, with a total operative time of 240 min and blood loss of 30 ml. VSS is a very useful and safe device for intersegmental division and pulmonary vessel division.
Calise, A. J.; Kadushin, I.; Kramer, F.
1981-01-01
The current status of research on the application of variable structure system (VSS) theory to design aircraft flight control systems is summarized. Two aircraft types are currently being investigated: the Augmentor Wing Jet STOL Research Aircraft (AWJSRA), and AV-8A Harrier. The AWJSRA design considers automatic control of longitudinal dynamics during the landing phase. The main task for the AWJSRA is to design an automatic landing system that captures and tracks a localizer beam. The control task for the AV-8A is to track velocity commands in a hovering flight configuration. Much effort was devoted to developing computer programs that are needed to carry out VSS design in a multivariable frame work, and in becoming familiar with the dynamics and control problems associated with the aircraft types under investigation. Numerous VSS design schemes were explored, particularly for the AWJSRA. The approaches that appear best suited for these aircraft types are presented. Examples are given of the numerical results currently being generated.
Jiang, Liren
2017-01-01
Background The aim was to develop scalable Whole Slide Imaging (sWSI), a WSI system based on mainstream smartphones coupled with regular optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry objective lenses of different magnifications, and reasonably high throughput. These performance metrics should be evaluated by expert pathologists and match those of high-end scanners. Objective The aim was to develop scalable Whole Slide Imaging (sWSI), a whole slide imaging system based on smartphones coupled with optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry object lens of different magnification. All performance metrics should be evaluated by expert pathologists and match those of high-end scanners. Methods In the sWSI design, the digitization process is split asynchronously between light-weight clients on smartphones and powerful cloud servers. The client apps automatically capture FoVs at up to 12-megapixel resolution and process them in real-time to track the operation of users, then give instant feedback of guidance. The servers first restitch each pair of FoVs, then automatically correct the unknown nonlinear distortion introduced by the lens of the smartphone on the fly, based on pair-wise stitching, before finally combining all FoVs into one gigapixel VS for each scan. These VSs can be viewed using Internet browsers anywhere. In the evaluation experiment, 100 frozen section slides from patients randomly selected among in-patients of the participating hospital were scanned by both a high-end Leica scanner and sWSI. All VSs were examined by senior pathologists whose diagnoses were compared against those made using optical microscopy as ground truth to evaluate the image quality. Results The sWSI system is developed for both Android and iPhone smartphones and
Yu, Hong; Gao, Feng; Jiang, Liren; Ma, Shuoxin
2017-09-15
The aim was to develop scalable Whole Slide Imaging (sWSI), a WSI system based on mainstream smartphones coupled with regular optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry objective lenses of different magnifications, and reasonably high throughput. These performance metrics should be evaluated by expert pathologists and match those of high-end scanners. The aim was to develop scalable Whole Slide Imaging (sWSI), a whole slide imaging system based on smartphones coupled with optical microscopes. This ultra-low-cost solution should offer diagnostic-ready imaging quality on par with standalone scanners, supporting both oil and dry object lens of different magnification. All performance metrics should be evaluated by expert pathologists and match those of high-end scanners. In the sWSI design, the digitization process is split asynchronously between light-weight clients on smartphones and powerful cloud servers. The client apps automatically capture FoVs at up to 12-megapixel resolution and process them in real-time to track the operation of users, then give instant feedback of guidance. The servers first restitch each pair of FoVs, then automatically correct the unknown nonlinear distortion introduced by the lens of the smartphone on the fly, based on pair-wise stitching, before finally combining all FoVs into one gigapixel VS for each scan. These VSs can be viewed using Internet browsers anywhere. In the evaluation experiment, 100 frozen section slides from patients randomly selected among in-patients of the participating hospital were scanned by both a high-end Leica scanner and sWSI. All VSs were examined by senior pathologists whose diagnoses were compared against those made using optical microscopy as ground truth to evaluate the image quality. The sWSI system is developed for both Android and iPhone smartphones and is currently being offered to the
Gholikandi, Gagik Badalians; Kazemirad, Khashayar
2018-03-01
In this study, the performance of the electrochemical peroxidation (ECP) process for removing the volatile suspended solids (VSS) content of waste-activated sludge was evaluated. The Fe 2+ ions required by the process were obtained directly from iron electrodes in the system. The performance of the ECP process was investigated in various operational conditions employing a laboratory-scale pilot setup and optimized by response surface methodology (RSM). According to the results, the ECP process showed its best performance when the pH value, current density, H 2 O 2 concentration and the retention time were 3, 3.2 mA/cm 2 , 1,535 mg/L and 240 min, respectively. In these conditions, the introduced Fe 2+ concentration was approximately 500 (mg/L) and the VSS removal efficiency about 74%. Moreover, the results of the microbial characteristics of the raw and the stabilized sludge demonstrated that the ECP process is able to remove close to 99.9% of the coliforms in the raw sludge during the stabilization process. The energy consumption evaluation showed that the required energy of the ECP reactor (about 1.8-2.5 kWh (kg VSS removed) -1 ) is considerably lower than for aerobic digestion, the conventional waste-activated sludge stabilization method (about 2-3 kWh (kg VSS removed) -1 ). The RSM optimization process showed that the best operational conditions of the ECP process comply with the experimental results, and the actual and the predicted results are in good conformity with each other. This feature makes it possible to predict the introduced Fe 2+ concentrations into the system and the VSS removal efficiency of the process precisely.
Model-Aided Altimeter-Based Water Level Forecasting System in Mekong River
Chang, C. H.; Lee, H.; Hossain, F.; Okeowo, M. A.; Basnayake, S. B.; Jayasinghe, S.; Saah, D. S.; Anderson, E.; Hwang, E.
2017-12-01
Mekong River, one of the massive river systems in the world, has drainage area of about 795,000 km2 covering six countries. People living in its drainage area highly rely on resources given by the river in terms of agriculture, fishery, and hydropower. Monitoring and forecasting the water level in a timely manner, is urgently needed over the Mekong River. Recently, using TOPEX/Poseidon (T/P) altimetry water level measurements in India, Biancamaria et al. [2011] has demonstrated the capability of an altimeter-based flood forecasting system in Bangladesh, with RMSE from 0.6 - 0.8 m for lead times up to 5 days on 10-day basis due to T/P's repeat period. Hossain et al. [2013] further established a daily water level forecasting system in Bangladesh using observations from Jason-2 in India and HEC-RAS hydraulic model, with RMSE from 0.5 - 1.5 m and an underestimating mean bias of 0.25 - 1.25 m. However, such daily forecasting system relies on a collection of Jason-2 virtual stations (VSs) to ensure frequent sampling and data availability. Since the Mekong River is a meridional river with few number of VSs, the direct application of this system to the Mekong River becomes challenging. To address this problem, we propose a model-aided altimeter-based forecasting system. The discharge output by Variable Infiltration Capacity hydrologic model is used to reconstruct a daily water level product at upstream Jason-2 VSs based on the discharge-to-level rating curve. The reconstructed daily water level is then used to perform regression analysis with downstream in-situ water level to build regression models, which are used to forecast a daily water level. In the middle reach of the Mekong River from Nakhon Phanom to Kratie, a 3-day lead time forecasting can reach RMSE about 0.7 - 1.3 m with correlation coefficient around 0.95. For the lower reach of the Mekong River, the water flow becomes more complicated due to the reversal flow between the Tonle Sap Lake and the Mekong River
Prause, Nicole; Steele, Vaughn R; Staley, Cameron; Sabatinelli, Dean; Hajcak, Greg
2015-07-01
"Excessive" viewing of visual sexual stimuli (VSS) is the most commonly reported hypersexual behavior problem and is especially amenable to laboratory study. A pattern of enhanced sexual cue responsiveness is expected in this sample if hypersexuality shares features of other addiction models. Participants (N=122) who either reported or denied problematic VSS use were presented with emotional, including explicit sexual, images while their evoked response potentials were recorded. An interaction of hypersexual problem group and the level of desire for sex with a partner predicted LPP amplitude. Specifically, those reporting problems regulating their VSS use who also reported higher sexual desire had lower LPP in response to VSS. This pattern appears different from substance addiction models. These are the first functional physiological data of persons reporting VSS regulation problems. Copyright © 2015 Elsevier B.V. All rights reserved.
Virtual substitution scan via single-step free energy perturbation.
Chiang, Ying-Chih; Wang, Yi
2016-02-05
With the rapid expansion of our computing power, molecular dynamics (MD) simulations ranging from hundreds of nanoseconds to microseconds or even milliseconds have become increasingly common. The majority of these long trajectories are obtained from plain (vanilla) MD simulations, where no enhanced sampling or free energy calculation method is employed. To promote the 'recycling' of these trajectories, we developed the Virtual Substitution Scan (VSS) toolkit as a plugin of the open-source visualization and analysis software VMD. Based on the single-step free energy perturbation (sFEP) method, VSS enables the user to post-process a vanilla MD trajectory for a fast free energy scan of substituting aryl hydrogens by small functional groups. Dihedrals of the functional groups are sampled explicitly in VSS, which improves the performance of the calculation and is found particularly important for certain groups. As a proof-of-concept demonstration, we employ VSS to compute the solvation free energy change upon substituting the hydrogen of a benzene molecule by 12 small functional groups frequently considered in lead optimization. Additionally, VSS is used to compute the relative binding free energy of four selected ligands of the T4 lysozyme. Overall, the computational cost of VSS is only a fraction of the corresponding multi-step FEP (mFEP) calculation, while its results agree reasonably well with those of mFEP, indicating that VSS offers a promising tool for rapid free energy scan of small functional group substitutions. This article is protected by copyright. All rights reserved. © 2016 Wiley Periodicals, Inc.
Tank Vapor Characterization Project: Annual status report for FY 1996
International Nuclear Information System (INIS)
Silvers, K.L.; Fruchter, J.S.; Huckaby, J.L.; Almeida, T.L.; Evans, J.C. Jr.; Pool, K.H.; Simonen, C.A.; Thornton, B.M.
1997-01-01
In Fiscal Year 1996, staff at the Vapor Analytical Laboratory at Pacific Northwest National Laboratory performed work in support of characterizing the vapor composition of the headspaces of radioactive waste tanks at the Hanford Site. Work performed included support for technical issues and sampling methodologies, upgrades for analytical equipment, analytical method development, preparation of unexposed samples, analyses of tank headspaces samples, preparation of data reports, and operation of the tank vapor database. Progress made in FY 1996 included completion and issuance of 50 analytical data reports. A sampling system comparison study was initiated and completed during the fiscal year. The comparison study involved the vapor sampling system (VSS), a truck-based system, and the in situ vapor sampling system (ISVS), a cart-based system. Samples collected during the study were characterized for inorganic, permanent gases, total non-methane organic compounds and organic speciation by SUMMA trademark and TST methods. The study showed comparable sampling results between the systems resulting in the program switching from the VSS to the less expensive ISVS methodology in late May 1996. A temporal study was initiated in January 1996 in order to understand the influences seasonal temperatures changes have on the vapors in the headspace of Hanford waste tanks. A holding time study was initiated in the fourth quarter of FY 1996. Samples were collected from tank S-102 and rushed to the laboratory for time zero analysis. Additional samples will be analyzed at 1, 2, 4, 8, 16, and 32 weeks
State of the art of teledermatopathology.
Massone, Cesare; Brunasso, Alexandra M G; Campbell, Terri M; Soyer, H Peter
2008-10-01
Teledermatopathology may involve real-time transmission of images from distant locations to consulting pathologists by the remote manipulation of a robotic microscope. Alternatively, the static store-and-forward option involves the single-file transmission of subjectively preselected and captured areas of microscopic images by a referring physician. The recent introduction of virtual slide systems (VSS) involves the digitization of whole slides at high resolution thus enabling the user to view any part of the specimen at any magnification. Such technology has surmounted previous restrictions caused by the size of preselected areas and specimen sampling for telepathology. In terms of client access, these VSS may be stored on a virtual slide server, made available on the Web for remote consultation by pathologists via an integrated virtual slide client network. Despite store-and-forward teledermatopathology being the most frequently used and less expensive approach to teledermatopathology, VSS represents the future in this discipline. The recent pilot studies suggest that the use of remote expert consultants in diagnostic dermatopathology can be integrated into daily routine, teleconsultation, and teleteaching. The new technology enables rapid and reproducible diagnoses, but despite its usability, VSS is not completely feasible for teledermatopathology of inflammatory skin diseases as the performance seems to be influenced by the availability of complete clinical data. Improvements in the diagnostic facility will no doubt follow from further development of the VSS, the slide processor, and of course training in the use of virtual microscope. Undoubtedly, as technology becomes even more sophisticated in the future, VSS will overcome the present drawbacks and find its place in all facets of teledermatopathology.
International Nuclear Information System (INIS)
BOGER, R.M.
1999-01-01
This design compliance matrix document provides specific design related functional characteristics, constraints, and requirements for the container filling system that is part of the nested, fixed-depth sampling system. This document addresses performance, external interfaces, ALARA, Authorization Basis, environmental and design code requirements for the container filling system. The container filling system will interface with the waste stream from the fluidic pumping channels of the nested, fixed-depth sampling system and will fill containers with waste that meet the Resource Conservation and Recovery Act (RCRA) criteria for waste that contains volatile and semi-volatile organic materials. The specifications for the nested, fixed-depth sampling system are described in a Level 2 Specification document (HNF-3483, Rev. 1). The basis for this design compliance matrix document is the Tank Waste Remediation System (TWRS) desk instructions for design Compliance matrix documents (PI-CP-008-00, Rev. 0)
Planetary Sample Caching System Design Options
Collins, Curtis; Younse, Paulo; Backes, Paul
2009-01-01
Potential Mars Sample Return missions would aspire to collect small core and regolith samples using a rover with a sample acquisition tool and sample caching system. Samples would need to be stored in individual sealed tubes in a canister that could be transfered to a Mars ascent vehicle and returned to Earth. A sample handling, encapsulation and containerization system (SHEC) has been developed as part of an integrated system for acquiring and storing core samples for application to future potential MSR and other potential sample return missions. Requirements and design options for the SHEC system were studied and a recommended design concept developed. Two families of solutions were explored: 1)transfer of a raw sample from the tool to the SHEC subsystem and 2)transfer of a tube containing the sample to the SHEC subsystem. The recommended design utilizes sample tool bit change out as the mechanism for transferring tubes to and samples in tubes from the tool. The SHEC subsystem design, called the Bit Changeout Caching(BiCC) design, is intended for operations on a MER class rover.
Core sampling system spare parts assessment
International Nuclear Information System (INIS)
Walter, E.J.
1995-01-01
Soon, there will be 4 independent core sampling systems obtaining samples from the underground tanks. It is desirable that these systems be available for sampling during the next 2 years. This assessment was prepared to evaluate the adequacy of the spare parts identified for the core sampling system and to provide recommendations that may remediate overages or inadequacies of spare parts
Alignment of classification paradigms for communication abilities in children with cerebral palsy.
Hustad, Katherine C; Oakes, Ashley; McFadd, Emily; Allison, Kristen M
2016-06-01
We examined three communication ability classification paradigms for children with cerebral palsy (CP): the Communication Function Classification System (CFCS), the Viking Speech Scale (VSS), and the Speech Language Profile Groups (SLPG). Questions addressed interjudge reliability, whether the VSS and the CFCS captured impairments in speech and language, and whether there were differences in speech intelligibility among levels within each classification paradigm. Eighty children (42 males, 38 females) with a range of types and severity levels of CP participated (mean age 60mo, range 50-72mo [SD 5mo]). Two speech-language pathologists classified each child via parent-child interaction samples and previous experience with the children for the CFCS and VSS, and using quantitative speech and language assessment data for the SLPG. Intelligibility scores were obtained using standard clinical intelligibility measurement. Kappa values were 0.67 (95% confidence interval [CI] 0.55-0.79) for the CFCS, 0.82 (95% CI 0.72-0.92) for the VSS, and 0.95 (95% CI 0.72-0.92) for the SLPG. Descriptively, reliability within levels of each paradigm varied, with the lowest agreement occurring within the CFCS at levels II (42%), III (40%), and IV (61%). Neither the CFCS nor the VSS were sensitive to language impairments captured by the SLPG. Significant differences in speech intelligibility were found among levels for all classification paradigms. Multiple tools are necessary to understand speech, language, and communication profiles in children with CP. Characterization of abilities at all levels of the International Classification of Functioning, Disability and Health will advance our understanding of the ways that speech, language, and communication abilities present in children with CP. © 2015 Mac Keith Press.
International Nuclear Information System (INIS)
Clauss, T.W.; Ligotke, M.W.; McVeety, B.D.; Pool, K.H.; Lucke, R.B.; Fruchter, J.S.; Goheen, S.C.
1994-11-01
This report describes results of the analyses of tank-headspace samples taken from Hanford waste Tank 241-BY-104 (referred to as Tank BY-104) on June 24, 1994. The Pacific Northwest Laboratory (PNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze inorganic and organic samples collected from the tank headspace. The sample job was designated S4019 and was performed by WHC on June 24, 1994 using the vapor sampling system (VSS). The results of the analyses are expected to be used in the determination of safety and toxicological issues related to the tank-headspace gas as described in the WHC report entitled Data Quality Objectives for Generic In-Tank Health and Safety Vapor Issue Resolution, WHC-SD-WM-DQO-002, Rev. 0. Sampling devices, including 16 sorbent trains (for inorganic analyses), and 5 SUMMA trademark canisters (for organic analyses), were supplied to the WHC sampling staff on June 20, 1994. Samples were taken (by WHC) on June 24. The samples were returned from the field on June 27. The inorganic samples delivered to PNL on chain-of-custody (COC) 006893 included 16 sorbent trains as described in Tables 2.2, 2.3, and 2.4. Additional inorganic blank spikes were obtained from related sample jobs. SUMMA trademark samples delivered to PNL on COC 006896 included one ambient air sample, one ambient-air sample through the sampling system, and three tank-headspace SUMMA trademark canister samples. The samples were inspected upon delivery to the 326/23B laboratory and logged into PNL laboratory record book 55408. Custody of the sorbent trains was transferred to PNL personnel performing the inorganic analysis and stored at refrigerated (≤10 degrees C) temperature until the time of analysis. Access to the 326/23B laboratory is limited to PNL personnel working on the waste-tank safety program
Energy Technology Data Exchange (ETDEWEB)
Wang, W.; Han, H.J.; Yuan, M.; Li, H.Q.; Fang, F.; Wang, K. [Harbin Institute of Technology, Harbin (China)
2011-05-15
A two-continuous mesophilic (37 {+-} 2{sup o}C) UASB system with step-feed was investigated as an attractive optimization strategy for enhancing COD and total phenols removal of the system and improving aerobic biodegradability of real coal gasification wastewater. Through the step-feed period, the maximum removal efficiencies of COD and total phenols reached 55-60% and 58-63% respectively in the system, at an influent flow distribution ratio of 0.2 and influent COD concentration of 2500 mg/L; the corresponding efficiencies were at low levels of 45-50% and 43-50% respectively at total HRT of 48 h during the single-feed period. The maximum specific methanogenic activity and substrate utilization rate were 592 {+-} 16 mg COD-CH{sub 4}/(gVSS d) and 89 {+-} 12 mg phenol/(gVSS d) during the step-feed operation. After the anaerobic digestion with step-feed, the aerobic effluent COD concentration decreased from 270 {+-} 9 to 215 {+-} 10 mg/L. The results suggested that step-feed enhanced the degradation of refractory organics in the second reactor.
A novel atmospheric tritium sampling system
Qin, Lailai; Xia, Zhenghai; Gu, Shaozhong; Zhang, Dongxun; Bao, Guangliang; Han, Xingbo; Ma, Yuhua; Deng, Ke; Liu, Jiayu; Zhang, Qin; Ma, Zhaowei; Yang, Guo; Liu, Wei; Liu, Guimin
2018-06-01
The health hazard of tritium is related to its chemical form. Sampling different chemical forms of tritium simultaneously becomes significant. Here a novel atmospheric tritium sampling system (TS-212) was developed to collect the tritiated water (HTO), tritiated hydrogen (HT) and tritiated methane (CH3T) simultaneously. It consisted of an air inlet system, three parallel connected sampling channels, a hydrogen supply module, a methane supply module and a remote control system. It worked at air flow rate of 1 L/min to 5 L/min, with temperature of catalyst furnace at 200 °C for HT sampling and 400 °C for CH3T sampling. Conversion rates of both HT and CH3T to HTO were larger than 99%. The collecting efficiency of the two-stage trap sets for HTO was larger than 96% in 12 h working-time without being blocked. Therefore, the collected efficiencies of TS-212 are larger than 95% for tritium with different chemical forms in environment. Besides, the remote control system made sampling more intelligent, reducing the operator's work intensity. Based on the performance parameters described above, the TS-212 can be used to sample atmospheric tritium in different chemical forms.
Hollander R.J.M. den; Bouma, H.; Rest, J.H.C. van; Hove, J.M. ten; Haar, F.B. ter; Burghouts, G.J.
2017-01-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS
Sewage sludge solubilization by high-pressure homogenization.
Zhang, Yuxuan; Zhang, Panyue; Guo, Jianbin; Ma, Weifang; Fang, Wei; Ma, Boqiang; Xu, Xiangzhe
2013-01-01
The behavior of sludge solubilization using high-pressure homogenization (HPH) treatment was examined by investigating the sludge solid reduction and organics solubilization. The sludge volatile suspended solids (VSS) decreased from 10.58 to 6.67 g/L for the sludge sample with a total solids content (TS) of 1.49% after HPH treatment at a homogenization pressure of 80 MPa with four homogenization cycles; total suspended solids (TSS) correspondingly decreased from 14.26 to 9.91 g/L. About 86.15% of the TSS reduction was attributed to the VSS reduction. The increase of homogenization pressure from 20 to 80 MPa or homogenization cycle number from 1 to 4 was favorable to the sludge organics solubilization, and the protein and polysaccharide solubilization linearly increased with the soluble chemical oxygen demand (SCOD) solubilization. More proteins were solubilized than polysaccharides. The linear relationship between SCOD solubilization and VSS reduction had no significant change under different homogenization pressures, homogenization cycles and sludge solid contents. The SCOD of 1.65 g/L was solubilized for the VSS reduction of 1.00 g/L for the three experimental sludge samples with a TS of 1.00, 1.49 and 2.48% under all HPH operating conditions. The energy efficiency results showed that the HPH treatment at a homogenization pressure of 30 MPa with a single homogenization cycle for the sludge sample with a TS of 2.48% was the most energy efficient.
Two-Stage Variable Sample-Rate Conversion System
Tkacenko, Andre
2009-01-01
A two-stage variable sample-rate conversion (SRC) system has been pro posed as part of a digital signal-processing system in a digital com munication radio receiver that utilizes a variety of data rates. The proposed system would be used as an interface between (1) an analog- todigital converter used in the front end of the receiver to sample an intermediatefrequency signal at a fixed input rate and (2) digita lly implemented tracking loops in subsequent stages that operate at v arious sample rates that are generally lower than the input sample r ate. This Two-Stage System would be capable of converting from an input sample rate to a desired lower output sample rate that could be var iable and not necessarily a rational fraction of the input rate.
RaPToRS Sample Delivery System
Henchen, Robert; Shibata, Kye; Krieger, Michael; Pogozelski, Edward; Padalino, Stephen; Glebov, Vladimir; Sangster, Craig
2010-11-01
At various labs (NIF, LLE, NRL), activated material samples are used to measure reaction properties. The Rapid Pneumatic Transport of Radioactive Samples (RaPToRS) system quickly and safely moves these radioactive samples through a closed PVC tube via airflow. The carrier travels from the reaction chamber to the control and analysis station, pneumatically braking at the outlet. A reversible multiplexer routes samples from various locations near the shot chamber to the analysis station. Also, the multiplexer allows users to remotely load unactivated samples without manually approaching the reaction chamber. All elements of the system (pneumatic drivers, flow control valves, optical position sensors, multiplexers, Geiger counters, and release gates at the analysis station) can be controlled manually or automatically using a custom LabVIEW interface. A prototype is currently operating at NRL in Washington DC. Prospective facilities for Raptors systems include LLE and NIF.
On sampling and modeling complex systems
International Nuclear Information System (INIS)
Marsili, Matteo; Mastromatteo, Iacopo; Roudi, Yasser
2013-01-01
The study of complex systems is limited by the fact that only a few variables are accessible for modeling and sampling, which are not necessarily the most relevant ones to explain the system behavior. In addition, empirical data typically undersample the space of possible states. We study a generic framework where a complex system is seen as a system of many interacting degrees of freedom, which are known only in part, that optimize a given function. We show that the underlying distribution with respect to the known variables has the Boltzmann form, with a temperature that depends on the number of unknown variables. In particular, when the influence of the unknown degrees of freedom on the known variables is not too irregular, the temperature decreases as the number of variables increases. This suggests that models can be predictable only when the number of relevant variables is less than a critical threshold. Concerning sampling, we argue that the information that a sample contains on the behavior of the system is quantified by the entropy of the frequency with which different states occur. This allows us to characterize the properties of maximally informative samples: within a simple approximation, the most informative frequency size distributions have power law behavior and Zipf’s law emerges at the crossover between the under sampled regime and the regime where the sample contains enough statistics to make inferences on the behavior of the system. These ideas are illustrated in some applications, showing that they can be used to identify relevant variables or to select the most informative representations of data, e.g. in data clustering. (paper)
A Consistent System for Coding Laboratory Samples
Sih, John C.
1996-07-01
A formal laboratory coding system is presented to keep track of laboratory samples. Preliminary useful information regarding the sample (origin and history) is gained without consulting a research notebook. Since this system uses and retains the same research notebook page number for each new experiment (reaction), finding and distinguishing products (samples) of the same or different reactions becomes an easy task. Using this system multiple products generated from a single reaction can be identified and classified in a uniform fashion. Samples can be stored and filed according to stage and degree of purification, e.g. crude reaction mixtures, recrystallized samples, chromatographed or distilled products.
Sliding Modes after the First Decade of the 21st Century State of the Art
Moreno, Jaime; Iriarte, Rafael
2012-01-01
The book presents the newest results of the major world research groups working in the area of Variable Structure Systems and Sliding Mode Control (VSS/SMC). The research activity of these groups is coordinated by the IEEE Technical Committee on Variable Structure Systems (VSS) and Sliding Modes (SM). The presented results include the reports of the research groups collaborating in a framework of the Unión European Union – México project of Fondo de Cooperación Internacional en Ciencia y Tecnología (FONCICyT) 93302 titled "Automatization and Monitoring of Energy Production Processes via Sliding Mode Control". The book starts with the overview of the sliding mode control concepts and algorithms that were developed and discussed in the last two decades The research papers are combined in three sections: Part I: VSS and SM Algorithms and their Analysis Part II: SMC Design Part III: Applications of VSS and SMC The book will be of interests of engineers, researchers and graduate students working in the area ...
Use of robotic systems for radiochemical sample changing and for analytical sample preparation
International Nuclear Information System (INIS)
Delmastro, J.R.; Hartenstein, S.D.; Wade, M.A.
1989-01-01
Two uses of the Perkin-Elmer (PE) robotic system will be presented. In the first, a PE robot functions as an automatic sample changer for up to five low energy photon spectrometry (LEPS) detectors operated with a Nuclear Data ND 6700 system. The entire system, including the robot, is controlled by an IBM PC-AT using software written in compiled BASIC. Problems associated with the development of the system and modifications to the robot will be presented. In the second, an evaluation study was performed to assess the abilities of the PE robotic system for performing complex analytical sample preparation procedures. For this study, a robotic system based upon the PE robot and auxiliary devices was constructed and programmed to perform the preparation of final product samples (UO 3 ) for accountability and impurity specification analyses. These procedures require sample dissolution, dilution, and liquid-liquid extraction steps. The results of an in-depth evaluation of all system components will be presented
Air sampling system for airborne surveys
International Nuclear Information System (INIS)
Jupiter, C.; Tipton, W.J.
1975-01-01
An air sampling system has been designed for installation on the Beechcraft King Air A-100 aircraft as a part of the Aerial Radiological Measuring System (ARMS). It is intended for both particle and whole gas sampling. The sampling probe is designed for isokinetic sampling and is mounted on a removable modified escape hatch cover, behind the co-pilot's seat, and extends about two feet forward of the hatch cover in the air stream lines. Directly behind the sampling probe inside the modified hatch cover is an expansion chamber, space for a 5-inch diameter filter paper cassette, and an optional four-stage cascade impactor for particle size distribution measurements. A pair of motors and blower pumps provide the necessary 0.5 atmosphere pressure across the type MSA 1106 B glass fiber filter paper to allow a flow rate of 50 cfm. The MSA 1106 B filter paper is designed to trap sub-micrometer particles with a high efficiency; it was chosen to enable a quantitative measurement of airborne radon daughters, one of the principal sources of background signals when radiological surveys are being performed. A venturi section and pressure gauges allow air flow rate measurements so that airborne contaminant concentrations may be quantified. A whole gas sampler capable of sampling a cubic meter of air is mounted inside the aircraft cabin. A nuclear counting system on board the aircraft provides capability for α, β and γ counting of filter paper samples. Design data are presented and types of survey missions which may be served by this system are described
Systems and methods for self-synchronized digital sampling
Samson, Jr., John R. (Inventor)
2008-01-01
Systems and methods for self-synchronized data sampling are provided. In one embodiment, a system for capturing synchronous data samples is provided. The system includes an analog to digital converter adapted to capture signals from one or more sensors and convert the signals into a stream of digital data samples at a sampling frequency determined by a sampling control signal; and a synchronizer coupled to the analog to digital converter and adapted to receive a rotational frequency signal from a rotating machine, wherein the synchronizer is further adapted to generate the sampling control signal, and wherein the sampling control signal is based on the rotational frequency signal.
Choi, Ja Young; Park, Jieun; Choi, Yoon Seong; Goh, Yu Ra; Park, Eun Sook
2018-07-01
The aim of the present study was to investigate communication function using classification systems and its association with other functional profiles, including gross motor function, manual ability, intellectual functioning, and brain magnetic resonance imaging (MRI) characteristics in children with cerebral palsy (CP). This study recruited 117 individuals with CP aged from 4 to 16 years. The Communication Function Classification System (CFCS), Viking Speech Scale (VSS), Speech Language Profile Groups (SLPG), Gross Motor Function Classification System (GMFCS), Manual Ability Classification System (MACS), and intellectual functioning were assessed in the children along with brain MRI categorization. Very strong relationships were noted among the VSS, CFCS, and SLPG, although these three communication systems provide complementary information, especially for children with mid-range communication impairment. These three communication classification systems were strongly related with the MACS, but moderately related with the GMFCS. Multiple logistic regression analysis indicated that manual ability and intellectual functioning were significantly related with VSS and CFCS function, whereas only intellectual functioning was significantly related with SLPG functioning in children with CP. Communication function in children with a periventricular white matter lesion (PVWL) varied widely. In the cases with a PVWL, poor functioning was more common on the SLPG, compared to the VSS and CFCS. Very strong relationships were noted among three communication classification systems that are closely related with intellectual ability. Compared to gross motor function, manual ability seemed more closely related with communication function in these children. © Copyright: Yonsei University College of Medicine 2018.
International Nuclear Information System (INIS)
Savarkar, V.K.; Mishra, A.K.; Bajpai, D.D.; Nair, M.K.T.
1990-01-01
The present generation of reprocessing plants have sampling and delivery systems that have to be operated manually with its associated problems. The complete automation and remotisation of sampling system has hence been considered to reduce manual intervention and personnel exposure. As a part of this scheme an attempt to automate and remotise various steps in sampling system has been made. This paper discusses in detail the development work carried out in this area as well as the tests conducted to incorporate the same in the existing plants. (author). 3 figs
Water sample-collection and distribution system
Brooks, R. R.
1978-01-01
Collection and distribution system samples water from six designated stations, filtered if desired, and delivers it to various analytical sensors. System may be controlled by Water Monitoring Data Acquisition System or operated manually.
PETA KENDALI X DENGAN UKURAN SAMPEL DAN INTERVAL PENGAMBILAN SAMPEL YANG BERVARIASI
Directory of Open Access Journals (Sweden)
Tanti Octavia
2000-01-01
Full Text Available Shewhart X chart is widely used in statistical process control for monitoring variable data and has shown good performance in detecting large mean shift but less sensitive in detecting moderate to small process shift. X chart with variable sample size and sampling interval (VSSI X chart is proposed to enhance the ability of detecting moderate to small process shift. The performance of VSSI X chart is compared with those of Shewhart X chart, VSS X chart (Variable Sample Size X chart and VSI X chart (Variable Sampling Interval X chart. Performance of these control charts is presented in the form of ATS (Average Time to Signal which is obtained from computer simulation and markov chain approach. The VSSI X chart shows better performance in detecting moderate mean shift. The simulation is then continued for VSSI X chart and VSS X chart with minimum sample size n 1=1 and n 1=2. Abstract in Bahasa Indonesia : Peta kendali X Shewhart telah umum digunakan dalam pengendalian proses statistis untuk data variabel dan terbukti berfungsi dengan baik untuk mendeteksi pergeseran rerata yang besar, namun kurang cepat dalam mendeteksi pergeseran rerata yang sedang hingga kecil. Untuk mengatasi kelemahan ini, diusulkan penggunaan peta kendali X dengan ukuran sampel dan interval pengambilan sampel yang bervariasi (peta kendali VSSI. Kinerja peta kendali X VSSI dibandingkan dengan kinerja peta kendali Shewhart, peta kendali X VSS (peta kendali X dengan ukuran sampel yang bervariasi, dan peta kendali X VSI (peta kendali X dengan interval waktu pengambilan sampel yang bervariasi. Kinerja peta kendali dinyatakan dalam nilai ATS (Average Time to Signal yang didapatkan dari hasil simulasi program komputer maupun perhitungan Rantai Markov. Peta kendali X VSSI terbukti mempunyai kinerja yang lebih baik dalam mendeteksi pergeseran rerata yang sedang. Selain itu juga disimulasikan penggunaan peta kendali X VSSI dan peta kendali X VSS dengan ukuran sampel minimum n1=1 dan n1
Active Fault Diagnosis in Sampled-data Systems
DEFF Research Database (Denmark)
Niemann, Hans Henrik; Poulsen, Niels Kjølstad
2015-01-01
The focus in this paper is on active fault diagnosis (AFD) in closed-loop sampleddata systems. Applying the same AFD architecture as for continuous-time systems does not directly result in the same set of closed-loop matrix transfer functions. For continuous-time systems, the LFT (linear fractional...... transformation) structure in the connection between the parametric faults and the matrix transfer function (also known as the fault signature matrix) applied for AFD is not directly preserved for sampled-data system. As a consequence of this, the AFD methods cannot directly be applied for sampled-data systems....... Two methods are considered in this paper to handle the fault signature matrix for sampled-data systems such that standard AFD methods can be applied. The first method is based on a discretization of the system such that the LFT structure is preserved resulting in the same LFT structure in the fault...
Importance sampling of rare events in chaotic systems
DEFF Research Database (Denmark)
Leitão, Jorge C.; Parente Lopes, João M.Viana; Altmann, Eduardo G.
2017-01-01
space of chaotic systems. As examples of our general framework we compute the distribution of finite-time Lyapunov exponents (in different chaotic maps) and the distribution of escape times (in transient-chaos problems). Our methods sample exponentially rare states in polynomial number of samples (in......Finding and sampling rare trajectories in dynamical systems is a difficult computational task underlying numerous problems and applications. In this paper we show how to construct Metropolis-Hastings Monte-Carlo methods that can efficiently sample rare trajectories in the (extremely rough) phase...... both low- and high-dimensional systems). An open-source software that implements our algorithms and reproduces our results can be found in reference [J. Leitao, A library to sample chaotic systems, 2017, https://github.com/jorgecarleitao/chaospp]....
Brooks, R. L. (Inventor)
1979-01-01
A multipoint fluid sample collection and distribution system is provided wherein the sample inputs are made through one or more of a number of sampling valves to a progressive cavity pump which is not susceptible to damage by large unfiltered particles. The pump output is through a filter unit that can provide a filtered multipoint sample. An unfiltered multipoint sample is also provided. An effluent sample can be taken and applied to a second progressive cavity pump for pumping to a filter unit that can provide one or more filtered effluent samples. The second pump can also provide an unfiltered effluent sample. Means are provided to periodically back flush each filter unit without shutting off the whole system.
Performance test of SAUNA xenon mobile sampling system
International Nuclear Information System (INIS)
Hu Dan; Yang Bin; Yang Weigeng; Jia Huaimao; Wang Shilian; Li Qi; Zhao Yungang; Fan Yuanqing; Chen Zhanying; Chang Yinzhong; Liu Shujiang; Zhang Xinjun; Wang Jun
2011-01-01
In this article, the structure and basic functions of SAUNA noble gas xenon mobile sampling system are introduced. The sampling capability of this system is about 2.2 mL per day, as a result from a 684-h operation. The system can be transported to designated locations conveniently to collect xenon sample for routine or emergency environment monitoring. (authors)
Chan, S.; Lehnert, K. A.; Coleman, R. J.
2011-12-01
SESAR, the System for Earth Sample Registration, is an online registry for physical samples collected for Earth and environmental studies. SESAR generates and administers the International Geo Sample Number IGSN, a unique identifier for samples that is dramatically advancing interoperability amongst information systems for sample-based data. SESAR was developed to provide the complete range of registry services, including definition of IGSN syntax and metadata profiles, registration and validation of name spaces requested by users, tools for users to submit and manage sample metadata, validation of submitted metadata, generation and validation of the unique identifiers, archiving of sample metadata, and public or private access to the sample metadata catalog. With the development of SESAR v3, we placed particular emphasis on creating enhanced tools that make metadata submission easier and more efficient for users, and that provide superior functionality for users to manage metadata of their samples in their private workspace MySESAR. For example, SESAR v3 includes a module where users can generate custom spreadsheet templates to enter metadata for their samples, then upload these templates online for sample registration. Once the content of the template is uploaded, it is displayed online in an editable grid format. Validation rules are executed in real-time on the grid data to ensure data integrity. Other new features of SESAR v3 include the capability to transfer ownership of samples to other SESAR users, the ability to upload and store images and other files in a sample metadata profile, and the tracking of changes to sample metadata profiles. In the next version of SESAR (v3.5), we will further improve the discovery, sharing, registration of samples. For example, we are developing a more comprehensive suite of web services that will allow discovery and registration access to SESAR from external systems. Both batch and individual registrations will be possible
Directory of Open Access Journals (Sweden)
Lee Tae-Hoon
2016-12-01
Full Text Available In many cases, a X¯$\\overline X $ control chart based on a performance variable is used in industrial fields. Typically, the control chart monitors the measurements of a performance variable itself. However, if the performance variable is too costly or impossible to measure, and a less expensive surrogate variable is available, the process may be more efficiently controlled using surrogate variables. In this paper, we present a model for the economic statistical design of a VSI (Variable Sampling Interval X¯$\\overline X $ control chart using a surrogate variable that is linearly correlated with the performance variable. We derive the total average profit model from an economic viewpoint and apply the model to a Very High Temperature Reactor (VHTR nuclear fuel measurement system and derive the optimal result using genetic algorithms. Compared with the control chart based on a performance variable, the proposed model gives a larger expected net income per unit of time in the long-run if the correlation between the performance variable and the surrogate variable is relatively high. The proposed model was confined to the sample mean control chart under the assumption that a single assignable cause occurs according to the Poisson process. However, the model may also be extended to other types of control charts using a single or multiple assignable cause assumptions such as VSS (Variable Sample Size X¯$\\overline X $ control chart, EWMA, CUSUM charts and so on.
Consensus of heterogeneous multi-agent systems based on sampled data with a small sampling delay
International Nuclear Information System (INIS)
Wang Na; Wu Zhi-Hai; Peng Li
2014-01-01
In this paper, consensus problems of heterogeneous multi-agent systems based on sampled data with a small sampling delay are considered. First, a consensus protocol based on sampled data with a small sampling delay for heterogeneous multi-agent systems is proposed. Then, the algebra graph theory, the matrix method, the stability theory of linear systems, and some other techniques are employed to derive the necessary and sufficient conditions guaranteeing heterogeneous multi-agent systems to asymptotically achieve the stationary consensus. Finally, simulations are performed to demonstrate the correctness of the theoretical results. (interdisciplinary physics and related areas of science and technology)
Disintegration impact on sludge digestion process.
Dauknys, Regimantas; Rimeika, Mindaugas; Jankeliūnaitė, Eglė; Mažeikienė, Aušra
2016-11-01
The anaerobic sludge digestion is a widely used method for sludge stabilization in wastewater treatment plant. This process can be improved by applying the sludge disintegration methods. As the sludge disintegration is not investigated enough, an analysis of how the application of thermal hydrolysis affects the sludge digestion process based on full-scale data was conducted. The results showed that the maximum volatile suspended solids (VSS) destruction reached the value of 65% independently on the application of thermal hydrolysis. The average VSS destruction increased by 14% when thermal hydrolysis was applied. In order to have the maximum VSS reduction and biogas production, it is recommended to keep the maximum defined VSS loading of 5.7 kg VSS/m(3)/d when the thermal hydrolysis is applied and to keep the VSS loading between 2.1-2.4 kg VSS/m(3)/d when the disintegration of sludge is not applied. The application of thermal hydrolysis leads to an approximately 2.5 times higher VSS loading maintenance comparing VSS loading without the disintegration; therefore, digesters with 1.8 times smaller volume is required.
ACS sampling system: design, implementation, and performance evaluation
Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca
2004-09-01
By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.
Sampling system for a boiling reactor NPP
International Nuclear Information System (INIS)
Zabelin, A.I.; Yakovleva, E.D.; Solov'ev, Yu.A.
1976-01-01
Investigations and pilot running of the nuclear power plant with a VK-50 boiling reactor reveal the necessity of normalizing the design system of water sampling and of mandatory replacement of the needle-type throttle device by a helical one. A method for designing a helical throttle device has been worked out. The quantitative characteristics of depositions of corrosion products along the line of reactor water sampling are presented. Recommendations are given on the organizaton of the sampling system of a nuclear power plant with BWR type reactors
ANL small-sample calorimeter system design and operation
International Nuclear Information System (INIS)
Roche, C.T.; Perry, R.B.; Lewis, R.N.; Jung, E.A.; Haumann, J.R.
1978-07-01
The Small-Sample Calorimetric System is a portable instrument designed to measure the thermal power produced by radioactive decay of plutonium-containing fuels. The small-sample calorimeter is capable of measuring samples producing power up to 32 milliwatts at a rate of one sample every 20 min. The instrument is contained in two packages: a data-acquisition module consisting of a microprocessor with an 8K-byte nonvolatile memory, and a measurement module consisting of the calorimeter and a sample preheater. The total weight of the system is 18 kg
den Hollander, Richard J. M.; Bouma, Henri; van Rest, Jeroen H. C.; ten Hove, Johan-Martijn; ter Haar, Frank B.; Burghouts, Gertjan J.
2017-10-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS with analytics needs careful configuration and prompt maintenance to avoid false alarms. However, there is a trend from static VSS consisting of fixed CCTV cameras towards more dynamic VSS deployments over public/private multi-organization networks, consisting of a wider variety of visual sensors, including pan-tilt-zoom (PTZ) cameras, body-worn cameras and cameras on moving platforms. This trend will lead to more dynamic scenes and more frequent changes in the optical chain, creating structural problems for analytics. If these problems are not adequately addressed, analytics will not be able to continue to meet end users' developing needs. In this paper, we present a three-part solution for managing the performance of complex analytics deployments. The first part is a register containing meta data describing relevant properties of the optical chain, such as intrinsic and extrinsic calibration, and parameters of the scene such as lighting conditions or measures for scene complexity (e.g. number of people). A second part frequently assesses these parameters in the deployed VSS, stores changes in the register, and signals relevant changes in the setup to the VSS administrator. A third part uses the information in the register to dynamically configure analytics tasks based on VSS operator input. In order to support the feasibility of this solution, we give an overview of related state-of-the-art technologies for autocalibration (self-calibration), scene recognition and lighting estimation in relation to person detection. The presented solution allows for rapid and robust deployment of Video Content Analysis (VCA) tasks in large scale ad-hoc networks.
On Converting Secret Sharing Scheme to Visual Secret Sharing Scheme
Directory of Open Access Journals (Sweden)
Wang Daoshun
2010-01-01
Full Text Available Abstract Traditional Secret Sharing (SS schemes reconstruct secret exactly the same as the original one but involve complex computation. Visual Secret Sharing (VSS schemes decode the secret without computation, but each share is m times as big as the original and the quality of the reconstructed secret image is reduced. Probabilistic visual secret sharing (Prob.VSS schemes for a binary image use only one subpixel to share the secret image; however the probability of white pixels in a white area is higher than that in a black area in the reconstructed secret image. SS schemes, VSS schemes, and Prob. VSS schemes have various construction methods and advantages. This paper first presents an approach to convert (transform a -SS scheme to a -VSS scheme for greyscale images. The generation of the shadow images (shares is based on Boolean XOR operation. The secret image can be reconstructed directly by performing Boolean OR operation, as in most conventional VSS schemes. Its pixel expansion is significantly smaller than that of VSS schemes. The quality of the reconstructed images, measured by average contrast, is the same as VSS schemes. Then a novel matrix-concatenation approach is used to extend the greyscale -SS scheme to a more general case of greyscale -VSS scheme.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS. PMID:27574507
296-B-10 stack monitoring and sampling system annual system assessment report
International Nuclear Information System (INIS)
Ridge, T.M.
1995-01-01
B Plant Administration Manual, requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with stack 296-B-10 at B Plant. The ventilation system of WESF (Waste Encapsulation and Storage Facility) is designed to provide airflow patterns so that air movement throughout the building is from areas of lesser radioactivity to areas of greater radioactivity. All potentially contaminated areas are maintained at a negative pressure with respect to the atmosphere so that air flows into the building at all times. The exhaust discharging through the 296-B-10 stack is continuously monitored and sampled using a sampling and monitoring probe assembly located approximately 17.4 meters (57 feet) above the base of the stack. The probe assembly consists of 5 nozzles for the sampling probe and 2 nozzles to monitor the flow. The sampling and monitoring system associated with Stack 296-B-10 is functional and performing satisfactorily
Sampled-data models for linear and nonlinear systems
Yuz, Juan I
2014-01-01
Sampled-data Models for Linear and Nonlinear Systems provides a fresh new look at a subject with which many researchers may think themselves familiar. Rather than emphasising the differences between sampled-data and continuous-time systems, the authors proceed from the premise that, with modern sampling rates being as high as they are, it is becoming more appropriate to emphasise connections and similarities. The text is driven by three motives: · the ubiquity of computers in modern control and signal-processing equipment means that sampling of systems that really evolve continuously is unavoidable; · although superficially straightforward, sampling can easily produce erroneous results when not treated properly; and · the need for a thorough understanding of many aspects of sampling among researchers and engineers dealing with applications to which they are central. The authors tackle many misconceptions which, although appearing reasonable at first sight, are in fact either p...
296-B-5 Stack monitoring and sampling system annual system assessment report
International Nuclear Information System (INIS)
Ridge, T.M.
1995-02-01
The B Plant Administration Manual requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with Stack 296-B-5 at B Plant. The sampling and monitoring system associated with stack 296-B-5 is functional and performing satisfactorily. This document is an annual assessment report of the systems associated with the 296-B-5 stack
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R L; Fernandes, L; Sun, X [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1994-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R.L.; Fernandes, L.; Sun, X. [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1993-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
An improved sampling system installed for reprocessing
International Nuclear Information System (INIS)
Finsterwalder, L.; Zeh, H.
1979-03-01
Sampling devices are needed for taking representative samples from individual process containers during the reprocessing of irradiated fuel. The aqueous process stream in a reprocessing plant frequently contains, in addition to the dissolved radioactive materials, more or less small quantities of solid matter fraction of fuel material still remaining undissolved, insoluble fission-, corrosion-, or degradation products as well, in exceptional cases, ion exchange resin or silica gel. The solid matter is deposited partly on the upper surfaces of the sampling system and the radiation due to this makes maintenance and repair of the sampler more difficult. The purpose of the development work was to reduce the chance of accident and the maintenance costs and to lower the radiation exposure of the personnel. A new sampling system was developed and is described. (author)
Directory of Open Access Journals (Sweden)
Qin Guo-jie
2014-08-01
Full Text Available Sample-time errors can greatly degrade the dynamic range of a time-interleaved sampling system. In this paper, a novel correction technique employing a cubic spline interpolation is proposed for inter-channel sample-time error compensation. The cubic spline interpolation compensation filter is developed in the form of a finite-impulse response (FIR filter structure. The correction method of the interpolation compensation filter coefficients is deduced. A 4GS/s two-channel, time-interleaved ADC prototype system has been implemented to evaluate the performance of the technique. The experimental results showed that the correction technique is effective to attenuate the spurious spurs and improve the dynamic performance of the system.
Sampling from a system-theoretic viewpoint
Meinsma, Gjerrit; Mirkin, Leonid
2009-01-01
This paper studies a system-theoretic approach to the problem of reconstructing an analog signal from its samples. The idea, borrowed from earlier treatments in the control literature, is to address the problem as a hybrid model-matching problem in which performance is measured by system norms. The
Li-dong, Shen; An-hui, Hu; Ren-cun, Jin; Dong-qing, Cheng; Ping, Zheng; Xiang-yang, Xu; Bao-lan, Hu
2012-01-15
Three activated sludges from a landfill leachate treatment plant (S1), a municipal sewage treatment plant (S2) and a monosodium glutamate (MSG) wastewater treatment plant (S3) were used as inocula to enrich anaerobic ammonium oxidation (anammox) bacteria for the startup of MSG industrial wastewater treatment system. After 360 days of cultivation using MSG wastewater, obvious anammox activity was observed in all three cultures. The maximum specific anammox activities of cultures S1, S2 and S3 were 0.11 kg N kg(-1) VSS day(-1), 0.09 kg N kg(-1) VSS day(-1) and 0.16 kg N kg(-1) VSS day(-1), respectively. Brownish-red anammox granules having diameters in the range of 0.2-1.0mm were visible in cultures S1 and S2, and large red granules having diameters in the range of 0.5-2.5mm were formed in culture S3 after 420 days of cultivation. Phylogenetic analysis of 16S rRNA genes showed that Kuenenia organisms were the dominant anammox species in all three cultures. The copy numbers of 16S rRNA genes of anammox bacteria in cultures S1, S2 and S3 were 6.8 × 10(7) copies mL(-1), 9.4 × 10(7) copies mL(-1) and 7.5 × 10(8) copies mL(-1), respectively. The results of this study demonstrated that anammox cultivation from conventional activated sludges was highly possible using MSG wastewater. Thus the anammox process has possibility of applying to the nitrogen removal from MSG wastewater. Copyright © 2011 Elsevier B.V. All rights reserved.
Sampled Data Systems Passivity and Discrete Port-Hamiltonian Systems
Stramigioli, Stefano; Secchi, Cristian; Schaft, Arjan J. van der; Fantuzzi, Cesare
2005-01-01
In this paper, we present a novel way to approach the interconnection of a continuous and a discrete time physical system. This is done in a way which preserves passivity of the coupled system independently of the sampling time T. This strategy can be used both in the field of telemanipulation, for
A THz Tomography System for Arbitrarily Shaped Samples
Stübling, E.; Bauckhage, Y.; Jelli, E.; Fischer, B.; Globisch, B.; Schell, M.; Heinrich, A.; Balzer, J. C.; Koch, M.
2017-10-01
We combine a THz time-domain spectroscopy system with a robotic arm. With this scheme, the THz emitter and receiver can be positioned perpendicular and at defined distance to the sample surface. Our system allows the acquisition of reflection THz tomographic images of samples with an arbitrarily shaped surface.
Indigenous development of automated metallographic sample preparation system
International Nuclear Information System (INIS)
Kulkarni, A.P.; Pandit, K.M.; Deshmukh, A.G.; Sahoo, K.C.
2005-01-01
Surface preparation of specimens for Metallographic studies on irradiated material involves a lot of remote handling of radioactive material by skilled manpower. These are laborious and man-rem intensive activities and put limitations on number of samples that can be prepared for the metallographic studies. To overcome these limitations, automated systems have been developed for surface preparation of specimens in PIE division. The system includes (i) Grinding and polishing stations (ii) Water jet cleaning station (iii) Ultrasonic cleaning stations (iv) Drying station (v) Sample loading and unloading station (vi) Dispenser for slurries and diluents and (vii) Automated head for movement of the sample holder disc from one station to other. System facilities the operator for programming/changing sequence of the sample preparations including remote changing of grinding/polishing discs from the stations. Two such systems have been installed and commissioned in Hot Cell for PIE Division. These are being used for preparation of irradiated samples from nuclear fuels and structural components. This development has increased the throughput of metallography work and savings in terms of (man-severts) radiation exposure to operators. This presentation will provide details of the challenges in undertaking this developmental work. (author)
Directory of Open Access Journals (Sweden)
Mateusz Gola
2016-08-01
Full Text Available There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS for human sexuality studies, including emerging field of research on compulsive sexual behaviors. A central question in this field is whether behaviors such as extensive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned (cue and unconditioned (reward stimuli (related to reward anticipation vs reward consumption, respectively. Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as cues (conditioned stimuli or rewards (unconditioned stimuli. Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward (unconditioned stimuli, as evidenced by: 1. experience of pleasure while watching VSS, possibly accompanied by genital reaction 2. reward-related brain activity correlated with these pleasurable feelings in response to VSS, 3. a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money, and/or 4. conditioning for cues (CS predictive for. We hope that this perspective paper will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Water and steam sampling systems; Provtagningssystem foer vatten och aanga
Energy Technology Data Exchange (ETDEWEB)
Hellman, Mats
2009-10-15
The supervision of cycle chemistry can be divided into two parts, the sampling system and the chemical analysis. In modern steam generating plants most of the chemical analyses are carried out on-line. The detection limits of these analyzers are pushed downward to the ppt-range (parts per trillion), however the analyses are not more correct than the accuracy of the sampling system. A lot of attention has been put to the analyzers and the statistics to interpret the results but the sampling procedures has gained much less attention. This report aims to give guidance of the considerations to be made regarding sampling systems. Sampling is necessary since most analysis of interesting parameters cannot be carried out in- situ on-line in the steam cycle. Today's on-line instruments for pH, conductivity, silica etc. are designed to meet a water sample at a temperature of 10-30 deg C. This means that the sampling system has to extract a representative sample from the process, transport and cool it down to room temperature without changing the characteristics of the fluid. In the literature research work, standards and other reports can be found. Although giving similar recommendations in most aspects there are some discrepancies that may be confusing. This report covers all parts in the sampling system: Sample points and nozzles; Sample lines; Valves, regulating and on-off; Sample coolers; Temperature, pressure and flow rate control; Cooling water; and Water recovery. On-line analyzers connecting to the sampling system are not covered. This report aims to clarify what guidelines are most appropriate amongst the existing ones. The report should also give guidance to the design of the sampling system in order to achieve representative samples. In addition to this the report gives an overview of the fluid mechanics involved in sampling. The target group of this report is owners and operators of steam generators, vendors of power plant equipment, consultants working in
Non-Contact Conductivity Measurement for Automated Sample Processing Systems
Beegle, Luther W.; Kirby, James P.
2012-01-01
A new method has been developed for monitoring and control of automated sample processing and preparation especially focusing on desalting of samples before analytical analysis (described in more detail in Automated Desalting Apparatus, (NPO-45428), NASA Tech Briefs, Vol. 34, No. 8 (August 2010), page 44). The use of non-contact conductivity probes, one at the inlet and one at the outlet of the solid phase sample preparation media, allows monitoring of the process, and acts as a trigger for the start of the next step in the sequence (see figure). At each step of the muti-step process, the system is flushed with low-conductivity water, which sets the system back to an overall low-conductivity state. This measurement then triggers the next stage of sample processing protocols, and greatly minimizes use of consumables. In the case of amino acid sample preparation for desalting, the conductivity measurement will define three key conditions for the sample preparation process. First, when the system is neutralized (low conductivity, by washing with excess de-ionized water); second, when the system is acidified, by washing with a strong acid (high conductivity); and third, when the system is at a basic condition of high pH (high conductivity). Taken together, this non-contact conductivity measurement for monitoring sample preparation will not only facilitate automation of the sample preparation and processing, but will also act as a way to optimize the operational time and use of consumables
A large-scale cryoelectronic system for biological sample banking
Shirley, Stephen G.; Durst, Christopher H. P.; Fuchs, Christian C.; Zimmermann, Heiko; Ihmig, Frank R.
2009-11-01
We describe a polymorphic electronic infrastructure for managing biological samples stored over liquid nitrogen. As part of this system we have developed new cryocontainers and carrier plates attached to Flash memory chips to have a redundant and portable set of data at each sample. Our experimental investigations show that basic Flash operation and endurance is adequate for the application down to liquid nitrogen temperatures. This identification technology can provide the best sample identification, documentation and tracking that brings added value to each sample. The first application of the system is in a worldwide collaborative research towards the production of an AIDS vaccine. The functionality and versatility of the system can lead to an essential optimization of sample and data exchange for global clinical studies.
Blood Sample Transportation by Pneumatic Transportation Systems
DEFF Research Database (Denmark)
Nybo, Mads; Lund, Merete E; Titlestad, Kjell
2018-01-01
BACKGROUND: Pneumatic transportation systems (PTSs) are increasingly used for transportation of blood samples to the core laboratory. Many studies have investigated the impact of these systems on different types of analyses, but to elucidate whether PTSs in general are safe for transportation...... analysis, and the hemolysis index). CONCLUSIONS: Owing to their high degree of heterogeneity, the retrieved studies were unable to supply evidence for the safety of using PTSs for blood sample transportation. In consequence, laboratories need to measure and document the actual acceleration forces...
A novel storage system for cryoEM samples.
Scapin, Giovanna; Prosise, Winifred W; Wismer, Michael K; Strickland, Corey
2017-07-01
We present here a new CryoEM grid boxes storage system designed to simplify sample labeling, tracking and retrieval. The system is based on the crystal pucks widely used by the X-ray crystallographic community for storage and shipping of crystals. This system is suitable for any cryoEM laboratory, but especially for large facilities that will need accurate tracking of large numbers of samples coming from different sources. Copyright © 2017. Published by Elsevier Inc.
Rotary Mode Core Sample System availability improvement
International Nuclear Information System (INIS)
Jenkins, W.W.; Bennett, K.L.; Potter, J.D.; Cross, B.T.; Burkes, J.M.; Rogers, A.C.
1995-01-01
The Rotary Mode Core Sample System (RMCSS) is used to obtain stratified samples of the waste deposits in single-shell and double-shell waste tanks at the Hanford Site. The samples are used to characterize the waste in support of ongoing and future waste remediation efforts. Four sampling trucks have been developed to obtain these samples. Truck I was the first in operation and is currently being used to obtain samples where the push mode is appropriate (i.e., no rotation of drill). Truck 2 is similar to truck 1, except for added safety features, and is in operation to obtain samples using either a push mode or rotary drill mode. Trucks 3 and 4 are now being fabricated to be essentially identical to truck 2
Candidate sample acquisition systems for the Rosetta
International Nuclear Information System (INIS)
Magnani, P.G.; Gerli, C.; Colombina, G.; Vielmo, P.
1989-01-01
The Comet Nucleus Sample Return (CNSR) mission, one of the four cornerstones of the ESA scientific program, is one of the most complex space ventures within the next century, both from technological and deep space exploration point of view. In the Rosetta scenario the sample acquisition phase represents the most critical point for the global mission's success. The proposed paper illustrates the main results obtained in the context of the CNSR-SAS ongoing activity. The main areas covered are related to: (1) sample properties characterization (comet soil model, physical/chemical properties, reference material for testing); (2) concepts identification for coring, shovelling, harpooning and anchoring; (3) preferred concept (trade off among concepts, identification of the preferred configuration); and (4) proposed development activity for gaining the necessary confidence before finalizing the CNSR mission. Particular emphasis will be given to the robotic and flexibility aspects of the identified sample acquisition systems (SAS) configuration, intended as a means for the overall system performance enhancement
Developing Agent-Oriented Video Surveillance System through Agent-Oriented Methodology (AOM
Directory of Open Access Journals (Sweden)
Cheah Wai Shiang
2016-12-01
Full Text Available Agent-oriented methodology (AOM is a comprehensive and unified agent methodology for agent-oriented software development. Although AOM is claimed to be able to cope with a complex system development, it is still not yet determined up to what extent this may be true. Therefore, it is vital to conduct an investigation to validate this methodology. This paper presents the adoption of AOM in developing an agent-oriented video surveillance system (VSS. An intruder handling scenario is designed and implemented through AOM. AOM provides an alternative method to engineer a distributed security system in a systematic manner. It presents the security system at a holistic view; provides a better conceptualization of agent-oriented security system and supports rapid prototyping as well as simulation of video surveillance system.
Wang, Dexin; Ma, Wencheng; Han, Hongjun; Li, Kun; Xu, Hao; Fang, Fang; Hou, Baolin; Jia, Shengyong
2016-12-01
Coupling of the Fe-C micro-electrolysis (IC-ME) into the up-flow anaerobic sludge blanket (UASB) was developed for enhanced Fischer-Tropsch wastewater treatment. The COD removal efficiency and methane production in R 3 with IC-ME assisted both reached up to 80.6 ± 1.7% and 1.38 ± 0.11 L/L·d that higher than those values in R 1 with GAC addition (63.0 ± 3.4% and 0.95 ± 0.09 L/L·d) and R 2 with ZVI addition (74.5 ± 2.8% and 1.21 ± 0.09 L/L·d) under the optimum HRT (5 d). The Fe corrosion as electron donor reduced the ORP values and stimulated the activities of hydrogenotrophic methanogens to lower H 2 partial pressure in R 2 and R 3 . Additionally, Fe 2+ as by-product of iron corrosion, its presence could effectively increase the percentage of protein content in tightly bound extracellular polymeric substances (TB-EPS) to promote better bioflocculation, increasing to 90.5 mg protein/g·VSS (R 2 ) and 106.3 mg protein/g·VSS (R 3 ) while this value in R1 was simply 56.6 mg protein/g·VSS. More importantly, compared with R 1 , the excess accumulation of propionic acid and butyric acid in system was avoided. The macroscopic galvanic cells around Fe-C micro-electrolysis carriers in R 3 , that larger than microscopic galvanic cells in R 2 , further accelerate to transfer the electrons from anodic Fe to cathodic carbon that enhance interspecies hydrogen transfer, making the decomposition of propionic acid and butyric acid more thermodynamically feasible, finally facilitate more methane production. Copyright © 2016 Elsevier Ltd. All rights reserved.
The Safeguards analysis applied to the RRP. Automatic sampling authentication system
International Nuclear Information System (INIS)
Ono, Sawako; Nakashima, Shinichi; Iwamoto, Tomonori
2004-01-01
The sampling for analysis from vessels and columns at the Rokkasho Reprocessing Plant (RRP) is performed mostly by the automatic sampling system. The safeguards sample for the verification also will be taken using these sampling systems and transfer to the OSL though the pneumatic transfer network owned and controlled by operator. In order to maintaining sample integrity and continuity of knowledge (CoK) for throughout the sample processing. It is essential to develop and establish the authentication measures for the automatic sampling system including transfer network. We have developed the Automatic Sampling Authentication System (ASAS) under consultation by IAEA. This paper describes structure, function and concept of ASAS. (author)
Balancing Public and Private Regulation
Directory of Open Access Journals (Sweden)
Martijn Scheltema
2016-01-01
Full Text Available Voluntary Sustainability Standards (VSS might develop into a viable alternative to public regulation. However, it turns on the (regulatory circumstances whether that holds true in practice. If public regulation on CSR topics is lacking, governments are unable to agree upon certain topics on a global level or diverging public regulation exists, VSS can be helpful to set global standards. Obviously, private standards will especially be helpful if they are commensurate with local public legislation (and e.g. treaties and/or are accepted by local governments. If one neglects this, numerous domestic structures might exist that frustrate VSS. Furthermore, governments have to remain vigilant as to whether these private regimes do not result in market disruption, consumer detriment or hamper trade. VSS might also compete with public arrangements which might limit the uptake of VSS. However, if public regulation exists VSS might be a viable alternative if compliance with not too compelling public norms by market participants is rather poor and the public policymaker is aiming to incentivize the better performing part of the market to embark on higher standards and thus only desires to regulate the less performing part of the market. However, of paramount importance is the effectiveness of VSS in order to be a viable alternative to public regulation. The effectiveness of VSS should be assessed using an integrated multi-disciplinary (comparative approach entailing legal, impact-assessment, legitimacy, governance and behavioural aspects. Only effective VSS in the aforementioned sense are a true alternative to public regulation.Beyond that, the legal perspective in connection with (the effectiveness of VSS is discussed, featuring FSC and UTZ Certified as an example. It is important from this perspective that VSS have a clear and sufficiently selective objective and sufficiently specific norms, are regularly evaluated, entail ‘conflict of law rules’ and
Extreme Environment Sampling System Deployment Mechanism, Phase I
National Aeronautics and Space Administration — Future Venus or Comet mission architectures may feature robotic sampling systems comprised of a Sampling Tool and Deployment Mechanism. Since 2005, Honeybee has been...
Aersol particle losses in sampling systems
International Nuclear Information System (INIS)
Fan, B.J.; Wong, F.S.; Ortiz, C.A.; Anand, N.K.; McFarland, A.R.
1993-01-01
When aerosols are sampled from stacks and ducts, it is usually necessary to transport them from the point of sampling to a location of collection or analysis. Losses of aerosol particles can occur in the inlet region of the probe, in straight horizontal and vertical tubes and in elbows. For probes in laminary flow, the Saffman lift force can cause substantial losses of particles in a short inlet region. An empirical model has been developed to predict probe inlet losses, which are often on the order of 40% for 10 μm AED particles. A user-friendly PC computer code, DEPOSITION, has been setup to model losses in transport systems. Experiments have been conducted to compare the actual aerosol particle losses in transport systems with those predicted by the DEPOSITION code
International Nuclear Information System (INIS)
Tripp, J.; Smith, T.; Law, J.
2013-01-01
A Fuel Cycle Research and Development project has investigated an innovative sampling method that could evolve into the next generation sampling and analysis system for metallic elements present in aqueous processing streams. Initially sampling technologies were evaluated and micro-fluidic sampling chip technology was selected and tested. A conceptual design for a fully automated microcapillary-based system was completed and a robotic automated sampling system was fabricated. The mechanical and sampling operation of the completed sampling system was investigated. Different sampling volumes have been tested. It appears that the 10 μl volume has produced data that had much smaller relative standard deviations than the 2 μl volume. In addition, the production of a less expensive, mass produced sampling chip was investigated to avoid chip reuse thus increasing sampling reproducibility/accuracy. The micro-fluidic-based robotic sampling system's mechanical elements were tested to ensure analytical reproducibility and the optimum robotic handling of micro-fluidic sampling chips. (authors)
Preliminary level 2 specification for the nested, fixed-depth sampling system
International Nuclear Information System (INIS)
BOGER, R.M.
1999-01-01
This preliminary Level 2 Component Specification establishes the performance, design, development, and test requirements for the in-tank sampling system which will support the BNFL contract in the final disposal of Hanford's High Level Wastes (HLW) and Low Activity Wastes (LAW). The PHMC will provide Low Activity Wastes (LAW) tank wastes for final treatment by BNFL from double-shell feed tanks. Concerns about the inability of the baseline ''grab'' sampling to provide large volume samples within time constraints has led to the development of a nested, fixed-depth sampling system. This sampling system will provide large volume? representative samples without the environmental, radiation exposure, and sample volume Impacts of the current base-line ''grab'' sampling method. This preliminary Level 2 Component Specification is not a general specification for tank sampling, but is based on a ''record of decision'', AGA (HNF-SD-TWR-AGA-001 ), the System Specification for the Double Shell Tank System (HNF-SD-WM-TRD-O07), and the BNFL privatization contract
Rapid surface sampling and archival record system (RSSAR)
International Nuclear Information System (INIS)
Barren, E.; Bracco, A.; Dorn, S.B.
1997-01-01
Purpose is to develop a rapid surface (concrete, steel) contamination measurement system that will provide a ''quick-look'' indication of contamination areas, an archival record, and an automated analysis. A bulk sampling oven is also being developed. The sampling device consists of a sampling head, a quick look detector, and an archiving system (sorbent tube). The head thermally desorbs semi-volatiles, such as PCBs, oils, etc., from concrete and steel surfaces; the volatilized materials are passed through a quick-look detector. Sensitivity of the detector can be attenuated for various contaminant levels. Volatilized materials are trapped in a tube filled with adsorbent. The tubes are housed in a magazine which also archives information about sampling conditions. Analysis of the tubes can be done at a later date. The concrete sampling head is fitted with a tungsten-halogen lamp; in laboratory experiments it has extracted model contaminants by heating the top 4mm of the surface to 250 C within 100-200 s. The steel sampling head has been tested on different types of steels and has extracted model contaminants within 30 s. A mathematical model of heat and mass transport in concrete has been developed. Rate of contaminant removal is at maximum when the moisture content is about 100 kg/m 3 . The system will be useful during decontamination and decommissioning operations
Progress with enhancing veterinary surveillance in the United Kingdom.
Lysons, R E; Gibbens, J C; Smith, L H
2007-01-27
The UK has experienced various animal health events that have had national impact in recent years. In response, a ;Veterinary Surveillance Strategy' (VSS) was published in 2003, with the objective of enhancing and coordinating national veterinary surveillance practice in a way that would enable important animal health events to be detected and assessed more rapidly and reliably. The VSS adopts an integrated UK-wide approach, which includes widespread engagement with interested parties both within government and beyond. It proposes enhancing surveillance through improved collaboration; transparent and defensible prioritisation of government resources to surveillance; deriving better value from existing resources, and assuring quality of the surveillance reports and source data. This article describes progress with implementing the VSS, in particular the methodology for developing a functional network and creating an effective, quality-assured, information management system, RADAR.
Fault tolerant controllers for sampled-data systems
DEFF Research Database (Denmark)
Niemann, Hans Henrik; Stoustrup, Jakob
2004-01-01
A general compensator architecture for fault tolerant control (FTC) for sampled-data systems is proposed. The architecture is based on the YJBK parameterization of all stabilizing controllers, and uses the dual YJBK parameterization to quantify the performance of the fault tolerant system. The FTC...
46 CFR 161.002-15 - Sample extraction smoke detection systems.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Sample extraction smoke detection systems. 161.002-15..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Fire-Protective Systems § 161.002-15 Sample extraction smoke detection systems. The smoke detecting system must consist of a means for...
Bosman, Renske; Borg, Charmaine; Jong, de Peter J.; Georgiadis, Janniko
Samenvatting Achtergrond Aan de ene kant kunnen mensen visuele seksuele stimulatie (VSS) ervaren als plezierig, maar aan de andere kant kunnen mensen VSS ook ervaren als iets “viezigs” en negatief. Dit onderzoek richt zich op de vraag hoe het brein bij vrouwen reageert op VSS en hoe de
Sampling system for in vivo ultrasound images
DEFF Research Database (Denmark)
Jensen, Jorgen Arendt; Mathorne, Jan
1991-01-01
Newly developed algorithms for processing medical ultrasound images use the high frequency sampled transducer signal. This paper describes demands imposed on a sampling system suitable for acquiring such data and gives details about a prototype constructed. It acquires full clinical images...... at a sampling frequency of 20 MHz with a resolution of 12 bits. The prototype can be used for real time image processing. An example of a clinical in vivo image is shown and various aspects of the data acquisition process are discussed....
Extraretinal induced visual sensations during IMRT of the brain.
Wilhelm-Buchstab, Timo; Buchstab, Barbara Myrthe; Leitzen, Christina; Garbe, Stephan; Müdder, Thomas; Oberste-Beulmann, Susanne; Sprinkart, Alois Martin; Simon, Birgit; Nelles, Michael; Block, Wolfgang; Schoroth, Felix; Schild, Hans Heinz; Schüller, Heinrich
2015-01-01
We observed visual sensations (VSs) in patients undergoing intensity modulated radiotherapy (IMRT) of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin. Analyzed were ten consecutive patients (aged 41-71 years) with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy) with helical tomotherapy (TT). A megavolt-CT (MVCT) was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF) matrix. Distance to the orbital roof (OR) from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient) 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm). The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%). There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
Extraretinal induced visual sensations during IMRT of the brain.
Directory of Open Access Journals (Sweden)
Timo Wilhelm-Buchstab
Full Text Available We observed visual sensations (VSs in patients undergoing intensity modulated radiotherapy (IMRT of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin.Analyzed were ten consecutive patients (aged 41-71 years with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy with helical tomotherapy (TT. A megavolt-CT (MVCT was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF matrix. Distance to the orbital roof (OR from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm. The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%.There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
On the sample transport time of a pneumatic transfer system
International Nuclear Information System (INIS)
Kondo, Yoshihide
1983-01-01
The counts accumulated in measuring system are affected by the variations in transport time of the sample on cyclic activation experiments with a mechanical sample transfer system. In use of the pneumatic transfer system, which has been set up, the transport time is variable according to the differences as follows: The form, size and weight of samples, the pneumatic pressure and so on. Comprehending the relationships between the transpot time and these variable factors is essentially important to make experiments with this transfer system. (author)
The LITA Drill and Sample Delivery System
Paulsen, G.; Yoon, S.; Zacny, K.; Wettergreeng, D.; Cabrol, N. A.
2013-12-01
The Life in the Atacama (LITA) project has a goal of demonstrating autonomous roving, sample acquisition, delivery and analysis operations in Atacama, Chile. To enable the sample handling requirement, Honeybee Robotics developed a rover-deployed, rotary-percussive, autonomous drill, called the LITA Drill, capable of penetrating to ~80 cm in various formations, capturing and delivering subsurface samples to a 20 cup carousel. The carousel has a built-in capability to press the samples within each cup, and position target cups underneath instruments for analysis. The drill and sample delivery system had to have mass and power requirements consistent with a flight system. The drill weighs 12 kg and uses less than 100 watt of power to penetrate ~80 cm. The LITA Drill auger has been designed with two distinct stages. The lower part has deep and gently sloping flutes for retaining powdered sample, while the upper section has shallow and steep flutes for preventing borehole collapse and for efficient movement of cuttings and fall back material out of the hole. The drill uses the so called 'bite-sampling' approach that is samples are taken in short, 5-10 cm bites. To take the first bite, the drill is lowered onto the ground and upon drilling of the first bite it is then retracted into an auger tube. The auger with the auger tube are then lifted off the ground and positioned next to the carousel. To deposit the sample, the auger is rotated and retracted above the auger tube. The cuttings retained on the flutes are either gravity fed or are brushed off by a passive side brush into the cup. After the sample from the first bite has been deposited, the drill is lowered back into the same hole to take the next bite. This process is repeated until a target depth is reached. The bite sampling is analogous to peck drilling in the machining process where a bit is periodically retracted to clear chips. If there is some fall back into the hole once the auger has cleared the hole, this
Design development of robotic system for on line sampling in fuel reprocessing
International Nuclear Information System (INIS)
Balasubramanian, G.R.; Venugopal, P.R.; Padmashali, G.K.
1990-01-01
This presentation describes the design and developmental work that is being carried out for the design of an automated sampling system for fast reactor fuel reprocessing plants. The plant proposes to use integrated sampling system. The sample is taken across regular process streams from any intermediate hold up pot. A robot system is planned to take the sample from the sample pot, transfer it to the sample bottle, cap the bottle and transfer the bottle to a pneumatic conveying station. The system covers a large number of sample pots. Alternate automated systems are also examined (1). (author). 4 refs., 2 figs
Directory of Open Access Journals (Sweden)
Xingang Wang
2017-11-01
Full Text Available The long-term effects of different influent Cr(VI concentrations (0–0.5 mg L−1 on the nitrification activities and microbial community structures of nitrifying activated sludge system were investigated in this study. Results showed that the performance of ammonia oxidation was significantly inhibited, and the effluent concentration of ammonia nitrogen (NH4+-N increased markedly when the influent Cr(VI loading was equal or greater than 0.2 mg L−1. The specific oxygen utilization rate (SOUR, specific ammonium oxidation rate (SAOR, and specific nitrite oxidation rate (SNOR of the system decreased from 53.24, 6.31, and 7.33 mg N g−1 VSS h−1 to 18.17, 1.68, and 2.88 mg N g−1 VSS h−1, respectively, with an increase of Cr(VI concentration from 0 to 0.5 mg L−1. The protein/polysaccharide (PN/PS ratio increased with the increasing Cr(VI concentration, indicating that excessive PN secreted by microorganisms was conducive to resisting the toxicity of Cr(VI. High-throughput sequencing revealed that the relative abundance of ammonia-oxidizing bacteria (Nitrospira and nitrite-oxidizing bacteria (Nitrosomonas and Nitrosospira all decreased with the increasing Cr(VI concentration, and ammonia-oxidizing bacteria were more sensitive to heavy metal toxicity than nitrite-oxidizing bacteria. The activities of nitrifying activated sludge system could not be completely recovered after a 30-d recovery process.
Modular microfluidic system for biological sample preparation
Rose, Klint A.; Mariella, Jr., Raymond P.; Bailey, Christopher G.; Ness, Kevin Dean
2015-09-29
A reconfigurable modular microfluidic system for preparation of a biological sample including a series of reconfigurable modules for automated sample preparation adapted to selectively include a) a microfluidic acoustic focusing filter module, b) a dielectrophoresis bacteria filter module, c) a dielectrophoresis virus filter module, d) an isotachophoresis nucleic acid filter module, e) a lyses module, and f) an isotachophoresis-based nucleic acid filter.
System Identification of a Non-Uniformly Sampled Multi-Rate System in Aluminium Electrolysis Cells
Directory of Open Access Journals (Sweden)
Håkon Viumdal
2014-07-01
Full Text Available Standard system identification algorithms are usually designed to generate mathematical models with equidistant sampling instants, that are equal for both input variables and output variables. Unfortunately, real industrial data sets are often disrupted by missing samples, variations of sampling rates in the different variables (also known as multi-rate systems, and intermittent measurements. In industries with varying events based maintenance or manual operational measures, intermittent measurements are performed leading to uneven sampling rates. Such is the case with aluminium smelters, where in addition the materials fed into the cell create even more irregularity in sampling. Both measurements and feeding are mostly manually controlled. A simplified simulation of the metal level in an aluminium electrolysis cell is performed based on mass balance considerations. System identification methods based on Prediction Error Methods (PEM such as Ordinary Least Squares (OLS, and the sub-space method combined Deterministic and Stochastic system identification and Realization (DSR, and its variants are applied to the model of a single electrolysis cell as found in the aluminium smelters. Aliasing phenomena due to large sampling intervals can be crucial in avoiding unsuitable models, but with knowledge about the system dynamics, it is easier to optimize the sampling performance, and hence achieve successful models. The results based on the simulation studies of molten aluminium height in the cells using the various algorithms give results which tally well with the synthetic data sets used. System identification on a smaller data set from a real plant is also implemented in this work. Finally, some concrete suggestions are made for using these models in the smelters.
Multi-dimensional virtual system introduced to enhance canonical sampling
Higo, Junichi; Kasahara, Kota; Nakamura, Haruki
2017-10-01
When an important process of a molecular system occurs via a combination of two or more rare events, which occur almost independently to one another, computational sampling for the important process is difficult. Here, to sample such a process effectively, we developed a new method, named the "multi-dimensional Virtual-system coupled Monte Carlo (multi-dimensional-VcMC)" method, where the system interacts with a virtual system expressed by two or more virtual coordinates. Each virtual coordinate controls sampling along a reaction coordinate. By setting multiple reaction coordinates to be related to the corresponding rare events, sampling of the important process can be enhanced. An advantage of multi-dimensional-VcMC is its simplicity: Namely, the conformation moves widely in the multi-dimensional reaction coordinate space without knowledge of canonical distribution functions of the system. To examine the effectiveness of the algorithm, we introduced a toy model where two molecules (receptor and its ligand) bind and unbind to each other. The receptor has a deep binding pocket, to which the ligand enters for binding. Furthermore, a gate is set at the entrance of the pocket, and the gate is usually closed. Thus, the molecular binding takes place via the two events: ligand approach to the pocket and gate opening. In two-dimensional (2D)-VcMC, the two molecules exhibited repeated binding and unbinding, and an equilibrated distribution was obtained as expected. A conventional canonical simulation, which was 200 times longer than 2D-VcMC, failed in sampling the binding/unbinding effectively. The current method is applicable to various biological systems.
System for Packaging Planetary Samples for Return to Earth
Badescu, Mircea; Bar-Cohen, Yoseph; Backes, paul G.; Sherrit, Stewart; Bao, Xiaoqi; Scott, James S.
2010-01-01
A system is proposed for packaging material samples on a remote planet (especially Mars) in sealed sample tubes in preparation for later return to Earth. The sample tubes (Figure 1) would comprise (1) tubes initially having open tops and closed bottoms; (2) small, bellows-like collapsible bodies inside the tubes at their bottoms; and (3) plugs to be eventually used to close the tops of the tubes. The top inner surface of each tube would be coated with solder. The side of each plug, which would fit snugly into a tube, would feature a solder-filled ring groove. The system would include equipment for storing, manipulating, filling, and sealing the tubes. The containerization system (see Figure 2) will be organized in stations and will include: the storage station, the loading station, and the heating station. These stations can be structured in circular or linear pattern to minimize the manipulator complexity, allowing for compact design and mass efficiency. The manipulation of the sample tube between stations is done by a simple manipulator arm. The storage station contains the unloaded sample tubes and the plugs before sealing as well as the sealed sample tubes with samples after loading and sealing. The chambers at the storage station also allow for plug insertion into the sample tube. At the loading station the sample is poured or inserted into the sample tube and then the tube is topped off. At the heating station the plug is heated so the solder ring melts and seals the plug to the sample tube. The process is performed as follows: Each tube is filled or slightly overfilled with sample material and the excess sample material is wiped off the top. Then, the plug is inserted into the top section of the tube packing the sample material against the collapsible bellowslike body allowing the accommodation of the sample volume. The plug and the top of the tube are heated momentarily to melt the solder in order to seal the tube.
Chen, Jiazhong; Lee, Yoomin; Oleszkiewicz, Jan A
2013-01-01
The applicability of four industrial waste streams from potato processing, canola processing and oil refining, biodiesel production (glycerol), and glycol as substitutes to methanol and ethanol in denitrification of anaerobically digested sludge dewatering liquor (centrate) was evaluated in bench-scale sequencing batch reactors. It was found that glycerol was the best substitute with the specific denitrification rate (SDNR) of 13 mg NO3-N/(g VSS x h) followed by potato processing wastewater at 12mg NO3-N/(g VSS x h). Both substrates produced faster SDNR than methanol's 10mg NO3-N/(g VSS x h); however, they were inferior to ethanol's 17 mg NO3-N/(g VSS x h). Glycol had SDNR of 8 mg NO3-N/(g VSS x h) and demonstrated a very fast acclimation rate, i.e. the response in increased denitrification rate was visible in three days following glycol addition. Canola processing and oil refining wastewater was considered an inappropriate carbon source due to a low SDNR of 5 mg NO3-N/(g VSS x h) and apparent inhibitory effect on nitrification.
Baseline Design Compliance Matrix for the Rotary Mode Core Sampling System
International Nuclear Information System (INIS)
LECHELT, J.A.
2000-01-01
The purpose of the design compliance matrix (DCM) is to provide a single-source document of all design requirements associated with the fifteen subsystems that make up the rotary mode core sampling (RMCS) system. It is intended to be the baseline requirement document for the RMCS system and to be used in governing all future design and design verification activities associated with it. This document is the DCM for the RMCS system used on Hanford single-shell radioactive waste storage tanks. This includes the Exhauster System, Rotary Mode Core Sample Trucks, Universal Sampling System, Diesel Generator System, Distribution Trailer, X-Ray Cart System, Breathing Air Compressor, Nitrogen Supply Trailer, Casks and Cask Truck, Service Trailer, Core Sampling Riser Equipment, Core Sampling Support Trucks, Foot Clamp, Ramps and Platforms and Purged Camera System. Excluded items are tools such as light plants and light stands. Other items such as the breather inlet filter are covered by a different design baseline. In this case, the inlet breather filter is covered by the Tank Farms Design Compliance Matrix
Estimation of Uncertainty in Aerosol Concentration Measured by Aerosol Sampling System
Energy Technology Data Exchange (ETDEWEB)
Lee, Jong Chan; Song, Yong Jae; Jung, Woo Young; Lee, Hyun Chul; Kim, Gyu Tae; Lee, Doo Yong [FNC Technology Co., Yongin (Korea, Republic of)
2016-10-15
FNC Technology Co., Ltd has been developed test facilities for the aerosol generation, mixing, sampling and measurement under high pressure and high temperature conditions. The aerosol generation system is connected to the aerosol mixing system which injects SiO{sub 2}/ethanol mixture. In the sampling system, glass fiber membrane filter has been used to measure average mass concentration. Based on the experimental results using main carrier gas of steam and air mixture, the uncertainty estimation of the sampled aerosol concentration was performed by applying Gaussian error propagation law. FNC Technology Co., Ltd. has been developed the experimental facilities for the aerosol measurement under high pressure and high temperature. The purpose of the tests is to develop commercial test module for aerosol generation, mixing and sampling system applicable to environmental industry and safety related system in nuclear power plant. For the uncertainty calculation of aerosol concentration, the value of the sampled aerosol concentration is not measured directly, but must be calculated from other quantities. The uncertainty of the sampled aerosol concentration is a function of flow rates of air and steam, sampled mass, sampling time, condensed steam mass and its absolute errors. These variables propagate to the combination of variables in the function. Using operating parameters and its single errors from the aerosol test cases performed at FNC, the uncertainty of aerosol concentration evaluated by Gaussian error propagation law is less than 1%. The results of uncertainty estimation in the aerosol sampling system will be utilized for the system performance data.
Designing an enhanced groundwater sample collection system
International Nuclear Information System (INIS)
Schalla, R.
1994-10-01
As part of an ongoing technical support mission to achieve excellence and efficiency in environmental restoration activities at the Laboratory for Energy and Health-Related Research (LEHR), Pacific Northwest Laboratory (PNL) provided guidance on the design and construction of monitoring wells and identified the most suitable type of groundwater sampling pump and accessories for monitoring wells. The goal was to utilize a monitoring well design that would allow for hydrologic testing and reduce turbidity to minimize the impact of sampling. The sampling results of the newly designed monitoring wells were clearly superior to those of the previously installed monitoring wells. The new wells exhibited reduced turbidity, in addition to improved access for instrumentation and hydrologic testing. The variable frequency submersible pump was selected as the best choice for obtaining groundwater samples. The literature references are listed at the end of this report. Despite some initial difficulties, the actual performance of the variable frequency, submersible pump and its accessories was effective in reducing sampling time and labor costs, and its ease of use was preferred over the previously used bladder pumps. The surface seals system, called the Dedicator, proved to be useful accessory to prevent surface contamination while providing easy access for water-level measurements and for connecting the pump. Cost savings resulted from the use of the pre-production pumps (beta units) donated by the manufacturer for the demonstration. However, larger savings resulted from shortened field time due to the ease in using the submersible pumps and the surface seal access system. Proper deployment of the monitoring wells also resulted in cost savings and ensured representative samples
A Sample Delivery System for Planetary Missions
National Aeronautics and Space Administration — The project will develop, test and characterize the performance of a prototype /sample delivery system (SDS) implemented as an end effector on a robotic arm capable...
Controlling a sample changer using the integrated counting system
International Nuclear Information System (INIS)
Deacon, S.; Stevens, M.P.
1985-06-01
Control of the Sample Changer from a counting system can be achieved by using a Scaler Timer type 6255 and Sample Changer Control Interface type 6263. The interface used, however, has quite complex circuitry. The application therefore lends itself to the use of another 6000 Series module the Integrated Counting System (ICS). Using this unit control is carried out through a control program written in BASIC for the Commodore PET (or any other device with an IEEE-488 interface). The ICS then controls the sample changer through an interface unit which is relatively simple. A brief description of how ICS controls the sample changer is given. The control program is then described, firstly the running options are given, followed by a program description listing and flowchart. (author)
Controlling a sample changer using the integrated counting system
Energy Technology Data Exchange (ETDEWEB)
Deacon, S; Stevens, M P
1985-06-01
Control of the Sample Changer from a counting system can be achieved by using a Scaler Timer type 6255 and Sample Changer Control Interface type 6263. The interface used, however, has quite complex circuitry. The application therefore lends itself to the use of another 6000 Series module-the Integrated Counting System (ICS). Using this unit control is carried out through a control program written in BASIC for the Commodore PET (or any other device with an IEEE-488 interface). The ICS then controls the sample changer through an interface unit which is relatively simple. A brief description of how ICS controls the sample changer is given. The control program is then described; first the running options are given, followed by a program description listing and flowchart.
Experimental performance evaluation of two stack sampling systems in a plutonium facility
International Nuclear Information System (INIS)
Glissmeyer, J.A.
1992-04-01
The evaluation of two routine stack sampling systems at the Z-Plant plutonium facility operated by Rockwell International for USERDA is part of a larger study, sponsored by Rockwell and conducted by Battelle, Pacific Northwest Laboratories, of gaseous effluent sampling systems. The gaseous effluent sampling systems evaluated are located at the main plant ventilation stack (291-Z-1) and at a vessel vent stack (296-Z-3). A preliminary report, which was a paper study issued in April 1976, identified many deficiencies in the existing sampling systems and made recommendations for corrective action. The objectives of this experimental evaluation of those sampling systems were as follows: Characterize the radioactive aerosols in the stack effluents; Develop a tracer aerosol technique for validating particulate effluent sampling system performance; Evaluate the performance of the existing routine sampling systems and their compliance with the sponsor's criteria; and Recommend corrective action where required. The tracer aerosol approach to sampler evaluation was chosen because the low concentrations of radioactive particulates in the effluents would otherwise require much longer sampling times and thus more time to complete this evaluation. The following report describes the sampling systems that are the subject of this study and then details the experiments performed. The results are then presented and discussed. Much of the raw and finished data are included in the appendices
Nickelson, Jen; Alfonso, Moya L; McDermott, Robert J; Bumpus, Elizabeth C; Bryant, Carol A; Baldwin, Julie A
2011-04-01
Creating community-based opportunities for youth to be physically active is challenging for many municipalities. A Lexington, Kentucky community coalition designed and piloted a physical activity program, 'VERB™ summer scorecard (VSS)', leveraging the brand equity of the national VERB™--It's What You Do! campaign. Key elements of VSS subsequently were adopted in Sarasota County, FL. This study identified characteristics of Sarasota's VSS participants and non-participants. Students in Grades 5-8 from six randomly selected public schools completed a survey assessing VSS participation, physical activity level, psychosocial variables, parental support for physical activity and demographics. Logistic regression showed that VSS participants were more likely to be from Grades 5 to 6 versus Grades 7 and 8 [odds ratio (OR) = 6.055] and perceive high versus low parental support for physical activity (OR = 4.627). Moreover, for each unit rise in self-efficacy, the odds of VSS participation rose by 1.839. Chi-squared automatic interaction detector (CHAID) analysis suggested an interaction effect between grade and school socioeconomic status (SES), with a large proportion of seventh and eighth graders from high SES schools being non-participants (76.6%). A VSS-style program can be expected to be more effective with tweens who are younger, in a middle SES school, having high self-efficacy and high parental support for physical activity.
National Research Council Canada - National Science Library
Anderson, John
1998-01-01
...) and AFIT MXTOOLS toolboxes were used to produce the optimal, multiobjective designs. These designs were implemented for flight test on the Calspan VSS I Learjet, simulating the unstable longitudinal dynamics of an F-16 type aircraft...
Robust H2 performance for sampled-data systems
DEFF Research Database (Denmark)
Rank, Mike Lind
1997-01-01
Robust H2 performance conditions under structured uncertainty, analogous to well known methods for H∞ performance, have recently emerged in both discrete and continuous-time. This paper considers the extension into uncertain sampled-data systems, taking into account inter-sample behavior. Convex...... conditions for robust H2 performance are derived for different uncertainty sets...
Sample-hold and analog multiplexer for multidetector systems
Energy Technology Data Exchange (ETDEWEB)
Goswami, G C; Ghoshdostidar, M R; Ghosh, B; Chaudhuri, N [North Bengal Univ., Darjeeling (India). Dept. of Physics
1982-08-15
A new sample-hold circuit with an analog multiplexer system is described. Designed for multichannel acquistion of data from an air shower array, the system is being used for accurate measurements of pulse heights from 16 channels by the use of a single ADC.
Design aspects of automation system for initial processing of fecal samples
International Nuclear Information System (INIS)
Sawant, Pramilla D.; Prabhu, Supreetha P.; Suja, A.; Wankhede, Sonal; Chaudhary, Seema; Rao, D.D.; Pradeepkumar, K.S.; Das, A.P.; Badodkar, B.D.
2014-01-01
The procedure for initial handling of the fecal samples at Bioassay Lab., Trombay is as follows: overnight fecal samples are collected from the worker in a kit consisting of a polythene bag placed in a wide mouth polythene container closed with an inner lid and a screw cap. Occupational worker collects the sample in the polythene bag. On receiving the sample, the polythene container along with the sample is weighed, polythene bag containing fecal sample is lifted out of the container using a pair of tongs placed inside a crucible and ashed inside a muffle furnace at 450℃. After complete ashing, the crucible containing white ash is taken-up for further radiochemical processing. This paper describes the various steps in developing a prototype automated system for initial handling of fecal samples. The proposed system for handling and processing of fecal samples is proposed to automate the above. The system once developed will help eliminate manual intervention till the ashing stage and reduce the biological hazard involved in handling such samples mentioned procedure
Noncontact inspection laser system for characterization of piezoelectric samples
International Nuclear Information System (INIS)
Jimenez, F.J.; Frutos, J. de
2004-01-01
In this work measurements on a piezoelectric sample in dynamic behavior were taken, in particular, around the frequencies of resonance for the sample where the nonlineal effects are accentuated. Dimension changes in the sample need to be studied as that will allow a more reliable characterization of the piezoelectric samples. The goal of this research is to develop an inspection system able to obtain measurements, using a noncontact laser displacement transducer, also able to visualize, in three-dimensional graphic environment, the displacement that takes place in a piezoelectric sample surface. In resonant mode, the vibration mode of the sample is visualized
Lagoa Real design. Description and evaluation of sampling system
International Nuclear Information System (INIS)
Hashizume, B.K.
1982-10-01
This report describes the samples preparation system of drilling from Lagoa Real Design, aiming obtainment representative fraction of the half from drilling outlier. The error of sampling + analysis and analytical accuracy was obtainment by delayed neutron analysis. (author)
Biasetti, Jacopo; Hussain, Fazle; Gasser, T Christian
2011-10-07
Abdominal aortic aneurysms (AAAs) are frequently characterized by the development of an intra-luminal thrombus (ILT), which is known to have multiple biochemical and biomechanical implications. Development of the ILT is not well understood, and shear-stress-triggered activation of platelets could be the first step in its evolution. Vortical structures (VSs) in the flow affect platelet dynamics, which motivated the present study of a possible correlation between VS and ILT formation in AAAs. VSs educed by the λ(2)-method using computational fluid dynamics simulations of the backward-facing step problem, normal aorta, fusiform AAA and saccular AAA were investigated. Patient-specific luminal geometries were reconstructed from computed tomography scans, and Newtonian and Carreau-Yasuda models were used to capture salient rheological features of blood flow. Particularly in complex flow domains, results depended on the constitutive model. VSs developed all along the normal aorta, showing that a clear correlation between VSs and high wall shear stress (WSS) existed, and that VSs started to break up during late systole. In contrast, in the fusiform AAA, large VSs developed at sites of tortuous geometry and high WSS, occupying the entire lumen, and lasting over the entire cardiac cycle. Downward motion of VSs in the AAA was in the range of a few centimetres per cardiac cycle, and with a VS burst at that location, the release (from VSs) of shear-stress-activated platelets and their deposition to the wall was within the lower part of the diseased artery, i.e. where the thickest ILT layer is typically observed. In the saccular AAA, only one VS was found near the healthy portion of the aorta, while in the aneurysmatic bulge, no VSs occurred. We present a fluid-dynamics-motivated mechanism for platelet activation, convection and deposition in AAAs that has the potential of improving our current understanding of the pathophysiology of fluid-driven ILT growth.
Molecular dynamics coupled with a virtual system for effective conformational sampling.
Hayami, Tomonori; Kasahara, Kota; Nakamura, Haruki; Higo, Junichi
2018-07-15
An enhanced conformational sampling method is proposed: virtual-system coupled canonical molecular dynamics (VcMD). Although VcMD enhances sampling along a reaction coordinate, this method is free from estimation of a canonical distribution function along the reaction coordinate. This method introduces a virtual system that does not necessarily obey a physical law. To enhance sampling the virtual system couples with a molecular system to be studied. Resultant snapshots produce a canonical ensemble. This method was applied to a system consisting of two short peptides in an explicit solvent. Conventional molecular dynamics simulation, which is ten times longer than VcMD, was performed along with adaptive umbrella sampling. Free-energy landscapes computed from the three simulations mutually converged well. The VcMD provided quicker association/dissociation motions of peptides than the conventional molecular dynamics did. The VcMD method is applicable to various complicated systems because of its methodological simplicity. © 2018 Wiley Periodicals, Inc. © 2018 Wiley Periodicals, Inc.
SCADA based radioactive sample bottle delivery system for fuel reprocessing project
International Nuclear Information System (INIS)
Kaushik, Subrat; Munj, Niket; Chauhan, R.K.; Jayaram, M.N.; Haneef, K.K.M.
2014-01-01
Radioactive samples of process streams need to be analyzed in centralized control lab for measuring concentration of heavy elements as well as activity at various stages of re-processing plants. The sample is taken from biologically shielded process cells remotely through sampling blisters in sample bottles. These are then transferred to control lab located about 50 meters using vacuum transfer system. The bottle movement is tracked from origin to destination in rich HMI SCADA system using Infra-red non contact type proximity sensors located along sampling line and these sensors are connected to PLC in a fail-safe mode. The sample bottle travels at a speed of 10 m/s under vacuum motive force and the detection time is of the order of 1 mS. The flow meters have been used to know the air flow in sampling line. The system has been designed, developed, tested and commissioned and in use for four years. (author)
Computer-controlled sampling system for airborne particulates
International Nuclear Information System (INIS)
Hall, C.F.; Anspaugh, L.R.; Koval, J.S.; Phelps, P.L.; Steinhaus, R.J.
1975-01-01
A self-contained, mobile, computer-controlled air-sampling system has been designed and fabricated that also collects and records the data from eight meteorological sensors. The air-samplers are activated automatically when the collected meteorological data meet the criteria specified at the beginning of the data-collection run. The filters from the samplers are intended to collect airborne 239 Pu for later radionuclide analysis and correlation with the meteorological data for the study of resuspended airborne radioactivity and for the development of a predictive model. This paper describes the system hardware, discusses the system and software concepts, and outlines the operational procedures for the system
A novel PMT test system based on waveform sampling
Yin, S.; Ma, L.; Ning, Z.; Qian, S.; Wang, Y.; Jiang, X.; Wang, Z.; Yu, B.; Gao, F.; Zhu, Y.; Wang, Z.
2018-01-01
Comparing with the traditional test system based on a QDC and TDC and scaler, a test system based on waveform sampling is constructed for signal sampling of the 8"R5912 and the 20"R12860 Hamamatsu PMT in different energy states from single to multiple photoelectrons. In order to achieve high throughput and to reduce the dead time in data processing, the data acquisition software based on LabVIEW is developed and runs with a parallel mechanism. The analysis algorithm is realized in LabVIEW and the spectra of charge, amplitude, signal width and rising time are analyzed offline. The results from Charge-to-Digital Converter, Time-to-Digital Converter and waveform sampling are discussed in detailed comparison.
Research of pneumatic control transmission system for small irradiation samples
International Nuclear Information System (INIS)
Bai Zhongxiong; Zhang Haibing; Rong Ru; Zhang Tao
2008-01-01
In order to reduce the absorbed dose damage for the operator, pneumatic control has been adopted to realize the rapid transmission of small irradiation samples. On/off of pneumatic circuit and directions for the rapid transmission system are controlled by the electrical control part. The main program initializes the system and detects the location of the manual/automatic change-over switch, and call for the corresponding subprogram to achieve the automatic or manual operation. Automatic subprogram achieves the automatic sample transmission; Manual subprogram completes the deflation, and back and forth movement of the radiation samples. This paper introduces in detail the implementation of the system, in terms of both hardware and software design. (authors)
Study on sampling of continuous linear system based on generalized Fourier transform
Li, Huiguang
2003-09-01
In the research of signal and system, the signal's spectrum and the system's frequency characteristic can be discussed through Fourier Transform (FT) and Laplace Transform (LT). However, some singular signals such as impulse function and signum signal don't satisfy Riemann integration and Lebesgue integration. They are called generalized functions in Maths. This paper will introduce a new definition -- Generalized Fourier Transform (GFT) and will discuss generalized function, Fourier Transform and Laplace Transform under a unified frame. When the continuous linear system is sampled, this paper will propose a new method to judge whether the spectrum will overlap after generalized Fourier transform (GFT). Causal and non-causal systems are studied, and sampling method to maintain system's dynamic performance is presented. The results can be used on ordinary sampling and non-Nyquist sampling. The results also have practical meaning on research of "discretization of continuous linear system" and "non-Nyquist sampling of signal and system." Particularly, condition for ensuring controllability and observability of MIMO continuous systems in references 13 and 14 is just an applicable example of this paper.
Additively Manufactured Ceramic Rocket Engine Components
National Aeronautics and Space Administration — HRL Laboratories, LLC, with Vector Space Systems (VSS) as subcontractor, has a 24-month effort to develop additive manufacturing technology for reinforced ceramic...
A newly developed grab sampling system for collecting stratospheric air over Antarctica
Directory of Open Access Journals (Sweden)
Hideyuki Honda
1996-07-01
Full Text Available In order to measure the concentrations of various minor constituents and their isotopic ratios in the stratosphere over Antarctica, a simple grab sampling system was newly developed. The sampling system was designed to be launched by a small number of personnel using a rubber balloon under severe experimental conditions. Special attention was paid to minimize the contamination of sample air, as well as to allow easy handling of the system. The sampler consisted mainly of a 15l sample container with electromagnetic and manual valves, control electronics for executing the air sampling procedures and sending the position and status information of the sampler to the ground station, batteries and a transmitter. All these parts were assembled in an aluminum frame gondola with a shock absorbing system for landing. The sampler was equipped with a turn-over mechanism of the gondola to minimize contamination from the gondola, as well as with a GPS receiver and a rawinsonde for its tracking. Total weight of the sampler was about 11kg. To receive, display and store the position and status data of the sampling system at the ground station, a simple data acquisition system with a portable receiver and a microcomputer was also developed. A new gas handling system was prepared to simplify the injection of He gas into the balloon. For air sampling experiments, three sampling systems were launched at Syowa Station (69°00′S, 39°35′E, Antarctica and then recovered on sea ice near the station on January 22 and 25,1996.
Remote sampling system in reprocessing: present and future perspective
International Nuclear Information System (INIS)
Garcha, J.S.; Balakrishnan, V.P.; Rao, M.K.
1990-01-01
For the process and inventory control of the reprocessing plant operation it is essential to analyse the samples from the various process vessels to assess the plant performance and take corrective action if needed in the operating parameters. In view of the very high radioactive inventory in the plant, these plants are operated remotely behind thick shielding. The liquid sampling also has to be carried out by remote techniques only as no direct approach is feasible. A vacuum assisted air lift method is employed for the purpose of obtaining samples from remotely located process vessels. A brief description of the present technique, the design criteria, various interlocks and manual operations involved during sampling and despatching the same to the analytical laboratory is given in the paper. A design approach for making the sampling system, a fully automated remote operation has been attempted in this paper. Utilisation of custom built robots and dedicated computer for the various operations and interlocks has been visualised to ensure a complete remotised system for the adoption in future plants. (author). 2 figs., 2 tabs
International Nuclear Information System (INIS)
Shibata Shin-nosuke; Tanaka, Tsuyoshi; Minami, Masayo
2001-01-01
A new gamma-ray counting and data processing system for non-destructive neutron activation analysis has been set up in Radioisotope Center in Nagoya University. The system carry out gamma-ray counting, sample change and data processing automatically, and is able to keep us away from parts of complicated operations in INAA. In this study, we have arranged simple analytical procedure that makes practical works easier than previous. The concrete flow is described from the reparation of powder rock samples to gamma-ray counting and data processing by the new INAA system. Then it is run over that the analyses used two Geological Survey of Japan rock reference samples JB-1a and JG-1a in order to evaluate how the new analytical procedure give any speediness and accuracy for analyses of geological materials. Two United States Geological Survey reference samples BCR-1 and G-2 used as the standard respectively. Twenty two elements for JB-1a and 25 elements for JG-1a were analyzed, the uncertainty are <5% for Na, Sc, Fe, Co, La, Ce, Sm, Eu, Yb, Lu, Hf, Ta and Th, and of <10% for Cr, Zn, Cs, Ba, Nd, Tb and U. This system will enable us to analyze more than 1500 geologic samples per year. (author)
Modulation transfer function cascade model for a sampled IR imaging system.
de Luca, L; Cardone, G
1991-05-01
The performance of the infrared scanning radiometer (IRSR) is strongly stressed in convective heat transfer applications where high spatial frequencies in the signal that describes the thermal image are present. The need to characterize more deeply the system spatial resolution has led to the formulation of a cascade model for the evaluation of the actual modulation transfer function of a sampled IR imaging system. The model can yield both the aliasing band and the averaged modulation response for a general sampling subsystem. For a line scan imaging system, which is the case of a typical IRSR, a rule of thumb that states whether the combined sampling-imaging system is either imaging-dependent or sampling-dependent is proposed. The model is tested by comparing it with other noncascade models as well as by ad hoc measurements performed on a commercial digitized IRSR.
Development and Evaluation of a Pilot Prototype Automated Online Sampling System
International Nuclear Information System (INIS)
Whitaker, M.J.
2000-01-01
An automated online sampling system has been developed for the BNFL-Hanford Technetium Monitoring Program. The system was designed to be flexible and allows for the collection and delivery of samples to a variety of detection devices that may be used
MarsVac: Pneumatic Sampling System for Planetary Exploration
Zacny, K.; Mungas, G.; Chu, P.; Craft, J.; Davis, K.
2008-12-01
We are proposing a Mars Sample Return scheme whereby a sample of regolith is acquired directly into a Mars Ascent Vehicle using a pneumatic system. Unlike prior developments that used suction to collect fines, the proposed system uses positive pressure to move the regolith. We envisage 3 pneumatic tubes to be embedded inside the 3 legs of the lander. Upon landing, the legs will burry themselves into the regolith and the tubes will fill up with regolith. With one puff of gas, the regolith can be lifted into a sampling chamber onboard of the Mars Ascent Vehicle. An additional chamber can be opened to acquire atmospheric gas and dust. The entire MSR will require 1) an actuator to open/close sampling chamber and 2) a valve to open gas cylinder. In the most recent study related to lunar excavation and funded under the NASA SBIR program we have shown that it is possible lift over 3000 grams of soil with only 1 gram of gas at 1atm. Tests conducted under Mars atmospheric pressure conditions (5 torr). In September of 2008, we will be performing tests at 1/6thg (Moon) and 1/3g (Mars) to determine mass lifting efficiencies in reduced gravities.
Double-Shell Tank (DST) Ventilation System Vapor Sampling and Analysis Plan
International Nuclear Information System (INIS)
SASAKI, L.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples from the primary ventilation systems of the AN, AP, AW, and AY/AZ tank farms. Sampling will be performed in accordance with Data Quality Objectives for Regulatory Requirements for Hazardous and Radioactive Air Emissions Sampling and Analysis (Air DQO) (Mulkey 1999). The sampling will verify if current air emission estimates used in the permit application are correct and provide information for future air permit applications. Vapor samples will be obtained from tank farm ventilation systems, downstream from the tanks and upstream of any filtration. Samples taken in support of the DQO will consist of SUMMA(trademark) canisters, triple sorbent traps (TSTs), sorbent tube trains (STTs), polyurethane foam (PUF) samples. Particulate filter samples and tritium traps will be taken for radiation screening to allow the release of the samples for analysis. The following sections provide the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from the vapor samples
40 CFR 205.171-2 - Test exhaust system sample selection and preparation.
2010-07-01
... Systems § 205.171-2 Test exhaust system sample selection and preparation. (a)(1) Exhaust systems... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test exhaust system sample selection and preparation. 205.171-2 Section 205.171-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
Development of RF non-IQ sampling module for Helium RFQ LLRF system
Energy Technology Data Exchange (ETDEWEB)
Jeong, Hae-Seong; Ahn, Tae-Sung; Kim, Seong-Gu; Kwon, Hyeok-Jung; Kim, Han-Sung; Song, Young-Gi; Seol, Kyung-Tae; Cho, Yong-Sub [KOMAC, Gyeongju (Korea, Republic of)
2015-05-15
KOMAC (Korea Multi-purpose Accelerator Complex) has a plan to develop the helium irradiation system. This system includes the Ion source, LEBT, RFQ, MEBT systems to transport helium particles to the target. Especially, the RFQ (Radio Frequency Quadrupole) system should receive the 200MHz RF within 1% amplitude error stability. For supplying stable 200MHz RF to the RFQ, the low-level radio frequency (LLRF) should be controlled by control system. The helium RFQ LLRF control system adopted non- IQ sampling method to sample the analog input RF. Sampled input data will be calculated to get the I, Q values. These I, Q values will be used to monitor the amplitude and phase of the RF signal. In this paper, non-IQ sampling logic and amplitude and phase calculating logic of the FPGA will be introduced. Using Xilinx ISE design suite which is tool for developing the FPGA logic module, non-IQ sampling module and amplitude and phase computing module developed. In the future, PI gain module and frequency error computing module will be developed.
An Automated Sample Processing System for Planetary Exploration
Soto, Juancarlos; Lasnik, James; Roark, Shane; Beegle, Luther
2012-01-01
An Automated Sample Processing System (ASPS) for wet chemistry processing of organic materials on the surface of Mars has been jointly developed by Ball Aerospace and the Jet Propulsion Laboratory. The mechanism has been built and tested to demonstrate TRL level 4. This paper describes the function of the system, mechanism design, lessons learned, and several challenges that were overcome.
A microcomputer controlled sample changer system for γ-ray spectroscopy
International Nuclear Information System (INIS)
Jost, D.T.; Kraehenbuehl, U.; Gunten, H.R. von
1982-01-01
A Z-80 based microcomputer is used to control a sample changer system connected to two γ-ray spectrometers. Samples are changed according to preselected counting criteria (maximum time and/or desired precision). Special precautions were taken to avoid the loss of information and of samples in case of a power failure. (orig.)
SCADA based radioactive sample bottle delivery system for fuel reprocessing project
International Nuclear Information System (INIS)
Kaushik, Subrat; Munj, Niket; Chauhan, R.K.; Kumar, Pramod; Mishra, A.C.
2011-01-01
Radioactive samples of process streams need to be analyzed in centralized control lab for measuring concentration of heavy elements as well as activity at various stages of re-processing plants. The sample is taken from biologically shielded process cells remotely through sampling blisters in sample bottles. These are then transferred to control lab located about 50 meters using vacuum transfer system. The bottle movement is tracked from origin to destination in rich HMI SCADA system using Infra-red non contact type proximity sensors located along sampling line and these sensors are connected to PLC in a fail-safe mode. The sample bottle travels at a speed of 10 m/s under vacuum motive force and the detection time is of the order of 1 mS. The contact time Flow meters have been used to know the air flow in sampling line
Nuclear-station post-accident liquid-sampling system: developed by Duke Power Company
International Nuclear Information System (INIS)
Burton, D.A.; Birch, M.L.; Orth, W.C.
1981-01-01
The accident at Three Mile Island showed that means must be provided to determine the radioactivity levels in high activity liquid and gaseous systems of a nuclear power plant without undue radiation exposure to personnel. The Duke Power Post Accident Liquid Sampling System provides the means for obtaining diluted liquid samples and diluted dissolved gas samples following a reactor accident involving substantial core damage. Their approach yields a straightforward engineering solution at a fraction of the cost of other systems. A description of the system, general design criteria, and color coded flow diagrams are included
International Nuclear Information System (INIS)
Oshita, Kazuyuki; Fujime, Motochika; Takaoka, Masaki; Fujimori, Takashi; Appels, Lise; Dewil, Raf
2015-01-01
Highlights: • Siloxanes hamper the energy-use of anaerobic digestion biogas. • D5 siloxane was considered as target compound in this study. • The treatment removed 80% of D5 in sewage sludge at 55 °C and 135 g-NaOH kg −1 -VTS. • D5 removal and the disintegration of VSS in the sludge were correlated. • At the optimal conditions, the costs of anaerobic digestion were notably diminished. - Abstract: A thermo-alkaline treatment with air stripping was applied before anaerobic sludge digestion for both siloxane removal and sludge disintegration. The treatment was expected to increase the amount of biogas produced and to reduce the amount of siloxane in the gas. Adding sodium hydroxide (NaOH) to the sludge improved the removal of siloxane from the sludge, with approximately 90% of the siloxane removed to the gas phase using a thermo-alkaline treatment. Over 80% of decamethylcyclopentasiloxane (D5) could be removed under the following conditions: 55 °C treatment temperature, 135 g-NaOH kg −1 volatile total solids (VTS), and 0.5 L min −1 air-stripping rate. The disintegration ratio of volatile suspended solids (VSS) in the sludge was correlated with the D5 removal ratio. Because most of the siloxane was adsorbed to, or was contained in the VSS, the siloxane removal ratio increased with VSS disintegration. Finally, the energy consumption and operational costs of this system were evaluated for several scenarios. Thermo-alkaline treatment at the indicated operational conditions had the lowest operating costs for a 400 m 3 day −1 anaerobic sludge digestion system
Test plan for evaluating the performance of the in-tank fluidic sampling system
International Nuclear Information System (INIS)
BOGER, R.M.
1999-01-01
The PHMC will provide Low Activity Wastes (LAW) tank wastes for final treatment by a privatization contractor from double-shell feed tanks, 241-AP-102 and 241-AP-104, Concerns about the inability of the baseline ''grab'' sampling to provide large volume samples within time constraints has led to the development of a conceptual sampling system that would be deployed in a feed tank riser, This sampling system will provide large volume, representative samples without the environmental, radiation exposure, and sample volume impacts of the current base-line ''grab'' sampling method. This test plan identifies ''proof-of-principle'' cold tests for the conceptual sampling system using simulant materials. The need for additional testing was identified as a result of completing tests described in the revision test plan document, Revision 1 outlines tests that will evaluate the performance and ability to provide samples that are representative of a tanks' content within a 95 percent confidence interval, to recovery from plugging, to sample supernatant wastes with over 25 wt% solids content, and to evaluate the impact of sampling at different heights within the feed tank. The test plan also identifies operating parameters that will optimize the performance of the sampling system
Improved mixing and sampling systems for vitrification melter feeds
International Nuclear Information System (INIS)
Ebadian, M.A.
1998-01-01
This report summarizes the methods used and results obtained during the progress of the study of waste slurry mixing and sampling systems during fiscal year 1977 (FY97) at the Hemispheric Center for Environmental Technology (HCET) at Florida International University (FIU). The objective of this work is to determine optimal mixing configurations and operating conditions as well as improved sampling technology for defense waste processing facility (DWPF) waste melter feeds at US Department of Energy (DOE) sites. Most of the research on this project was performed experimentally by using a tank mixing configuration with different rotating impellers. The slurry simulants for the experiments were prepared in-house based on the properties of the DOE sites' typical waste slurries. A sampling system was designed to withdraw slurry from the mixing tank. To obtain insight into the waste mixing process, the slurry flow in the mixing tank was also simulated numerically by applying computational fluid dynamics (CFD) methods. The major parameters investigated in both the experimental and numerical studies included power consumption of mixer, mixing time to reach slurry uniformity, slurry type, solids concentration, impeller type, impeller size, impeller rotating speed, sampling tube size, and sampling velocities. Application of the results to the DWPF melter feed preparation process will enhance and modify the technical base for designing slurry transportation equipment and pipeline systems. These results will also serve as an important reference for improving waste slurry mixing performance and melter operating conditions. These factors will contribute to an increase in the capability of the vitrification process and the quality of the waste glass
A New Cryogenic Sample Manipulator For SRC's Scienta 2002 System
International Nuclear Information System (INIS)
Gundelach, Chad T.; Fisher, Mike V.; Hoechst, Hartmut
2004-01-01
We discuss the first bench tests of a sample manipulator which was recently designed at SRC for the Scienta 2002 User system. The manipulator concept utilizes the 10 deg. angular window of the Scienta in the horizontal plane (angle dispersion) by rotating the sample normal around the vertical axis while angular scans along the vertical axis (energy dispersion) are continuous within ±30 deg. relative to the electron lens by rotating the sample around the horizontal axis. With this concept it is possible to precisely map the entire two-dimensional k-space of a crystal by means of stitching together 10 deg. wide stripes centered +15 deg. to -50 deg. relative to the sample normal. Three degrees of translational freedom allow positioning the sample surface at the focal point of the analyzer. Two degrees of rotational freedom are available at this position for manipulating the sample. Samples are mounted to a standard holder and transferred to the manipulator via a load-lock system attached to a prep chamber. The manipulator is configured with a cryogenic cold head, an electrical heater, and a temperature sensor permitting continuous closed-loop operation for 20-380 K
Association between vestibular schwannomas and mobile phone use
Moon, In Seok; Kim, Bo Gyung; Kim, Jinna; Lee, Jong Dae; Lee, Won-Sang
2013-01-01
Vestibular schwannomas (VSs) grow in the region where the energy from mobile phone use is absorbed. We examined the associations of VSs with mobile phone use. This study included 119 patients who had undergone surgical tumor removal. We used two approaches in this investigation. First, a case–control study for the association of mobile phone use and incidence of VSs was conducted. Both cases and controls were investigated with questions based on INTERPHONE guidelines. Amount of mobile phone u...
Identification of continuous-time systems from samples of input ...
Indian Academy of Sciences (India)
Abstract. This paper presents an introductory survey of the methods that have been developed for identification of continuous-time systems from samples of input±output data. The two basic approaches may be described as (i) the indirect method, where first a discrete-time model is estimated from the sampled data and then ...
Infrared surface analysis using a newly developed thin-sample preparation system.
Nagai, Naoto; Nishiyama, Itsuo; Kishima, Yoshio; Iida, Katsuhiko; Mori, Koichi
2009-01-01
We developed a new sampling system, the Nano Catcher, for measuring the surface chemical structure of polymers or industrial products and we evaluated the performance of the system. The system can directly pick up surface species whose depth is on the order of approximately 100 nm and can easily provide a sample for a Fourier transform infrared (FT-IR) system without the necessity of passing it over to a measurement plate. The FT-IR reflection data obtained from the Nano Catcher were compared with those obtained using the attenuated total reflection (ATR) method and sampling by hand. Chemical structural analysis of a depth region from a few tens of nanometers to a few hundred nanometers can be directly performed using this system. Such depths are beyond the scope of conventional X-ray photoelectron spectroscopy (XPS) and ATR methods. We can expect the use of the Nano Catcher system to lead to a great improvement in the detection of signals of surface species in these depth regions.
Analysis format and evaluation methods for effluent particle sampling systems in nuclear facilities
International Nuclear Information System (INIS)
Schwendiman, L.C.; Glissmeyer, J.A.
1976-06-01
Airborne effluent sampling systems for nuclear facilities are frequently designed, installed, and operated without a systematic approach which discloses and takes into account all the circumstances and conditions which would affect the validity and adequacy of the sample. Without a comprehensive check list or something similar, the designer of the system may not be given the important information needed to provide a good design. In like manner, an already operating system may be better appraised. Furthermore, the discipline of a more formal approach may compel the one who will use the system to make sure he knows what he wants and can thus give the designer the needed information. An important consideration is the criteria to be applied to the samples to be taken. This analysis format consists of a listing of questions and statements calling forth the necessary information required to analyze a sampling system. With this information developed, one can proceed with an evaluation, the methodology of which is also discussed in the paper. Errors in probe placement, failure to sample at the proper rate, delivery line losses, and others are evaluated using mathematical models and empirically derived relationships. Experimental methods are also described for demonstrating that quality sampling will be achieved. The experiments include using a temporary, simple, but optimal sample collection system to evaluate the more complex systems. The use of tracer particles injected in the stream is also discussed. The samples obtained with the existing system are compared with those obtained by the temporary, optimal system
A multi-probe thermophoretic soot sampling system for high-pressure diffusion flames
Energy Technology Data Exchange (ETDEWEB)
Vargas, Alex M.; Gülder, Ömer L. [Institute for Aerospace Studies, University of Toronto, Toronto, Ontario M3H 5T6 (Canada)
2016-05-15
Optical diagnostics and physical probing of the soot processes in high pressure combustion pose challenges that are not faced in atmospheric flames. One of the preferred methods of studying soot in atmospheric flames is in situ thermophoretic sampling followed by transmission electron microscopy imaging and analysis for soot sizing and morphology. The application of this method of sampling to high pressures has been held back by various operational and mechanical problems. In this work, we describe a rotating disk multi-probe thermophoretic soot sampling system, driven by a microstepping stepper motor, fitted into a high-pressure chamber capable of producing sooting laminar diffusion flames up to 100 atm. Innovative aspects of the sampling system design include an easy and precise control of the sampling time down to 2.6 ms, avoidance of the drawbacks of the pneumatic drivers used in conventional thermophoretic sampling systems, and the capability to collect ten consecutive samples in a single experimental run. Proof of principle experiments were performed using this system in a laminar diffusion flame of methane, and primary soot diameter distributions at various pressures up to 10 atm were determined. High-speed images of the flame during thermophoretic sampling were recorded to assess the influence of probe intrusion on the flow field of the flame.
Vapor and gas sampling of single-shell tank 241-U-104 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue.Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-U-104. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the July 16, 1996 sampling of SST 241-U-104. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media
Vapor and gas sampling of single-shell tank 241-S-103 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-S-103. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the June 12, 1996 sampling of SST 241-S-103. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media
Vapor and gas sampling of single-shell tank 241-S-106 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-S-106. This document presents In Situ vapor Sampling System (ISVS) data resulting from the June 13, 1996 sampling of SST 241-S-106. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which'supplied and analyzed the sample media
40 CFR 90.421 - Dilute gaseous exhaust sampling and analytical system description.
2010-07-01
... gas mixture temperature, measured at a point immediately ahead of the critical flow venturi, must be... analytical system description. (a) General. The exhaust gas sampling system described in this section is... requirements are as follows: (1) This sampling system requires the use of a Positive Displacement Pump—Constant...
Han, Yuanyuan; Jin, Xibiao; Wang, Yuan; Liu, Yongdi; Chen, Xiurong
2014-02-01
Inhibition of nitrification by four typical pollutants (acrylonitrile, acrylic acid, acetonitrile and cyanide) in acrylonitrile wastewater was investigated. The inhibitory effect of cyanide on nitrification was strongest, with a 50% inhibitory concentration of 0.218 mg·gVSS-1 being observed in a municipal activated sludge system. However, the performance of nitrification was recovered when cyanide was completely degraded. The nitrification, which had been inhibited by 4.17 mg·gVSS-1 of free cyanide for 24 h, was recovered to greater than 95% of that without cyanide after 10 days of recovery. To overcome cyanide inhibition, cyanide-degrading bacteria were cultivated in a batch reactor by increasing the influent cyanide concentration in a stepwise manner, which resulted in an increase in the average cyanide degradation rate from 0.14 to 1.01 mg CN-·gVSS-1·h-1 over 20 days. The cultured cyanide-degrading bacteria were shaped like short rods, and the dominant cyanide-degrading bacteria strain was identified as Pseudomonas fluorescens NCIMB by PCR.
Reachable Distance Space: Efficient Sampling-Based Planning for Spatially Constrained Systems
Xinyu Tang,
2010-01-25
Motion planning for spatially constrained robots is difficult due to additional constraints placed on the robot, such as closure constraints for closed chains or requirements on end-effector placement for articulated linkages. It is usually computationally too expensive to apply sampling-based planners to these problems since it is difficult to generate valid configurations. We overcome this challenge by redefining the robot\\'s degrees of freedom and constraints into a new set of parameters, called reachable distance space (RD-space), in which all configurations lie in the set of constraint-satisfying subspaces. This enables us to directly sample the constrained subspaces with complexity linear in the number of the robot\\'s degrees of freedom. In addition to supporting efficient sampling of configurations, we show that the RD-space formulation naturally supports planning and, in particular, we design a local planner suitable for use by sampling-based planners. We demonstrate the effectiveness and efficiency of our approach for several systems including closed chain planning with multiple loops, restricted end-effector sampling, and on-line planning for drawing/sculpting. We can sample single-loop closed chain systems with 1,000 links in time comparable to open chain sampling, and we can generate samples for 1,000-link multi-loop systems of varying topologies in less than a second. © 2010 The Author(s).
The effects of fatigue on robotic surgical skill training in Urology residents.
Mark, James R; Kelly, Douglas C; Trabulsi, Edouard J; Shenot, Patrick J; Lallas, Costas D
2014-09-01
This study reports on the effect of fatigue on Urology residents using the daVinci surgical skills simulator (dVSS). Seven Urology residents performed a series of selected exercises on the dVSS while pre-call and post-call. Prior to dVSS performance a survey of subjective fatigue was taken and residents were tested with the Epworth Sleepiness Scale (ESS). Using the metrics available in the dVSS software, the performance of each resident was evaluated. The Urology residents slept an average of 4.07 h (range 2.5-6 h) while on call compared to an average of 5.43 h while not on call (range 3-7 h, p = 0.08). Post-call residents were significantly more likely to be identified as fatigued by the Epworth Sleepiness Score than pre-call residents (p = 0.01). Significant differences were observed in fatigued residents performing the exercises, Tubes and Match Board 2 (p = 0.05, 0.02). Additionally, there were significant differences in the total number of critical errors during the training session (9.29 vs. 3.14, p = 0.04). Fatigue in post-call Urology residents leads to poorer performance on the dVSS simulator. The dVSS may become a useful instrument in the education of fatigued residents and a tool to identify fatigue in trainees.
A Method for Traffic Calming Using Radio Transmitter
Directory of Open Access Journals (Sweden)
Amin Mirza Boroujerdian
2017-01-01
Full Text Available Excessive speed is one of the major factors in transportation safety assessment and is influenced by road geometric design, vehicle properties, and driving pattern. Exploiting innovative methods along with the conventional ones has been proven to be effective in road safety to control the speed limit. In this study, a supplementary tool is introduced to help drivers to observe the speed limit. In line with this objective, the effectiveness of Voice Sign System (VSS as an Intelligent Transportation System is evaluated. In order to measure the speed, video processing software is used. Moreover, SPSS is utilized to perform statistical analysis and compare upstream and downstream speeds before and after a message transmission. The study is conducted in Yadegar-e-Imam expressway, located in Tehran, to evaluate the effectiveness of a voice message. The message reads as follows: “Observe the Speed Limit.” The results reveal that VSS is an effective tool for speed reduction as well as the speed limit observation in expressways. The study shows that the speed is reduced by 18% on average, and speed limit observation is improved by 46.5%, out of which 18.2% is direct and 28.3% is indirect influence of VSS.
[Kinesitherapy in patients with the peripheral vestibular system disorders].
Szczepanik, Marcin; Walak, Jarosław; Woszczak, Marek; Józefowicz-Korczyńska, Magdalena
2013-01-01
Kinesitherapy is widely accepted management in patients with vertigo and imbalance, but there has been inadequate evidence that one form of therapy is superior to another. of the study was to compare effectiveness of two kinesitherapy protocols in patients with the peripheral vestibular system disorders. Fifty patients (mean age 46.0±13.1 year) with vertigo and balance instability lasting over 3 months with unilateral vestibular disorder, confirmed in Videnystagmography, were included in the study. Thirty patients underwent supervised and 20 patients home-based exercise programs. All of them were assessed three times at the baseline, after 4 weeks and 3 months, on vertigo intensity and frequency with the Vertigo Syndrome Scale (VSS), Vertigo Visual Analog Scale (VAS) and clinical unsteadiness with tests (Romberg, Amended Motor Club Assesment (AMCA), Eurofit test - standing on one leg. In both groups the clinical tasks and the intensity of vertigo in VAS significantly decreased. The mean value of VSS (part physical and emotional)score significantly decreased only in supervised group at the end of 4 weeks and 3 months (p=ns). Recovery was more dynamic in supervised group than home-based exercises group, in AMCA test (3.9 vs. 1.3 s, p<0.05) in Eurofit tests eye open (14.1 vs. 0.9 s, p<0.05) and eye closed (3.5 vs. 1 s, p<0.05). In patients with unilateral peripheral vestibular dysfunction supervised and home-based group kinesitherapy is an effective treatment method. In supervised group patients recovery has been faster. Copyright © 2013 Polish Otorhinolaryngology - Head and Neck Surgery Society. Published by Elsevier Urban & Partner Sp. z.o.o. All rights reserved.
Power distribution system reliability evaluation using dagger-sampling Monte Carlo simulation
Energy Technology Data Exchange (ETDEWEB)
Hu, Y.; Zhao, S.; Ma, Y. [North China Electric Power Univ., Hebei (China). Dept. of Electrical Engineering
2009-03-11
A dagger-sampling Monte Carlo simulation method was used to evaluate power distribution system reliability. The dagger-sampling technique was used to record the failure of a component as an incident and to determine its occurrence probability by generating incident samples using random numbers. The dagger sampling technique was combined with the direct sequential Monte Carlo method to calculate average values of load point indices and system indices. Results of the 2 methods with simulation times of up to 100,000 years were then compared. The comparative evaluation showed that less computing time was required using the dagger-sampling technique due to its higher convergence speed. When simulation times were 1000 years, the dagger-sampling method required 0.05 seconds to accomplish an evaluation, while the direct method required 0.27 seconds. 12 refs., 3 tabs., 4 figs.
System design description for sampling fuel in K basins
International Nuclear Information System (INIS)
Baker, R.B.
1996-01-01
This System Design Description provides: (1) statements of the Spent Nuclear Fuel Projects (SNFP) needs requiring sampling of fuel in the K East and K West Basins, (2) the sampling equipment functions and requirements, (3) a general work plan and the design logic being followed to develop the equipment, and (4) a summary description of the design for the sampling equipment. The report summarizes the integrated application of both the subject equipment and the canister sludge sampler in near-term characterization campaigns at K Basins
Target Tracking of a Linear Time Invariant System under Irregular Sampling
Directory of Open Access Journals (Sweden)
Jin Xue-Bo
2012-11-01
Full Text Available Due to event-triggered sampling in a system, or maybe with the aim of reducing data storage, tracking many applications will encounter irregular sampling time. By calculating the matrix exponential using an inverse Laplace transform, this paper transforms the irregular sampling tracking problem to the problem of tracking with time-varying parameters of a system. Using the common Kalman filter, the developed method is used to track a target for the simulated trajectory and video tracking. The results of simulation experiments have shown that it can obtain good estimation performance even at a very high irregular rate of measurement sampling time.
Völker, S; Schreiber, C; Müller, H; Zacharias, N; Kistemann, T
2017-05-01
After the amendment of the Drinking Water Ordinance in 2011, the requirements for the hygienic-microbiological monitoring of drinking water installations have increased significantly. In the BMBF-funded project "Biofilm Management" (2010-2014), we examined the extent to which established sampling strategies in practice can uncover drinking water plumbing systems systemically colonized with Legionella. Moreover, we investigated additional parameters that might be suitable for detecting systemic contaminations. We subjected the drinking water plumbing systems of 8 buildings with known microbial contamination (Legionella) to an intensive hygienic-microbiological sampling with high spatial and temporal resolution. A total of 626 drinking hot water samples were analyzed with classical culture-based methods. In addition, comprehensive hygienic observations were conducted in each building and qualitative interviews with operators and users were applied. Collected tap-specific parameters were quantitatively analyzed by means of sensitivity and accuracy calculations. The systemic presence of Legionella in drinking water plumbing systems has a high spatial and temporal variability. Established sampling strategies were only partially suitable to detect long-term Legionella contaminations in practice. In particular, the sampling of hot water at the calorifier and circulation re-entrance showed little significance in terms of contamination events. To detect the systemic presence of Legionella,the parameters stagnation (qualitatively assessed) and temperature (compliance with the 5K-rule) showed better results. © Georg Thieme Verlag KG Stuttgart · New York.
291-B-1 stack monitoring and sampling system annual system assessment report
International Nuclear Information System (INIS)
Ridge, T.M.
1994-01-01
The B Plant 291-B-1 main stack exhausts gaseous effluents to the atmosphere from the 221-B Building canyon and cells, the No. 1 Vessel Ventilation System (VVS1), the 212-B Cask Station cell ventilation system, and, to a limited capacity, the 224-B Building. VVS1 collects offgases from various process tanks in 221-B Building, while the 224-B system maintains a negative pressure in out-of-service, sealed process tanks. B Plant Administration Manual, WHC-CM-7-5, Section 5.30 requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with Stack 291-B-1 (System Number B977A) at B Plant. The system is functional and performing satisfactorily
Set Up of an Automatic Water Quality Sampling System in Irrigation Agriculture
Directory of Open Access Journals (Sweden)
Emanuel Heinz
2013-12-01
Full Text Available We have developed a high-resolution automatic sampling system for continuous in situ measurements of stable water isotopic composition and nitrogen solutes along with hydrological information. The system facilitates concurrent monitoring of a large number of water and nutrient fluxes (ground, surface, irrigation and rain water in irrigated agriculture. For this purpose we couple an automatic sampling system with a Wavelength-Scanned Cavity Ring Down Spectrometry System (WS-CRDS for stable water isotope analysis (δ2H and δ18O, a reagentless hyperspectral UV photometer (ProPS for monitoring nitrate content and various water level sensors for hydrometric information. The automatic sampling system consists of different sampling stations equipped with pumps, a switch cabinet for valve and pump control and a computer operating the system. The complete system is operated via internet-based control software, allowing supervision from nearly anywhere. The system is currently set up at the International Rice Research Institute (Los Baños, The Philippines in a diversified rice growing system to continuously monitor water and nutrient fluxes. Here we present the system’s technical set-up and provide initial proof-of-concept with results for the isotopic composition of different water sources and nitrate values from the 2012 dry season.
International Nuclear Information System (INIS)
Lober, R.W.; Reeder, J.D.; Porter, L.K.
1987-01-01
Studies were conducted to quantify and compare the efficiencies of various evaporative systems used in evaporating 15 N samples prior to mass spectrometric analysis. Two new forced-air systems were designed and compared with a conventional forced-air system and with an open-air dry bath technique for effectiveness in preventing atmospheric contamination of evaporating samples. The forced-air evaporative systems significantly reduced the time needed to evaporate samples as compared to the open-air dry bath technique; samples were evaporated to dryness in 2.5 h with the forced-air systems as compared to 8 to 10 h on the open-air dry bath. The effectiveness of a given forced-air system to prevent atmospheric contamination of evaporating samples was significantly affected by the flow rate of the air stream flowing over the samples. The average atmospheric contaminant N found in samples evaporated on the open-air dry bath was 0.3 μ N, indicating very low concentrations of atmospheric NH 3 during this study. However, in previous studies the authors have experienced significant contamination of 15 N samples evaporated on an open-air dry bath because the level of contaminant N in the laboratory atmosphere varied and could not be adequately controlled. Average cross-contaminant levels of 0.28, 0.20, and 1.01 μ of N were measured between samples evaporated on the open-air dry bath, the newly-designed forced-air system, and the conventional forced-air system, respectively. The cross-contamination level is significantly higher on the conventional forced-air system than on the other two systems, and could significantly alter the atom % 15 N of high-enriched, low [N] evaporating samples
Sánchez, Carlos; Lienemann, Charles-Philippe; Todolí, Jose-Luis
2016-10-01
Bioethanol real samples have been directly analyzed through ICP-MS by means of the so called High Temperature Torch Integrated Sample Introduction System (hTISIS). Because bioethanol samples may contain water, experiments have been carried out in order to determine the effect of ethanol concentration on the ICP-MS response. The ethanol content studied went from 0 to 50%, because higher alcohol concentrations led to carbon deposits on the ICP-MS interface. The spectrometer default spray chamber (double pass) equipped with a glass concentric pneumatic micronebulizer has been taken as the reference system. Two flow regimes have been evaluated: continuous sample aspiration at 25 μL min- 1 and 5 μL air-segmented sample injection. hTISIS temperature has been shown to be critical, in fact ICP-MS sensitivity increased with this variable up to 100-200 °C depending on the solution tested. Higher chamber temperatures led to either a drop in signal or a plateau. Compared with the reference system, the hTISIS improved the sensitivities by a factor included within the 4 to 8 range while average detection limits were 6 times lower for the latter device. Regarding the influence of the ethanol concentration on sensitivity, it has been observed that an increase in the temperature was not enough to eliminate the interferences. It was also necessary to modify the torch position with respect to the ICP-MS interface to overcome them. This fact was likely due to the different extent of ion plasma radial diffusion encountered as a function of the matrix when working at high chamber temperatures. When the torch was moved 1 mm plasma down axis, ethanolic and aqueous solutions provided statistically equal sensitivities. A preconcentration procedure has been applied in order to validate the methodology. It has been found that, under optimum conditions from the point of view of matrix effects, recoveries for spiked samples were close to 100%. Furthermore, analytical concentrations for real
Nano-Scale Sample Acquisition Systems for Small Class Exploration Spacecraft
Paulsen, G.
2015-12-01
The paradigm for space exploration is changing. Large and expensive missions are very rare and the space community is turning to smaller, lighter, and less expensive missions that could still perform great exploration. These missions are also within reach of commercial companies such as the Google Lunar X Prize teams that develop small scale lunar missions. Recent commercial endeavors such as "Planet Labs inc." and Sky Box Imaging, inc. show that there are new benefits and business models associated with miniaturization of space hardware. The Nano-Scale Sample Acquisition System includes NanoDrill for capture of small rock cores and PlanetVac for capture of surface regolith. These two systems are part of the ongoing effort to develop "Micro Sampling" systems for deployment by the small spacecraft with limited payload capacities. The ideal applications include prospecting missions to the Moon and Asteroids. The MicroDrill is a rotary-percussive coring drill that captures cores 7 mm in diameter and up to 2 cm long. The drill weighs less than 1 kg and can capture a core from a 40 MPa strength rock within a few minutes, with less than 10 Watt power and less than 10 Newton of preload. The PlanetVac is a pneumatic based regolith acquisition system that can capture surface sample in touch-and-go maneuver. These sampling systems were integrated within the footpads of commercial quadcopter for testing. As such, they could also be used by geologists on Earth to explore difficult to get to locations.
International Nuclear Information System (INIS)
Wu Zhi-Hai; Peng Li; Xie Lin-Bo; Wen Ji-Wei
2013-01-01
In this paper we provide a unified framework for consensus tracking of leader-follower multi-agent systems with measurement noises based on sampled data with a general sampling delay. First, a stochastic bounded consensus tracking protocol based on sampled data with a general sampling delay is presented by employing the delay decomposition technique. Then, necessary and sufficient conditions are derived for guaranteeing leader-follower multi-agent systems with measurement noises and a time-varying reference state to achieve mean square bounded consensus tracking. The obtained results cover no sampling delay, a small sampling delay and a large sampling delay as three special cases. Last, simulations are provided to demonstrate the effectiveness of the theoretical results. (interdisciplinary physics and related areas of science and technology)
Variable-temperature sample system for ion implantation at -192 to +5000C
International Nuclear Information System (INIS)
Fuller, C.T.
1978-04-01
A variable-temperature sample system based on exchange-gas coupling was developed for ion-implantation use. The sample temperature can be controlled from -192 0 C to +500 0 C with rapid cooling. The system also has provisions for focusing and alignment of the ion beam, electron suppression, temperature monitoring, sample current measuring, and cryo-shielding. Design considerations and operating characteristics are discussed. 5 figures
Industrial variographic analysis for continuous sampling system validation
DEFF Research Database (Denmark)
Engström, Karin; Esbensen, Kim Harry
2017-01-01
Karin Engström, LKAB mining, Kiruna, Sweden, continues to present illuminative cases from process industry. Here she reveals more from her ongoing PhD project showing application of variographic characterisation for on-line continuous control of process sampling systems, including the one...
Does Pneumatic Tube System Transport Contribute to Hemolysis in ED Blood Samples?
Phelan, Michael P; Reineks, Edmunds Z; Hustey, Fredric M; Berriochoa, Jacob P; Podolsky, Seth R; Meldon, Stephen; Schold, Jesse D; Chamberlin, Janelle; Procop, Gary W
2016-09-01
Our goal was to determine if the hemolysis among blood samples obtained in an emergency department and then sent to the laboratory in a pneumatic tube system was different from those in samples that were hand-carried. The hemolysis index is measured on all samples submitted for potassium analysis. We queried our hospital laboratory database system (SunQuest(®)) for potassium results for specimens obtained between January 2014 and July 2014. From facility maintenance records, we identified periods of system downtime, during which specimens were hand-carried to the laboratory. During the study period, 15,851 blood specimens were transported via our pneumatic tube system and 92 samples were hand delivered. The proportions of hemolyzed specimens in the two groups were not significantly different (13.6% vs. 13.1% [p=0.90]). Results were consistent when the criterion was limited to gross (3.3% vs 3.3% [p=0.99]) or mild (10.3% vs 9.8% [p=0.88]) hemolysis. The hemolysis rate showed minimal variation during the study period (12.6%-14.6%). We found no statistical difference in the percentages of hemolyzed specimens transported by a pneumatic tube system or hand delivered to the laboratory. Certain features of pneumatic tube systems might contribute to hemolysis (e.g., speed, distance, packing material). Since each system is unique in design, we encourage medical facilities to consider whether their method of transport might contribute to hemolysis in samples obtained in the emergency department.
Liang, Jialin; Huang, Shaosong; Dai, Yongkang; Li, Lei; Sun, Shuiyu
2015-11-01
Sludge conditioning with Fenton's reagent and lime is a valid method for sludge dewatering. This study investigated the influence of different organic matter content sludge on sludge dewatering and discussed the main mechanism of sludge conditioning by combined Fenton's reagent and lime. The results indicated that the specific resistance to filterability (SRF) of sludge was reduced efficiently by approximately 90%, when conditioned with Fenton's reagent and lime. Through single factor experiments, the optimal conditioning combinations were found. In addition, the relationship between VSS% and consumption of the reagents was detected. Furthermore, it was also demonstrated that the SRF and filtrate TOC values had a significant correlation with VSS% of sludge (including raw and conditioned). The main mechanism of sludge dewatering was also investigated. Firstly, it revealed that the dewaterability of sludge was closely correlated to extracellular polymeric substances (EPS) and bound water contents. Secondly, the results of scanning electron microscopy (SEM) stated that sludge particles were to be smaller and thinner after conditioning. And this structure could easily form outflow channels for releasing free water. Additionally, with the ultrahigh pressure filtration system, the water content of sludge cake conditioned with Fenton's reagent and lime could be reduced to below 50%. Moreover, the economic assessment shows that Fenton's reagent and lime combined with ultrahigh pressure filtration system can be an economical and viable technology for sewage sludge dewatering. Finally, three types of sludge were classified: (1) Fast to dewater; (2) Moderately fast to dewater; (3) Slow to dewater sludge. Copyright © 2015 Elsevier Ltd. All rights reserved.
Quantitative measurement of hypertrophic scar: interrater reliability and concurrent validity.
Nedelec, Bernadette; Correa, José A; Rachelska, Grazyna; Armour, Alexis; LaSalle, Léo
2008-01-01
Research into the pathophysiology and treatment of hypertrophic scar (HSc) remains limited by the heterogeneity of scar and the imprecision with which its severity is measured. The objective of this study was to test the interrater reliability and concurrent validity of the Cutometer measurement of elasticity, the Mexameter measurement of erythema and pigmentation, and total thickness measure of the DermaScan C relative to the modified Vancouver Scar Scale (mVSS) in patient-matched normal skin, normal scar, and HSc. Three independent investigators evaluated 128 sites (severe HSc, moderate or mild HSc, donor site, and normal skin) on 32 burn survivors using all of the above measurement tools. The intraclass correlation coefficient, which was used to measure interrater reliability, reflects the inherent amount of error in the measure and is considered acceptable when it is >0.75. Interrater reliability of the totals of the height, pliability, and vascularity subscales of the mVSS fell below the acceptable limit ( congruent with0.50). The individual subscales of the mVSS fell well below the acceptable level (0.89) for each study site with the exception of severe scar. Mexameter and DermaScan C reliability measurements were acceptable for all sites (>0.82). Concurrent validity correlations with the mVSS were significant except for the comparison of the mVSS pliability subscale and the Cutometer maximum deformation measure comparison in severe scar. In conclusion, the Mexameter and DermaScan C measurements of scar color and thickness of all sites, as well as the Cutometer measurement of elasticity in all but the most severe scars shows high interrater reliability. Their significant concurrent validity with the mVSS confirms that these tools are measuring the same traits as the mVSS, and in a more objective way.
Testing of a Microfluidic Sampling System for High Temperature Electrochemical MC&A
Energy Technology Data Exchange (ETDEWEB)
Pereira, Candido [Argonne National Lab. (ANL), Argonne, IL (United States); Nichols, Kevin [Argonne National Lab. (ANL), Argonne, IL (United States)
2013-11-27
This report describes the preliminary validation of a high-temperature microfluidic chip system for sampling of electrochemical process salt. Electroanalytical and spectroscopic techniques are attractive candidates for improvement through high-throughput sample analysis via miniaturization. Further, microfluidic chip systems are amenable to micro-scale chemical processing such as rapid, automated sample purification to improve sensor performance. The microfluidic chip was tested to determine the feasibility of the system for high temperature applications and conditions under which microfluidic systems can be used to generate salt droplets at process temperature to support development of material balance and control systems in a used fuel treatment facility. In FY13, the project focused on testing a quartz microchip device with molten salts at near process temperatures. The equipment was installed in glove box and tested up to 400°C using commercial thermal transfer fluids as the carrier phase. Preliminary tests were carried out with a low-melting halide salt to initially characterize the properties of this novel liquid-liquid system and to investigate the operating regimes for inducing droplet flow within candidate carrier fluids. Initial results show that the concept is viable for high temperature sampling but further development is required to optimize the system to operate with process relevant molten salts.
Ghorbani, M; Eskicioglu, C
2011-12-01
Batch and semi-continuous flow aerobic digesters were used to stabilize thickened waste-activated sludge at different initial conditions and mean solids retention times. Under dynamic conditions, total suspended solids, volatile suspended solids (VSS) and total and particulate chemical oxygen demand (COD and PCOD) were monitored in the batch reactors and effluent from the semi-continuous flow reactors. Activated Sludge Model (ASM) no. 1 and ASM no. 3 were applied to measured data (calibration data set) to evaluate the consistency and performances of models at different flow regimes for digester COD and VSS modelling. The results indicated that both ASM1 and ASM3 predicted digester COD, VSS and PCOD concentrations well (R2, Ra2 > or = 0.93). Parameter estimation concluded that compared to ASM1, ASM3 parameters were more consistent across different batch and semi-continuous flow runs with different operating conditions. Model validation on a data set independent from the calibration data successfully predicted digester COD (R2 = 0.88) and VSS (R2 = 0.94) concentrations by ASM3, while ASM1 overestimated both reactor COD (R2 = 0.74) and VSS concentrations (R2 = 0.79) after 15 days of aerobic batch digestion.
Use the Bar Code System to Improve Accuracy of the Patient and Sample Identification.
Chuang, Shu-Hsia; Yeh, Huy-Pzu; Chi, Kun-Hung; Ku, Hsueh-Chen
2018-01-01
In time and correct sample collection were highly related to patient's safety. The sample error rate was 11.1%, because misbranded patient information and wrong sample containers during January to April, 2016. We developed a barcode system of "Specimens Identify System" through process of reengineering of TRM, used bar code scanners, add sample container instructions, and mobile APP. Conclusion, the bar code systems improved the patient safety and created green environment.
Does Pneumatic Tube System Transport Contribute to Hemolysis in ED Blood Samples?
Directory of Open Access Journals (Sweden)
Fredric M. Hustey
2016-09-01
Full Text Available Introduction: Our goal was to determine if the hemolysis among blood samples obtained in an emergency department and then sent to the laboratory in a pneumatic tube system was different from those in samples that were hand-carried. Methods: The hemolysis index is measured on all samples submitted for potassium analysis. We queried our hospital laboratory database system (SunQuest® for potassium results for specimens obtained between January 2014 and July 2014. From facility maintenance records, we identified periods of system downtime, during which specimens were hand-carried to the laboratory. Results: During the study period, 15,851 blood specimens were transported via our pneumatic tube system and 92 samples were hand delivered. The proportions of hemolyzed specimens in the two groups were not significantly different (13.6% vs. 13.1% [p=0.90]. Results were consistent when the criterion was limited to gross (3.3% vs 3.3% [p=0.99] or mild (10.3% vs 9.8% [p=0.88] hemolysis. The hemolysis rate showed minimal variation during the study period (12.6%–14.6%. Conclusion: We found no statistical difference in the percentages of hemolyzed specimens transported by a pneumatic tube system or hand delivered to the laboratory. Certain features of pneumatic tube systems might contribute to hemolysis (e.g., speed, distance, packing material. Since each system is unique in design, we encourage medical facilities to consider whether their method of transport might contribute to hemolysis in samples obtained in the emergency department.
An automated blood sampling system used in positron emission tomography
International Nuclear Information System (INIS)
Eriksson, L.; Bohm, C.; Kesselberg, M.
1988-01-01
Fast dynamic function studies with positron emission tomography (PET), has the potential to give accurate information of physiological functions of the brain. This capability can be realised if the positron camera system accurately quantitates the tracer uptake in the brain with sufficiently high efficiency and in sufficiently short time intervals. However, in addition, the tracer concentration in blood, as a function of time, must be accurately determined. This paper describes and evaluates an automated blood sampling system. Two different detector units are compared. The use of the automated blood sampling system is demonstrated in studies of cerebral blood flow, in studies of the blood-brain barrier transfer of amino acids and of the cerebral oxygen consumption. 5 refs.; 7 figs
Neuro-genetic system for optimization of GMI samples sensitivity.
Pitta Botelho, A C O; Vellasco, M M B R; Hall Barbosa, C R; Costa Silva, E
2016-03-01
Magnetic sensors are largely used in several engineering areas. Among them, magnetic sensors based on the Giant Magnetoimpedance (GMI) effect are a new family of magnetic sensing devices that have a huge potential for applications involving measurements of ultra-weak magnetic fields. The sensitivity of magnetometers is directly associated with the sensitivity of their sensing elements. The GMI effect is characterized by a large variation of the impedance (magnitude and phase) of a ferromagnetic sample, when subjected to a magnetic field. Recent studies have shown that phase-based GMI magnetometers have the potential to increase the sensitivity by about 100 times. The sensitivity of GMI samples depends on several parameters, such as sample length, external magnetic field, DC level and frequency of the excitation current. However, this dependency is yet to be sufficiently well-modeled in quantitative terms. So, the search for the set of parameters that optimizes the samples sensitivity is usually empirical and very time consuming. This paper deals with this problem by proposing a new neuro-genetic system aimed at maximizing the impedance phase sensitivity of GMI samples. A Multi-Layer Perceptron (MLP) Neural Network is used to model the impedance phase and a Genetic Algorithm uses the information provided by the neural network to determine which set of parameters maximizes the impedance phase sensitivity. The results obtained with a data set composed of four different GMI sample lengths demonstrate that the neuro-genetic system is able to correctly and automatically determine the set of conditioning parameters responsible for maximizing their phase sensitivities. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
LOCKREM, L.L.
1999-01-01
This data package presents sampling data and analytical results from the March 28, 1999, vapor sampling of Hanford Site single-shell tank 241-C-106 during active sluicing. Samples were obtained from the 296-C-006 ventilation system stack and ambient air at several locations. Characterization Project Operations (CPO) was responsible for the collection of all SUMMATM canister samples. The Special Analytical Support (SAS) vapor team was responsible for the collection of all triple sorbent trap (TST), sorbent tube train (STT), polyurethane foam (PUF), and particulate filter samples collected at the 296-C-006 stack. The SAS vapor team used the non-electrical vapor sampling (NEVS) system to collect samples of the air, gases, and vapors from the 296-C-006 stack. The SAS vapor team collected and analyzed these samples for Lockheed Martin Hanford Corporation (LMHC) and Tank Waste Remediation System (TWRS) in accordance with the sampling and analytical requirements specified in the Waste Retrieval Sluicing System Vapor Sampling and Analysis Plan (SAP) for Evaluation of Organic Emissions, Process Test Phase III, HNF-4212, Rev. 0-A, (LMHC, 1999). All samples were stored in a secured Radioactive Materials Area (RMA) until the samples were radiologically released and received by SAS for analysis. The Waste Sampling and Characterization Facility (WSCF) performed the radiological analyses. The samples were received on April 5, 1999
Sample Management System for Heavy Ion Irradiation, Phase II
National Aeronautics and Space Administration — A robotic sample management device and system for the exposure of biological and material specimens to heavy ion beams of the NASA Space Radiation Laboratory (NSRL)...
Sample Management System for Heavy Ion Irradiation, Phase I
National Aeronautics and Space Administration — A robotic sample management device and system for the exposure of biological and material specimens to heavy ion beams of the NASA Space Radiation Laboratory (NSRL)...
The installation of a multiport ground-water sampling system in the 300 Area
International Nuclear Information System (INIS)
Gilmore, T.J.
1989-06-01
In 1988, the Pacific Northwest Laboratory installed a multiport groundwater sampling system in well 399-1-20, drilled north of the 300 Area on the Hanford Site in southwestern Washington State. The purpose of installing the multiport system is to evaluate methods of determining the vertical distribution of contaminants and hydraulic heads in ground water. Well 399-1-20 is adjacent to a cluster of four Resource Conservation and Recovery Act (RCRA) ground-water monitoring wells. This proximity makes it possible to compare sampling intervals and head measurements between the multiport system and the RCRA monitoring wells. Drilling and installation of the multiport system took 42 working days. Six sampling ports were installed in the upper unconfined aquifer at depths of approximately 120, 103, 86, 74, 56, and 44 feet. The locations of the sampling ports were determined by the hydrogeology of the area and the screened intervals of adjacent ground-water monitoring wells. The system was installed by backfilling sand around the sampling ports and isolating the ports with bentonite seals. The method proved adequate. For future installation, however, development and evaluation of an alternative method is recommended. In the alternative method suggested, the multiport system would be placed inside a cased and screened well, using packers to isolate the sampling zones. 4 refs., 8 figs., 1 tab
Development of an automatic sample changer and a data acquisition system
International Nuclear Information System (INIS)
Bianchini, Ricardo M.; Estevez, Jorge; Vollmer, Alberto E.; Iglicki, Flora A.
1999-01-01
An automatic electro-pneumatic sample changer with a rotating sample holder is described. The changer is coupled through an electronic interface with the data acquisition station. The software to automate the system has been designed. (author)
Systems and methods for laser assisted sample transfer to solution for chemical analysis
Van Berkel, Gary J; Kertesz, Vilmos; Ovchinnikova, Olga S
2013-08-27
Systems and methods are described for laser ablation of an analyte from a specimen and capturing of the analyte in a dispensed solvent to form a testing solution. A solvent dispensing and extraction system can form a liquid microjunction with the specimen. The solvent dispensing and extraction system can include a surface sampling probe. The laser beam can be directed through the surface sampling probe. The surface sampling probe can also serve as an atomic force microscopy probe. The surface sampling probe can form a seal with the specimen. The testing solution including the analyte can then be analyzed using an analytical instrument or undergo further processing.
Energy Technology Data Exchange (ETDEWEB)
Nishiyama, Hidetoshi, E-mail: hinishiy@jeol.co.jp [JEOL Ltd., 3-1-2, Musashino, Akishima, Tokyo 196-8558 (Japan); Koizumi, Mitsuru, E-mail: koizumi@jeol.co.jp [JEOL Technics Ltd., 2-6-38 Musashino, Akishima, Tokyo 196-0021 (Japan); Ogawa, Koji, E-mail: kogawa@jeol.co.jp [JEOL Technics Ltd., 2-6-38 Musashino, Akishima, Tokyo 196-0021 (Japan); Kitamura, Shinich, E-mail: kitamura@jeol.co.jp [JEOL Ltd., 3-1-2, Musashino, Akishima, Tokyo 196-8558 (Japan); Konyuba, Yuji, E-mail: ykonyuub@jeol.co.jp [JEOL Ltd., 3-1-2, Musashino, Akishima, Tokyo 196-8558 (Japan); Watanabe, Yoshiyuki, E-mail: watanabeyoshiy@pref.yamagata.jp [Yamagata Research Institute of Technology, 2-2-1, Matsuei, Yamagata 990-2473 (Japan); Ohbayashi, Norihiko, E-mail: n.ohbayashi@m.tohoku.ac.jp [Laboratory of Membrane Trafficking Mechanisms, Department of Developmental Biology and Neurosciences, Graduate School of Life Sciences, Tohoku University, Aobayama, Aoba-ku, Sendai, Miyagi 980-8578 (Japan); Fukuda, Mitsunori, E-mail: nori@m.tohoku.ac.jp [Laboratory of Membrane Trafficking Mechanisms, Department of Developmental Biology and Neurosciences, Graduate School of Life Sciences, Tohoku University, Aobayama, Aoba-ku, Sendai, Miyagi 980-8578 (Japan); Suga, Mitsuo, E-mail: msuga@jeol.co.jp [JEOL Ltd., 3-1-2, Musashino, Akishima, Tokyo 196-8558 (Japan); Sato, Chikara, E-mail: ti-sato@aist.go.jp [Biomedical Research Institute, National Institute of Advanced Industrial Science and Technology (AIST), 1-1-4, Umezono, Tsukuba 305-8568 (Japan)
2014-12-15
An atmospheric scanning electron microscope (ASEM) with an open sample chamber and optical microscope (OM) is described and recent developments are reported. In this ClairScope system, the base of the open sample dish is sealed to the top of the inverted SEM column, allowing the liquid-immersed sample to be observed by OM from above and by SEM from below. The optical axes of the two microscopes are aligned, ensuring that the same sample areas are imaged to realize quasi-simultaneous correlative microscopy in solution. For example, the cathodoluminescence of ZnO particles was directly demonstrated. The improved system has (i) a fully motorized sample stage, (ii) a column protection system in the case of accidental window breakage, and (iii) an OM/SEM operation system controlled by a graphical user interface. The open sample chamber allows the external administration of reagents during sample observation. We monitored the influence of added NaCl on the random motion of silica particles in liquid. Further, using fluorescence as a transfection marker, the effect of small interfering RNA-mediated knockdown of endogenous Varp on Tyrp1 trafficking in melanocytes was examined. A temperature-regulated titanium ASEM dish allowed the dynamic observation of colloidal silver nanoparticles as they were heated to 240 °C and sintered. - Highlights: • Atmospheric SEM (ASEM) allows observation of samples in liquid or gas. • Open sample chamber allows in situ monitoring of evaporation and sintering processes. • in situ monitoring of processes during reagent administration is also accomplished. • Protection system for film breakage is developed for ASEM. • Usability of ASEM has been improved significantly including GUI control.
International Nuclear Information System (INIS)
Nishiyama, Hidetoshi; Koizumi, Mitsuru; Ogawa, Koji; Kitamura, Shinich; Konyuba, Yuji; Watanabe, Yoshiyuki; Ohbayashi, Norihiko; Fukuda, Mitsunori; Suga, Mitsuo; Sato, Chikara
2014-01-01
An atmospheric scanning electron microscope (ASEM) with an open sample chamber and optical microscope (OM) is described and recent developments are reported. In this ClairScope system, the base of the open sample dish is sealed to the top of the inverted SEM column, allowing the liquid-immersed sample to be observed by OM from above and by SEM from below. The optical axes of the two microscopes are aligned, ensuring that the same sample areas are imaged to realize quasi-simultaneous correlative microscopy in solution. For example, the cathodoluminescence of ZnO particles was directly demonstrated. The improved system has (i) a fully motorized sample stage, (ii) a column protection system in the case of accidental window breakage, and (iii) an OM/SEM operation system controlled by a graphical user interface. The open sample chamber allows the external administration of reagents during sample observation. We monitored the influence of added NaCl on the random motion of silica particles in liquid. Further, using fluorescence as a transfection marker, the effect of small interfering RNA-mediated knockdown of endogenous Varp on Tyrp1 trafficking in melanocytes was examined. A temperature-regulated titanium ASEM dish allowed the dynamic observation of colloidal silver nanoparticles as they were heated to 240 °C and sintered. - Highlights: • Atmospheric SEM (ASEM) allows observation of samples in liquid or gas. • Open sample chamber allows in situ monitoring of evaporation and sintering processes. • in situ monitoring of processes during reagent administration is also accomplished. • Protection system for film breakage is developed for ASEM. • Usability of ASEM has been improved significantly including GUI control
Sampling Transition Pathways in Highly Correlated Complex Systems
Energy Technology Data Exchange (ETDEWEB)
Chandler, David
2004-10-20
This research grant supported my group's efforts to apply and extend the method of transition path sampling that we invented during the late 1990s. This methodology is based upon a statistical mechanics of trajectory space. Traditional statistical mechanics focuses on state space, and with it, one can use Monte Carlo methods to facilitate importance sampling of states. With our formulation of a statistical mechanics of trajectory space, we have succeeded at creating algorithms by which importance sampling can be done for dynamical processes. In particular, we are able to study rare but important events without prior knowledge of transition states or mechanisms. In perhaps the most impressive application of transition path sampling, my group combined forces with Michele Parrinello and his coworkers to unravel the dynamics of auto ionization of water [5]. This dynamics is the fundamental kinetic step of pH. Other applications concern nature of dynamics far from equilibrium [1, 7], nucleation processes [2], cluster isomerization, melting and dissociation [3, 6], and molecular motors [10]. Research groups throughout the world are adopting transition path sampling. In part this has been the result of our efforts to provide pedagogical presentations of the technique [4, 8, 9], as well as providing new procedures for interpreting trajectories of complex systems [11].
Borg, Charmaine; de Jong, Peter J.; Georgiadis, Janniko R.
Lifetime experiences shape people's attitudes toward sexual stimuli. Visual sexual stimulation (VSS), for instance, may be perceived as pleasurable by some, but as disgusting or ambiguous by others. VSS depicting explicit penile-vaginal penetration (PEN) is relevant in this respect, because the act
Ye, Tingting; Li, Xiang; Zhang, Ting; Su, Yinglong; Zhang, Wenjuan; Li, Jun; Gan, Yanfei; Zhang, Ai; Liu, Yanan; Xue, Gang
2018-03-20
Bio-refinery of food waste and waste activated sludge to high value-added chemicals, such as lactic acid, has attracted particular interest in recent years. In this paper, the effect of copper (II) dosing to the organic waste fermentation system on lactic acid production was evaluated, which proved to be a promising method to stimulate high yield of lactic acid (77.0% higher than blank) at dosage of 15 μM-Cu 2+ /g VSS. As mechanism study suggested, copper addition enhanced the activity of α-glycosidase and glycolysis, which increased the substrate for subsequent acidification; whereas, the high dosage (70 μM-Cu 2+ /g VSS) inhibited the conversion of lactic acid to VFA, thus stabilized lactic acid concentration. Microbial community study revealed that small amount of copper (II) at 15 μM/g VSS resulted in the proliferation of Lactobacillus to 82.6%, which mainly produced lactic acid. Finally, the variation of functional capabilities implied that the proposed homeostatic system II was activated at relatively low concentration of copper. Meanwhile, membrane transport function and carbohydrate metabolism were also strengthened. This study provides insights into the effect of copper (II) on the enhancement of lactic acid production from co-fermentation of food waste and waste activated sludge. Copyright © 2018 Elsevier Ltd. All rights reserved.
Cryogenic Liquid Sample Acquisition System for Remote Space Applications
Mahaffy, Paul; Trainer, Melissa; Wegel, Don; Hawk, Douglas; Melek, Tony; Johnson, Christopher; Amato, Michael; Galloway, John
2013-01-01
There is a need to acquire autonomously cryogenic hydrocarbon liquid sample from remote planetary locations such as the lakes of Titan for instruments such as mass spectrometers. There are several problems that had to be solved relative to collecting the right amount of cryogenic liquid sample into a warmer spacecraft, such as not allowing the sample to boil off or fractionate too early; controlling the intermediate and final pressures within carefully designed volumes; designing for various particulates and viscosities; designing to thermal, mass, and power-limited spacecraft interfaces; and reducing risk. Prior art inlets for similar instruments in spaceflight were designed primarily for atmospheric gas sampling and are not useful for this front-end application. These cryogenic liquid sample acquisition system designs for remote space applications allow for remote, autonomous, controlled sample collections of a range of challenging cryogenic sample types. The design can control the size of the sample, prevent fractionation, control pressures at various stages, and allow for various liquid sample levels. It is capable of collecting repeated samples autonomously in difficult lowtemperature conditions often found in planetary missions. It is capable of collecting samples for use by instruments from difficult sample types such as cryogenic hydrocarbon (methane, ethane, and propane) mixtures with solid particulates such as found on Titan. The design with a warm actuated valve is compatible with various spacecraft thermal and structural interfaces. The design uses controlled volumes, heaters, inlet and vent tubes, a cryogenic valve seat, inlet screens, temperature and cryogenic liquid sensors, seals, and vents to accomplish its task.
The Sample Handling System for the Mars Icebreaker Life Mission: from Dirt to Data
Dave, Arwen; Thompson, Sarah J.; McKay, Christopher P.; Stoker, Carol R.; Zacny, Kris; Paulsen, Gale; Mellerowicz, Bolek; Glass, Brian J.; Wilson, David; Bonaccorsi, Rosalba;
2013-01-01
The Mars icebreaker life mission will search for subsurface life on mars. It consists of three payload elements: a drill to retrieve soil samples from approx. 1 meter below the surface, a robotic sample handling system to deliver the sample from the drill to the instruments, and the instruments themselves. This paper will discuss the robotic sample handling system.
Lee, Sohee; Kim, Ha Yan; Lee, Cho Rok; Park, Seulkee; Son, Haiyoung; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Chung, Woong Youn; Park, Cheong Soo
2014-07-01
Body image is associated with self-esteem and identity and has a close relationship with quality of life (QoL). We compared the impact of surgical scars on the patient's perception of body image between conventional open thyroidectomy (OT) and robotic thyroidectomy (RT) in female papillary thyroid carcinoma patients. From October 2009 to December 2010, we enrolled prospectively 116 papillary thyroid carcinoma patients who underwent total thyroidectomy at the Yonsei University Health System (Seoul, Korea). Of these 116 patients, 56 had OT and 60 RT. Their scars were assessed using the Vancouver Scar Scale (VSS), and psychometric properties were evaluated using the Body Image Scale (BIS) questionnaire postoperatively. Both groups were compared using cross-sectional and time-series methods. Mean age was significantly younger in the RT group. Regarding scar quality, the OT group showed superiority in scar pigmentation and the total VSS score during the early postoperative period, but the VSS score improved over time and was similar between both groups at 9 months. The RT group had better scores regarding most of the BIS items, a trend that remained relatively constant over time. In patients with noticeable scars (VSS ≥ 2) at 9 months, the RT group had better BIS scores regarding almost all items, including "self-conscious," "physical attractiveness," "feeling of less feminine," "sexual attractiveness," "dissatisfaction with body, scar and appearance when dressed," and "avoidance of people due to appearance." RT provides a better self-body image and improves QoL compared with conventional OT by avoiding a noticeable cervical scar. Copyright © 2014 Mosby, Inc. All rights reserved.
Chemical and Metallurgy Research (CMR) Sample Tracking System Design Document
International Nuclear Information System (INIS)
Bargelski, C. J.; Berrett, D. E.
1998-01-01
The purpose of this document is to describe the system architecture of the Chemical and Metallurgy Research (CMR) Sample Tracking System at Los Alamos National Laboratory. During the course of the document observations are made concerning the objectives, constraints and limitations, technical approaches, and the technical deliverables
Walsh, David I; Murthy, Shashi K; Russom, Aman
2016-10-01
Point-of-care (POC) microfluidic devices often lack the integration of common sample preparation steps, such as preconcentration, which can limit their utility in the field. In this technology brief, we describe a system that combines the necessary sample preparation methods to perform sample-to-result analysis of large-volume (20 mL) biopsy model samples with staining of captured cells. Our platform combines centrifugal-paper microfluidic filtration and an analysis system to process large, dilute biological samples. Utilizing commercialization-friendly manufacturing methods and materials, yielding a sample throughput of 20 mL/min, and allowing for on-chip staining and imaging bring together a practical, yet powerful approach to microfluidic diagnostics of large, dilute samples. © 2016 Society for Laboratory Automation and Screening.
Decker, David L.; Lyles, Brad F.; Purcell, Richard G.; Hershey, Ronald Lee
2013-04-16
The present disclosure provides an apparatus and method for coupling conduit segments together. A first pump obtains a sample and transmits it through a first conduit to a reservoir accessible by a second pump. The second pump further conducts the sample from the reservoir through a second conduit.
SAIL--a software system for sample and phenotype availability across biobanks and cohorts.
Gostev, Mikhail; Fernandez-Banet, Julio; Rung, Johan; Dietrich, Joern; Prokopenko, Inga; Ripatti, Samuli; McCarthy, Mark I; Brazma, Alvis; Krestyaninova, Maria
2011-02-15
The Sample avAILability system-SAIL-is a web based application for searching, browsing and annotating biological sample collections or biobank entries. By providing individual-level information on the availability of specific data types (phenotypes, genetic or genomic data) and samples within a collection, rather than the actual measurement data, resource integration can be facilitated. A flexible data structure enables the collection owners to provide descriptive information on their samples using existing or custom vocabularies. Users can query for the available samples by various parameters combining them via logical expressions. The system can be scaled to hold data from millions of samples with thousands of variables. SAIL is available under Aferro-GPL open source license: https://github.com/sail.
Monte Carlo importance sampling optimization for system reliability applications
International Nuclear Information System (INIS)
Campioni, Luca; Vestrucci, Paolo
2004-01-01
This paper focuses on the reliability analysis of multicomponent systems by the importance sampling technique, and, in particular, it tackles the optimization aspect. A methodology based on the minimization of the variance at the component level is proposed for the class of systems consisting of independent components. The claim is that, by means of such a methodology, the optimal biasing could be achieved without resorting to the typical approach by trials
The computer system for the express-analysis of the irradiation samples
International Nuclear Information System (INIS)
Vzorov, I.K.; Kalmykov, A.V.; Korenev, S.A.; Minashkin, V.F.; Sikolenko, V.V.
1999-01-01
The computer system for the express-analysis (SEA) of the irradiation samples is described. The system is working together with the pulse high current electrons and ions source. It allows us to correct irradiation regime in real time. The SEA system automatically measures volt-ampere and volt-farad characteristics, sample resistance by 'four-probe' method, sample capacitor parameters. Its parameters are: in the volt-ampere measuring regime - U max = 200 V, minimal voltage step U sh =0.05 V, voltage accuracy 0.25%; in the capacity measuring regime - capacity measurement diapason 0 - 1600 pF, working frequencies diapason 1 -150 kHz, capacity accuracy 0.5%, voltage shifting diapason 1 - 200 V, minimal step of voltage shifting U sh 0.05 V. The SEA management is performed by IBM/AT computer. The control and measuring apparatus was realized in CAMAC standard. The programmed set consists of the first display procedures, control, treatment and information exit. (author)
The validation of a pixe system for trace element analysis of biological samples
Saied, S. O.; Crumpton, D.; Francois, P. E.
1981-03-01
A PIXE system has been developed for measuring trace element levels in biological samples and a study made of the precision and accuracy achievable. The calibration of the system has been established using thin targets of known elemental composition and the reproducibility studied using protons of energy 2.5 MeV. Both thick and thin samples prepared from NBS bovine liver have been analysed and the elemental ratios present established for a set of replicate samples. These are compared with the results of other workers. Problems relating to sample preparation are discussed.
Automated sample-processing and titration system for determining uranium in nuclear materials
International Nuclear Information System (INIS)
Harrar, J.E.; Boyle, W.G.; Breshears, J.D.; Pomernacki, C.L.; Brand, H.R.; Kray, A.M.; Sherry, R.J.; Pastrone, J.A.
1977-01-01
The system is designed for accurate, precise, and selective determination of from 10 to 180 mg of uranium in 2 to 12 cm 3 of solution. Samples, standards, and their solutions are handled on a weight basis. These weights, together with their appropriate identification numbers, are stored in computer memory and are used automatically in the assay calculations after each titration. The measurement technique (controlled-current coulometry) is based on the Davies-Gray and New Brunswick Laboratory method, in which U(VI) is reduced to U(IV) in strong H 3 PO 4 , followed by titration of the U(IV) with electrogenerated V(V). Solution pretreatment and titration are automatic. The analyzer is able to process 44 samples per loading of the sample changer, at a rate of 4 to 9 samples per hour. The system includes a comprehensive fault-monitoring system that detects analytical errors, guards against abnormal conditions which might cause errors, and prevents unsafe operation. A detailed description of the system, information on the reliability of the component subsystems, and a summary of its evaluation by the New Brunswick Laboratory are presented
Estimating rare events in biochemical systems using conditional sampling
Sundar, V. S.
2017-01-01
The paper focuses on development of variance reduction strategies to estimate rare events in biochemical systems. Obtaining this probability using brute force Monte Carlo simulations in conjunction with the stochastic simulation algorithm (Gillespie's method) is computationally prohibitive. To circumvent this, important sampling tools such as the weighted stochastic simulation algorithm and the doubly weighted stochastic simulation algorithm have been proposed. However, these strategies require an additional step of determining the important region to sample from, which is not straightforward for most of the problems. In this paper, we apply the subset simulation method, developed as a variance reduction tool in the context of structural engineering, to the problem of rare event estimation in biochemical systems. The main idea is that the rare event probability is expressed as a product of more frequent conditional probabilities. These conditional probabilities are estimated with high accuracy using Monte Carlo simulations, specifically the Markov chain Monte Carlo method with the modified Metropolis-Hastings algorithm. Generating sample realizations of the state vector using the stochastic simulation algorithm is viewed as mapping the discrete-state continuous-time random process to the standard normal random variable vector. This viewpoint opens up the possibility of applying more sophisticated and efficient sampling schemes developed elsewhere to problems in stochastic chemical kinetics. The results obtained using the subset simulation method are compared with existing variance reduction strategies for a few benchmark problems, and a satisfactory improvement in computational time is demonstrated.
Solar System Samples for Research, Education, and Public Outreach
Allen, J.; Luckey, M.; McInturff, B.; Kascak, A.; Tobola, K.; Galindo, C.; Allen, C.
2011-01-01
In the next two years, during the NASA Year of the Solar System, spacecraft from NASA and our international partners will; encounter a comet, orbit asteroid 4 Vesta, continue to explore Mars with rovers, and launch robotic explorers to the Moon and Mars. We have pieces of all these worlds in our laboratories, and their continued study provides incredibly valuable "ground truth" to complement space exploration missions. Extensive information about these unique materials, as well as actual lunar samples and meteorites, are available for display and education. The Johnson Space Center (JSC) has the unique responsibility to curate NASA's extraterrestrial samples from past and future missions. Curation includes documentation, preservation, preparation, and distribution of samples for research, education, and public outreach.
Mobile Variable Depth Sampling System Design Study
International Nuclear Information System (INIS)
BOGER, R.M.
2000-01-01
A design study is presented for a mobile, variable depth sampling system (MVDSS) that will support the treatment and immobilization of Hanford LAW and HLW. The sampler can be deployed in a 4-inch tank riser and has a design that is based on requirements identified in the Level 2 Specification (latest revision). The waste feed sequence for the MVDSS is based on Phase 1, Case 3S6 waste feed sequence. Technical information is also presented that supports the design study
Mobile Variable Depth Sampling System Design Study
Energy Technology Data Exchange (ETDEWEB)
BOGER, R.M.
2000-08-25
A design study is presented for a mobile, variable depth sampling system (MVDSS) that will support the treatment and immobilization of Hanford LAW and HLW. The sampler can be deployed in a 4-inch tank riser and has a design that is based on requirements identified in the Level 2 Specification (latest revision). The waste feed sequence for the MVDSS is based on Phase 1, Case 3S6 waste feed sequence. Technical information is also presented that supports the design study.
Sampled-Data Consensus of Linear Multi-agent Systems With Packet Losses.
Zhang, Wenbing; Tang, Yang; Huang, Tingwen; Kurths, Jurgen
In this paper, the consensus problem is studied for a class of multi-agent systems with sampled data and packet losses, where random and deterministic packet losses are considered, respectively. For random packet losses, a Bernoulli-distributed white sequence is used to describe packet dropouts among agents in a stochastic way. For deterministic packet losses, a switched system with stable and unstable subsystems is employed to model packet dropouts in a deterministic way. The purpose of this paper is to derive consensus criteria, such that linear multi-agent systems with sampled-data and packet losses can reach consensus. By means of the Lyapunov function approach and the decomposition method, the design problem of a distributed controller is solved in terms of convex optimization. The interplay among the allowable bound of the sampling interval, the probability of random packet losses, and the rate of deterministic packet losses are explicitly derived to characterize consensus conditions. The obtained criteria are closely related to the maximum eigenvalue of the Laplacian matrix versus the second minimum eigenvalue of the Laplacian matrix, which reveals the intrinsic effect of communication topologies on consensus performance. Finally, simulations are given to show the effectiveness of the proposed results.In this paper, the consensus problem is studied for a class of multi-agent systems with sampled data and packet losses, where random and deterministic packet losses are considered, respectively. For random packet losses, a Bernoulli-distributed white sequence is used to describe packet dropouts among agents in a stochastic way. For deterministic packet losses, a switched system with stable and unstable subsystems is employed to model packet dropouts in a deterministic way. The purpose of this paper is to derive consensus criteria, such that linear multi-agent systems with sampled-data and packet losses can reach consensus. By means of the Lyapunov function
Resonance ionization mass spectrometry system for measurement of environmental samples
International Nuclear Information System (INIS)
Pibida, L.; McMahon, C.A.; Noertershaeuser, W.; Bushaw, B.A.
2002-01-01
A resonance ionization mass spectrometry (RIMS) system has been developed at the National Institute of Standards and Technology (NIST) for sensitive and selective determination of radio-cesium in the environment. The overall efficiency was determined to be 4x10-7 with a combined (laser and mass spectrometer) selectivity of 108 for both 135Cs and 137Cs with respect to 133Cs. RIMS isotopic ratio measurements of 135Cs/ 137Cs were performed on a nuclear fuel burn-up sample and compared to measurements on a similar system at Pacific Northwest National Laboratory (PNNL) and to conventional thermal ionization mass spectrometry (TIMS). Results of preliminary RIMS investigations on a freshwater lake sediment sample are also discussed
Computer system for environmental sample analysis and data storage and analysis
International Nuclear Information System (INIS)
Brauer, F.P.; Fager, J.E.
1976-01-01
A mini-computer based environmental sample analysis and data storage system has been developed. The system is used for analytical data acquisition, computation, storage of analytical results, and tabulation of selected or derived results for data analysis, interpretation and reporting. This paper discussed the structure, performance and applications of the system
Control System Radioactive Contamination in Food Samples in Poland
International Nuclear Information System (INIS)
Grabowski, D.; Kurowski, W.; Muszynski, W.; Rubel, B.; Smagala, G.; Swietochowska, J.
2001-01-01
Full text: The analyses of the level of radioactive contamination in food samples are carried out by the Service for Measurements of Radioactive Contamination (SMRC) in Poland. The Service was brought into existence in 1961. The Service comprises of a network of measurement stations and the Centre of Radioactive Contamination Measurements (CRCM). The duty of the Centre is being executed by the Central Laboratory for Radiological Protection (CLRP). The uniform methods of sampling are used in measurement stations. All important foodstuff: milk, meat, vegetables, fruit, cereals are controlled in the Service stations. The radiochemical and spectrometric methods are used to determine the activity of radioactive isotopes. The standard equipment of the measurement station is the measurement system type SAPOS-90 and multichannel analyser with scintillation or germanium detector. The structure of the Service, kinds of samples tested by each station, program of sampling in normal and during accident situation are presented in this paper. (author)
African Journals Online (AJOL)
A retrial queueing-inventory system with J-additional options for service and nite source · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VSS Yadavalli, K Jeganathan, T Venkatesan, S Padmasekaran, S Jehoashan Kingsly, 105-135 ...
Density meter algorithm and system for estimating sampling/mixing uncertainty
International Nuclear Information System (INIS)
Shine, E.P.
1986-01-01
The Laboratories Department at the Savannah River Plant (SRP) has installed a six-place density meter with an automatic sampling device. This paper describes the statistical software developed to analyze the density of uranyl nitrate solutions using this automated system. The purpose of this software is twofold: to estimate the sampling/mixing and measurement uncertainties in the process and to provide a measurement control program for the density meter. Non-uniformities in density are analyzed both analytically and graphically. The mean density and its limit of error are estimated. Quality control standards are analyzed concurrently with process samples and used to control the density meter measurement error. The analyses are corrected for concentration due to evaporation of samples waiting to be analyzed. The results of this program have been successful in identifying sampling/mixing problems and controlling the quality of analyses
Density meter algorithm and system for estimating sampling/mixing uncertainty
International Nuclear Information System (INIS)
Shine, E.P.
1986-01-01
The Laboratories Department at the Savannah River Plant (SRP) has installed a six-place density meter with an automatic sampling device. This paper describes the statisical software developed to analyze the density of uranyl nitrate solutions using this automated system. The purpose of this software is twofold: to estimate the sampling/mixing and measurement uncertainties in the process and to provide a measurement control program for the density meter. Non-uniformities in density are analyzed both analytically and graphically. The mean density and its limit of error are estimated. Quality control standards are analyzed concurrently with process samples and used to control the density meter measurement error. The analyses are corrected for concentration due to evaporation of samples waiting to be analyzed. The results of this program have been successful in identifying sampling/mixing problems and controlling the quality of analyses
Energy Technology Data Exchange (ETDEWEB)
Li, Xiaowei; Xing, Meiyan, E-mail: lixiaowei419@163.com; Yang, Jian; Dai, Xiaohu
2014-07-15
Highlights: • Earthworm growth biomass and activity decreased with the VF depth. • Earthworm gut microbial communities were dominated by Gammaproteobacteria. • δ{sup 15}N and δ{sup 13}C in earthworms decreased with time, and increased with the VF depth. • Effect of earthworm feeding in enhanced VSS reduction was analyzed quantitatively. • Earthworm feeding had low contribution to the enhanced VSS reduction. - Abstract: Previous studies showed that the presence of earthworm improves treatment performance of vermifilter (VF) for sewage sludge stabilization, but earthworm eco-physiological characteristics and effects in VF were not fully investigated. In this study, earthworm population, enzymatic activity, gut microbial community and stable isotopic abundance were investigated in the VF. Results showed that biomass, average weight, number and alkaline phosphatase activity of the earthworms tended to decrease, while protein content and activities of peroxidase and catalase had an increasing tendency as the VF depth. Earthworm gut microbial communities were dominated by Gammaproteobacteria, and the percentages arrived to 76–92% of the microbial species detected. {sup 15}N and {sup 13}C natural abundance of the earthworms decreased with operation time, and increased as the VF depth. Quantitative analysis using δ{sup 15}N showed that earthworm feeding and earthworm–microorganism interaction were responsible for approximately 21% and 79%, respectively, of the enhanced volatile suspended solid reduction due to the presence of earthworm. The finding provides a quantitative insight into how earthworms influence on sewage sludge stabilization in vermifiltration system.
Sample size calculation to externally validate scoring systems based on logistic regression models.
Directory of Open Access Journals (Sweden)
Antonio Palazón-Bru
Full Text Available A sample size containing at least 100 events and 100 non-events has been suggested to validate a predictive model, regardless of the model being validated and that certain factors can influence calibration of the predictive model (discrimination, parameterization and incidence. Scoring systems based on binary logistic regression models are a specific type of predictive model.The aim of this study was to develop an algorithm to determine the sample size for validating a scoring system based on a binary logistic regression model and to apply it to a case study.The algorithm was based on bootstrap samples in which the area under the ROC curve, the observed event probabilities through smooth curves, and a measure to determine the lack of calibration (estimated calibration index were calculated. To illustrate its use for interested researchers, the algorithm was applied to a scoring system, based on a binary logistic regression model, to determine mortality in intensive care units.In the case study provided, the algorithm obtained a sample size with 69 events, which is lower than the value suggested in the literature.An algorithm is provided for finding the appropriate sample size to validate scoring systems based on binary logistic regression models. This could be applied to determine the sample size in other similar cases.
Optimal relaxed causal sampler using sampled-date system theory
Shekhawat, Hanumant; Meinsma, Gjerrit
This paper studies the design of an optimal relaxed causal sampler using sampled data system theory. A lifted frequency domain approach is used to obtain the existence conditions and the optimal sampler. A state space formulation of the results is also provided. The resulting optimal relaxed causal
Development of gas-sampling device for 13N monitoring system
International Nuclear Information System (INIS)
Zhao Lihong; Gong Xueyu
2003-01-01
The 13 N monitoring system is used in the monitoring of the rate of leakage of the primary coolant circuit in nuclear power stations. The author introduces a gas-sampling device of the 13 Nmonitoring system. It is with a close-loop flow control system with intelligent control of Single Chip Micyoco (SCM), and has the ability to monitor and replace the filter paper automatically, to increase the automation of the device and stable operation in long time
International Nuclear Information System (INIS)
Wang Baosheng; Wang Dongqing; Zhang Jianmin; Jiang Jing
2012-01-01
In order to estimate the functional failure probability of passive systems, an innovative adaptive importance sampling methodology is presented. In the proposed methodology, information of variables is extracted with some pre-sampling of points in the failure region. An important sampling density is then constructed from the sample distribution in the failure region. Taking the AP1000 passive residual heat removal system as an example, the uncertainties related to the model of a passive system and the numerical values of its input parameters are considered in this paper. And then the probability of functional failure is estimated with the combination of the response surface method and adaptive importance sampling method. The numerical results demonstrate the high computed efficiency and excellent computed accuracy of the methodology compared with traditional probability analysis methods. (authors)
Sampled data CT system including analog filter and compensating digital filter
International Nuclear Information System (INIS)
Glover, G. H.; DallaPiazza, D. G.; Pelc, N. J.
1985-01-01
A CT scanner in which the amount of x-ray information acquired per unit time is substantially increased by using a continuous-on x-ray source and a sampled data system with the detector. An analog filter is used in the sampling system for band limiting the detector signal below the highest frequency of interest, but is a practically realizable filter and is therefore non-ideal. A digital filter is applied to the detector data after digitization to compensate for the characteristics of the analog filter, and to provide an overall filter characteristic more nearly like the ideal
International Nuclear Information System (INIS)
Snell, Gyorgy; Cork, Carl; Nordmeyer, Robert; Cornell, Earl; Meigs, George; Yegian, Derek; Jaklevic, Joseph; Jin, Jian; Stevens, Raymond C.; Earnest, Thomas
2004-01-01
High-throughput data collection for macromolecular crystallography requires an automated sample mounting system for cryo-protected crystals that functions reliably when integrated into protein-crystallography beamlines at synchrotrons. Rapid mounting and dismounting of the samples increases the efficiency of the crystal screening and data collection processes, where many crystals can be tested for the quality of diffraction. The sample-mounting subsystem has random access to 112 samples, stored under liquid nitrogen. Results of extensive tests regarding the performance and reliability of the system are presented. To further increase throughput, we have also developed a sample transport/storage system based on 'puck-shaped' cassettes, which can hold sixteen samples each. Seven cassettes fit into a standard dry shipping Dewar. The capabilities of a robotic crystal mounting and alignment system with instrumentation control software and a relational database allows for automated screening and data collection to be developed
Xiao, B P; Reece, C E; Phillips, H L; Geng, R L; Wang, H; Marhauser, F; Kelley, M J
2011-05-01
A radio frequency (RF) surface impedance characterization (SIC) system that uses a novel sapphire-loaded niobium cavity operating at 7.5 GHz has been developed as a tool to measure the RF surface impedance of flat superconducting material samples. The SIC system can presently make direct calorimetric RF surface impedance measurements on the central 0.8 cm(2) area of 5 cm diameter disk samples from 2 to 20 K exposed to RF magnetic fields up to 14 mT. To illustrate system utility, we present first measurement results for a bulk niobium sample.
Improved importance sampling technique for efficient simulation of digital communication systems
Lu, Dingqing; Yao, Kung
1988-01-01
A new, improved importance sampling (IIS) approach to simulation is considered. Some basic concepts of IS are introduced, and detailed evolutions of simulation estimation variances for Monte Carlo (MC) and IS simulations are given. The general results obtained from these evolutions are applied to the specific previously known conventional importance sampling (CIS) technique and the new IIS technique. The derivation for a linear system with no signal random memory is considered in some detail. For the CIS technique, the optimum input scaling parameter is found, while for the IIS technique, the optimum translation parameter is found. The results are generalized to a linear system with memory and signals. Specific numerical and simulation results are given which show the advantages of CIS over MC and IIS over CIS for simulations of digital communications systems.
International Nuclear Information System (INIS)
Campos, Leonardo C.; Tonezzer, Matteo; Ferlauto, Andre S.; Magalhaes-Paniago, Rogerio; Oliveira, Sergio; Ladeira, Luiz O.; Lacerda, Rodrigo G.
2008-01-01
Nowadays, the growth of nano materials, like nano wires and nano tubes, is one of the key research areas of nano technology. However, a full picture of the growth mechanism of these quasi-one dimensional systems still needs to be achieved if these materials are to be applied electronics, biology and medicinal fields. Nevertheless, in spite of considerable advances on the growth of numerous nano wires, a clear understanding of the growth mechanism is still controversial and highly discussed. The present work provides a comprehensive picture of the precise mechanism of Zn O vapor-solid-solid (VSS) nano wire growth at low temperatures and gives the fundamental reasons responsible. We demonstrate by using a combination of synchrotron XRD and high resolution TEM that the growth dynamics at low temperatures is not governed by the well-known vapor-liquid solid (VLS) mechanisms. A critical new insight on the driving factor of VSS growth is proposed in which the VSS process occurs by a solid diffusion mechanism that is driven by a preferential oxidation process of the Zn inside the alloy catalyst induced by an epitaxial match between the Zn O(10-10) plane and the γ-Au Zn(222) plane. We believe that these results are not only important for the understanding of Zn O nano wire growth but could also have significant impact on the understanding of growth mechanisms of other nano wire systems. (author)
Design of a sample acquistion system for the Mars exobiological penetrator
Thomson, Ron; Gwynne, Owen
1988-01-01
The Mars Exobiological Penetrator will be imbedded into several locations on the Martian surface. It contains various scientific instruments, such as an Alpha-Particle Instrument (API), Differential Scanning Calorimeter (DSC), Evolved Gas Analyzer (EGA) and accelerometers. A sample is required for analysis in the API and DSC. To avoid impact contaminated material, this sample must be taken from soil greater than 2 cm away from the penetrator shell. This study examines the design of a dedicated sampling system including deployment, suspension, fore/after body coupling, sample gathering and placement. To prevent subsurface material from entering the penetrator sampling compartment during impact, a plug is placed in the exit hole of the wall. A U-lever device is used to hold this plug in the penetrator wall. The U-lever rotates upon initial motion of the core-grinder mechanism (CGM), releasing the plug. Research points to a combination of coring and grinding as a plausible solution to the problem of dry drilling. The CGM, driven by two compressed springs, will be deployed along a tracking system. A slowly varying load i.e., springs, is favored over a fixed displacement motion because of its adaptability to different material hardness. However, to accommodate sampling in a low density soil, two dash pots set a maximum transverse velocity. In addition, minimal power use is achieved by unidirectional motion of the CGM. The sample will be transported to the scientific instruments by means of a sample placement tray that is driven by a compressed spring to avoid unnecessary power usage. This paper also explores possible modifications for size, weight, and time as well as possible future studies.
System to determine present elements in oily samples
International Nuclear Information System (INIS)
Mendoza G, Y.
2004-11-01
In the Chemistry Department of the National Institute of Nuclear Investigations of Mexico, dedicated to analyze samples of oleaginous material and of another origin, to determine the elements of the periodic table present in the samples, through the Neutron activation analysis technique (NAA). This technique has been developed to determine majority elements in any solid, aqueous, industrial and environmental sample, which consists basically on to irradiate a sample with neutrons coming from the TRIGA Mark III reactor and to carry out the analysis to obtain those gamma spectra that it emits, for finally to process the information, the quantification of the analysis it is carried out in a manual way, which requires to carry out a great quantity of calculations. The main objective of this project is the development of a software that allows to carry out the quantitative analysis of the NAA for the multielemental determination of samples in an automatic way. To fulfill the objective of this project it has been divided in four chapters: In the first chapter it is shortly presented the history on radioactivity and basic concepts that will allow us penetrate better to this work. In the second chapter the NAA is explained which is used in the sample analysis, the description of the process to be carried out, its are mentioned the characteristics of the used devices and an example of the process is illustrated. In the third chapter it is described the development of the algorithm and the selection of the programming language. The fourth chapter it is shown the structure of the system, the general form of operation, the execution of processes and the obtention of results. Later on the launched results are presented in the development of the present project. (Author)
Highly oriented Bi-system bulk sample prepared by a decomposition-crystallization process
International Nuclear Information System (INIS)
Xi Zhengping; Zhou Lian; Ji Chunlin
1992-01-01
A decomposition-crystallization method, preparing highly oriented Bi-system bulk sample is reported. The effects of processing parameter, decomposition temperature, cooling rate and post-treatment condition on texture and superconductivity are investigated. The method has successfully prepared highly textured Bi-system bulk samples. High temperature annealing does not destroy the growing texture, but the cooling rate has some effect on texture and superconductivity. Annealing in N 2 /O 2 atmosphere can improve superconductivity of the textured sample. The study on the superconductivity of the Bi(Pb)-Sr-Ca-Cu-O bulk material has been reported in numerous papers. The research on J c concentrates on the tape containing the 2223 phase, with very few studies on the J c of bulk sample. The reason for the lack of studies is that the change of superconducting phases at high temperatures has not been known. The authors have reported that the 2212 phase incongruently melted at about 875 degrees C and proceeded to orient the c-axis perpendicular to the surface in the process of crystallization of the 2212 phase. Based on that result, a decomposition-crystallization method was proposed to prepare highly oriented Bi-system bulk sample. In this paper, the process is described in detail and the effects of processing parameters on texture and superconductivity are reported
Matsumoto, K; Sakamoto, S; Senda, M; Yamamoto, S; Tarutani, K; Minato, K
2002-01-01
To measure cerebral blood flow with sup 1 sup 5 O PET, it is necessary to measure the time course of arterial blood radioactivity. We examined the performance of three different types of continuous blood sampling system. Three kinds of continuous blood sampling system were used: a plastic scintillator-based beta detector (conventional beta detector (BETA)), a bismuth germinate (BGO)-based coincidence gamma detector (Pico-count flow-through detector (COINC)) and a Phoswich detector (PD) composed by a combination of plastic scintillator and BGO scintillator. Performance of these systems was evaluated for absolute sensitivity, count rate characteristic, sensitivity to background gamnra photons, and reproducibility for nylon tube geometry. The absolute sensitivity of the PD was 0.21 cps/Bq for sup 6 sup 8 Ga positrons at the center of the detector. This was approximately three times higher than BETA, two times higher than COINC. The value measured with BETA was stable, even when background radioactivity was incre...
Sample and injection manifolds used to in-place test of nuclear air-cleaning system
International Nuclear Information System (INIS)
Qiu Dangui; Li Xinzhi; Hou Jianrong; Qiao Taifei; Wu Tao; Zhang Jirong; Han Lihong
2012-01-01
Objective: According to the regulations of nuclear safety rules and related standards, in-place test of the nuclear air-cleaning systems should be carried out before and during operation of the nuclear facilities, which ensure them to be in good condition. In some special conditions, the use of sample and injection manifolds is required to make the test tracer and ventilating duct air fully mixed, so as to get the on-spot typical sample. Methods: This paper introduces the technology and application of the sample and injection manifolds in nuclear air-cleaning system. Results: Multi point injection and multi point sampling technology as an effective experimental method, has been used in a of domestic and international nuclear facilities. Conclusion: The technology solved the problem of uniformly of on-spot injection and sampling,which plays an important role in objectively evaluating the function of nuclear air-cleaning system. (authors)
Freitas, Alex A; Limbu, Kriti; Ghafourian, Taravat
2015-01-01
Volume of distribution is an important pharmacokinetic property that indicates the extent of a drug's distribution in the body tissues. This paper addresses the problem of how to estimate the apparent volume of distribution at steady state (Vss) of chemical compounds in the human body using decision tree-based regression methods from the area of data mining (or machine learning). Hence, the pros and cons of several different types of decision tree-based regression methods have been discussed. The regression methods predict Vss using, as predictive features, both the compounds' molecular descriptors and the compounds' tissue:plasma partition coefficients (Kt:p) - often used in physiologically-based pharmacokinetics. Therefore, this work has assessed whether the data mining-based prediction of Vss can be made more accurate by using as input not only the compounds' molecular descriptors but also (a subset of) their predicted Kt:p values. Comparison of the models that used only molecular descriptors, in particular, the Bagging decision tree (mean fold error of 2.33), with those employing predicted Kt:p values in addition to the molecular descriptors, such as the Bagging decision tree using adipose Kt:p (mean fold error of 2.29), indicated that the use of predicted Kt:p values as descriptors may be beneficial for accurate prediction of Vss using decision trees if prior feature selection is applied. Decision tree based models presented in this work have an accuracy that is reasonable and similar to the accuracy of reported Vss inter-species extrapolations in the literature. The estimation of Vss for new compounds in drug discovery will benefit from methods that are able to integrate large and varied sources of data and flexible non-linear data mining methods such as decision trees, which can produce interpretable models. Graphical AbstractDecision trees for the prediction of tissue partition coefficient and volume of distribution of drugs.
Pacific Northwest National Laboratory Facility Radionuclide Emissions Units and Sampling Systems
Energy Technology Data Exchange (ETDEWEB)
Barnett, J. Matthew; Brown, Jason H.; Walker, Brian A.
2012-04-01
Battelle–Pacific Northwest Division operates numerous research and development (R&D) laboratories in Richland, WA, including those associated with Pacific Northwest National Laboratory (PNNL) on the U.S. Department of Energy (DOE)’s Hanford Site and PNNL Site that have the potential for radionuclide air emissions. The National Emission Standard for Hazardous Air Pollutants (NESHAP 40 CFR 61, Subparts H and I) requires an assessment of all emission units that have the potential for radionuclide air emissions. Potential emissions are assessed annually by PNNL staff members. Sampling, monitoring, and other regulatory compliance requirements are designated based upon the potential-to-emit dose criteria found in the regulations. The purpose of this document is to describe the facility radionuclide air emission sampling program and provide current and historical facility emission unit system performance, operation, and design information. For sampled systems, a description of the buildings, exhaust units, control technologies, and sample extraction details is provided for each registered emission unit. Additionally, applicable stack sampler configuration drawings, figures, and photographs are provided. Deregistered emission unit details are provided as necessary for up to 5 years post closure.
Fiber laser-microscope system for femtosecond photodisruption of biological samples.
Yavaş, Seydi; Erdogan, Mutlu; Gürel, Kutan; Ilday, F Ömer; Eldeniz, Y Burak; Tazebay, Uygar H
2012-03-01
We report on the development of a ultrafast fiber laser-microscope system for femtosecond photodisruption of biological targets. A mode-locked Yb-fiber laser oscillator generates few-nJ pulses at 32.7 MHz repetition rate, amplified up to ∼125 nJ at 1030 nm. Following dechirping in a grating compressor, ∼240 fs-long pulses are delivered to the sample through a diffraction-limited microscope, which allows real-time imaging and control. The laser can generate arbitrary pulse patterns, formed by two acousto-optic modulators (AOM) controlled by a custom-developed field-programmable gate array (FPGA) controller. This capability opens the route to fine optimization of the ablation processes and management of thermal effects. Sample position, exposure time and imaging are all computerized. The capability of the system to perform femtosecond photodisruption is demonstrated through experiments on tissue and individual cells.
Robotic system for process sampling
International Nuclear Information System (INIS)
Dyches, G.M.
1985-01-01
A three-axis cartesian geometry robot for process sampling was developed at the Savannah River Laboratory (SRL) and implemented in one of the site radioisotope separations facilities. Use of the robot reduces personnel radiation exposure and contamination potential by routinely handling sample containers under operator control in a low-level radiation area. This robot represents the initial phase of a longer term development program to use robotics for further sample automation. Preliminary design of a second generation robot with additional capabilities is also described. 8 figs
Slurry feed variability in West Valley's melter feed tank and sampling system
International Nuclear Information System (INIS)
Fow, C.L.; Kurath, D.E.; Pulsipher, B.A.; Bauer, B.P.
1989-04-01
The present plan for disposal of high-level wastes at West Valley is to vitrify the wastes for disposal in deep geologic repository. The vitrification process involves mixing the high-level wastes with glass-forming chemicals and feeding the resulting slurry to a liquid-fed ceramic melter. Maintaining the quality of the glass product and proficient melter operation depends on the ability of the melter feed system to produce and maintain a homogeneous mixture of waste and glass-former materials. To investigate the mixing properties of the melter feed preparation system at West Valley, a statistically designed experiment was conducted using synthetic melter feed slurry over a range of concentrations. On the basis of the statistical data analysis, it was found that (1) a homogeneous slurry is produced in the melter feed tank, (2) the liquid-sampling system provides slurry samples that are statistically different from the slurry in the tank, and (3) analytical measurements are the major source of variability. A statistical quality control program for the analytical laboratory and a characterization test of the actual sampling system is recommended. 1 ref., 5 figs., 1 tab
Sample introduction systems for the analysis of liquid microsamples by ICP-AES and ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Todoli, Jose L. [Departamento de Quimica Analitica, Nutricion y Bromatologia, Universidad de Alicante, 03080 Alicante (Spain)]. E-mail: jose.todoli@ua.es; Mermet, Jean M. [Spectroscopy Forever, 01390 Tramoyes (France)
2006-03-15
There are many fields in which the available sample volume is the limiting factor for an elemental analysis. Over the last ten years, sample introduction systems used in plasma spectrometry (i.e., Inductively Coupled Plasma Atomic Emission Spectrometry, ICP-AES, and Mass Spectrometry, ICP-MS) have evolved in order to expand the field of applicability of these techniques to the analysis of micro- and nanosamples. A full understanding of the basic processes occurring throughout the sample introduction system is absolutely necessary to improve analytical performance. The first part of the present review deals with fundamental studies concerning the different phenomena taking place from aerosol production to analyte excitation/ionization when the liquid consumption rate does not exceed 100 {mu}l/min. Existing sample introduction systems are currently far from the ideal and a significant effort has been made to develop new and efficient devices. Different approaches for continuously introducing small sample volumes (i.e., microsamples) have been reviewed and compared in the present work. Finally, applications as well as basic guidelines to select the best sample introduction system according to the sample particularities are given at the end of this review.
Sample introduction systems for the analysis of liquid microsamples by ICP-AES and ICP-MS
International Nuclear Information System (INIS)
Todoli, Jose L.; Mermet, Jean M.
2006-01-01
There are many fields in which the available sample volume is the limiting factor for an elemental analysis. Over the last ten years, sample introduction systems used in plasma spectrometry (i.e., Inductively Coupled Plasma Atomic Emission Spectrometry, ICP-AES, and Mass Spectrometry, ICP-MS) have evolved in order to expand the field of applicability of these techniques to the analysis of micro- and nanosamples. A full understanding of the basic processes occurring throughout the sample introduction system is absolutely necessary to improve analytical performance. The first part of the present review deals with fundamental studies concerning the different phenomena taking place from aerosol production to analyte excitation/ionization when the liquid consumption rate does not exceed 100 μl/min. Existing sample introduction systems are currently far from the ideal and a significant effort has been made to develop new and efficient devices. Different approaches for continuously introducing small sample volumes (i.e., microsamples) have been reviewed and compared in the present work. Finally, applications as well as basic guidelines to select the best sample introduction system according to the sample particularities are given at the end of this review
Down sampled signal processing for a B Factory bunch-by-bunch feedback system
International Nuclear Information System (INIS)
Hindi, H.; Hosseini, W.; Briggs, D.; Fox, J.; Hutton, A.
1992-03-01
A bunch-by-bunch feedback scheme is studied for damping coupled bunch synchrotron oscillations in the proposed PEP II B Factory. The quasi-linear feedback systems design incorporates a phase detector to provide a quantized measure of bunch phase, digital signal processing to compute an error correction signal and a kicker system to correct the energy of the bunches. A farm of digital processors, operating in parallel, is proposed to compute correction signals for the 1658 bunches of the B Factory. This paper studies the use of down sampled processing to reduce the computational complexity of the feedback system. We present simulation results showing the effect of down sampling on beam dynamics. Results show that down sampled processing can reduce the scale of the processing task by a factor of 10
Development of a sample preparation system for AMS radiocarbon dating at CRICH, Korea
Energy Technology Data Exchange (ETDEWEB)
Kim, Myung-Jin; Lee, Byeong-Cheol; Lim, Eun-Soo [Cultural Research Institute of Chungcheong Heritage, Gongju (Korea, Republic of); Hong, Duk-Geun [Kangwon National University, Chuncheon (Korea, Republic of); Park, Soon-Bal [Chungnam National University, Daejeon (Korea, Republic of); Youn, Min-Young [Seoul National University, Seoul (Korea, Republic of)
2010-01-15
We developed a sample preparation system for radiocarbon dating by using AMS measurement at Cultural Research Institute of Chungcheong Heritage, Korea. From the investigation of the reduction process, the optimum graphitization temperature was chosen as 625 .deg. C. Using Aldrich graphite powder of 0.75 {+-} 0.023 pMC, the background value of our preparation system was controlled at a low level. The robustness against chemical treatment and contamination was also observed from samples of Oxalic acid II and IAEA-C4. The resultant values, 134.04 {+-} 0.99 pMC and 0.38 {+-} 0.043 pMC, were in good agreement with the consensus values. Based on comparison, our conventional ages agreed very well with those of Beta Analytic Co. and SNU-AMS. No memory effect existed in the preparation system. Therefore, we concluded that the sample preparation system was operated in a stable manner and that the basic radiocarbon dating procedures were completely verified.
Advanced Ignition System for Hybrid Rockets for Sample Return Missions, Phase I
National Aeronautics and Space Administration — To return a sample from the surface of Mars or any of the larger moons in the solar system will require a propulsion system with a comparatively large delta-V...
Networked Estimation for Event-Based Sampling Systems with Packet Dropouts
Directory of Open Access Journals (Sweden)
Young Soo Suh
2009-04-01
Full Text Available This paper is concerned with a networked estimation problem in which sensor data are transmitted over the network. In the event-based sampling scheme known as level-crossing or send-on-delta (SOD, sensor data are transmitted to the estimator node if the difference between the current sensor value and the last transmitted one is greater than a given threshold. Event-based sampling has been shown to be more efficient than the time-triggered one in some situations, especially in network bandwidth improvement. However, it cannot detect packet dropout situations because data transmission and reception do not use a periodical time-stamp mechanism as found in time-triggered sampling systems. Motivated by this issue, we propose a modified event-based sampling scheme called modified SOD in which sensor data are sent when either the change of sensor output exceeds a given threshold or the time elapses more than a given interval. Through simulation results, we show that the proposed modified SOD sampling significantly improves estimation performance when packet dropouts happen.
A modified method to determine biomass concentration as COD in ...
African Journals Online (AJOL)
drinie
2002-10-04
Oct 4, 2002 ... A modification of the standard VSS technique was also proposed using two membranes in the filtration device; this technique allowed the biomass determination in 1 μm size bacteria cultures that cannot be detected by the standard VSS method because cells are not retained by the 1.5 μm diameter pore ...
A sampling approach to constructing Lyapunov functions for nonlinear continuous–time systems
Bobiti, R.V.; Lazar, M.
2016-01-01
The problem of constructing a Lyapunov function for continuous-time nonlinear dynamical systems is tackled in this paper via a sampling-based approach. The main idea of the sampling-based method is to verify a Lyapunov-type inequality for a finite number of points (known state vectors) in the
Novel platform for ocean survey and autonomous sampling using multi-agent system
Taher, Tawfiq; Weymouth, G.D.; Varghese, Tony
2013-01-01
In-situ surveying and sampling of ocean environments provides critical data for laboratory work and oceanographic research. However, sampling a time-varying ocean field is often time and resource limited-meaning that samples often miss the features of interest. This paper presents a modular autonomous multi-agent robotic system which has been developed to accommodate a variety of research activities. This paper demonstrates the complementary capabilities of the agents by simultaneously survey...
Seguino, Alessandro; Seguino, Ferruccio; Eleuteri, Antonio; Rhind, Susan M
2014-01-01
Veterinary surgeons working on farms and food-processing establishments play a fundamental role in safeguarding both public health and the welfare of animals under their care. An essential part of veterinary public health (VPH) undergraduate training in the UK involves students undertaking placements within abattoirs, a practice that remains vital to the educational experience of future veterinary professionals. However, several issues have adversely affected the ability of students to gain such extramural placements. For this reason, the Virtual Slaughterhouse Simulator (VSS) was developed to strengthen and enhance undergraduate VPH teaching at the Royal (Dick) School of Veterinary Studies, enabling students to explore a realistic abattoir work environment with embedded educational activities. The aim of this research project was to evaluate the VSS as a teaching and learning tool for training and educating veterinary students. Ninety-eight final-year veterinary students engaged with the prototype VSS, followed by assessment of their knowledge and behavior when faced with a "real-life" abattoir situation. Further evaluation of their experiences with the VSS was carried out using questionnaires and focus groups. The results of this investigation show that there is the potential for the VSS to enhance the student learning experience in basic abattoir procedures. This innovative tool provides a visually based learning resource that can support traditional lectures and practical classes and can also be used to stimulate interactive problem-solving activities embedded in the relevant context.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Yoshihide, E-mail: e0827@mosk.tytlabs.co.jp; Nishimura, Yusaku F.; Suzuki, Ryo; Beniya, Atsushi; Isomura, Noritake [Toyota Central R& D Labs., Inc., Yokomichi 41-1, Nagakute, Aichi 480-1192 (Japan); Uehara, Hiromitsu; Asakura, Kiyotaka; Takakusagi, Satoru [Catalysis Research Center, Hokkaido University, Kita 21-10, Sapporo, Hokkaido 001-0021 (Japan); Nimura, Tomoyuki [AVC Co., Ltd., Inada 1450-6, Hitachinaka, Ibaraki 312-0061 (Japan)
2016-03-15
A portable ultrahigh-vacuum sample storage system was designed and built to investigate the detailed geometric structures of mass-selected metal clusters on oxide substrates by polarization-dependent total-reflection fluorescence x-ray absorption fine structure spectroscopy (PTRF-XAFS). This ultrahigh-vacuum (UHV) sample storage system provides the handover of samples between two different sample manipulating systems. The sample storage system is adaptable for public transportation, facilitating experiments using air-sensitive samples in synchrotron radiation or other quantum beam facilities. The samples were transferred by the developed portable UHV transfer system via a public transportation at a distance over 400 km. The performance of the transfer system was demonstrated by a successful PTRF-XAFS study of Pt{sub 4} clusters deposited on a TiO{sub 2}(110) surface.
Integrating a sampling oscilloscope card and spectroscopy ADCs in a data acquisition system
Maartensson, L
2001-01-01
A high-rate sampling oscilloscope card has been integrated into an existing data acquisition system for spectroscopy ADCs. Experiments where pulse-shape analyses are important have then been made possible. Good performance characteristics of the integrated system have been achieved. Spectroscopy ADC data together with pulse-shape data sampled 512 times at 100 MHz are saved to hard disk at event rates up to about 1 kHz with low dead time losses.
Shen, Si; Shen, Junwei; Zhu, Liang; Wu, Chaoqun; Li, Dongliang; Yu, Hongyu; Qiu, Yuanyuan; Zhou, Yi
2015-11-01
To establish and manage of multicentral collection bio-sample banks of malignant tumors from digestive system, the paper designed a multicentral management system, established the standard operation procedures (SOPs) and leaded ten hospitals nationwide to collect tumor samples. The biobank has been established for half a year, and has collected 695 samples from patients with digestive system malignant tumor. The clinical data is full and complete, labeled in a unified way and classified to be managed. The clinical and molecular biology researches were based on the biobank, and obtained achievements. The biobank provides a research platform for malignant tumor of digestive system from different regions and of different types.
Authentication Assurance Level Application to the Inventory Sampling Measurement System
International Nuclear Information System (INIS)
Devaney, Mike M.; Kouzes, Richard T.; Hansen, Randy R.; Geelhood, Bruce D.
2001-01-01
This document concentrates on the identification of a standardized assessment approach for the verification of security functionality in specific equipment, the Inspection Sampling Measurement System (ISMS) being developed for MAYAK. Specifically, an Authentication Assurance Level 3 is proposed to be reached in authenticating the ISMS
LIIS: A web-based system for culture collections and sample annotation
Directory of Open Access Journals (Sweden)
Matthew S Forster
2014-04-01
Full Text Available The Lab Information Indexing System (LIIS is a web-driven database application for laboratories looking to store their sample or culture metadata on a central server. The design was driven by a need to replace traditional paper storage with an easier to search format, and extend current spreadsheet storage methods. The system supports the import and export of CSV spreadsheets, and stores general metadata designed to complement the environmental packages provided by the Genomic Standards Consortium. The goals of the LIIS are to simplify the storage and archival processes and to provide an easy to access library of laboratory annotations. The program will find utility in microbial ecology laboratories or any lab that needs to annotate samples/cultures.
Laser heating of aqueous samples on a micro-optical-electro-mechanical system
Beer, Neil Reginald; Kennedy, Ian
2013-02-05
A system of heating a sample on a microchip includes the steps of providing a microchannel flow channel in the microchip; positioning the sample within the microchannel flow channel, providing a laser that directs a laser beam onto the sample for heating the sample; providing the microchannel flow channel with a wall section that receives the laser beam and enables the laser beam to pass through wall section of the microchannel flow channel without being appreciably heated by the laser beam; and providing a carrier fluid in the microchannel flow channel that moves the sample in the microchannel flow channel wherein the carrier fluid is not appreciably heated by the laser beam.
40 CFR 90.414 - Raw gaseous exhaust sampling and analytical system description.
2010-07-01
... probe may not be greater than 0.10 cm. The fitting that attaches the probe to the exhaust pipe must be... the different analyzers. (2) Heat the sample transport system from the engine exhaust pipe to the HC... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Raw gaseous exhaust sampling and...
40 CFR 89.412 - Raw gaseous exhaust sampling and analytical system description.
2010-07-01
... the exhaust pipe shall be as small as practical in order to minimize heat loss from the probe. (2) The... sample transport system from the engine exhaust pipe to the HC analyzer and the NOX analyzer must be... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Raw gaseous exhaust sampling and...
40 CFR 91.414 - Raw gaseous exhaust sampling and analytical system description.
2010-07-01
... shall not be greater than 0.10 cm. The fitting that attaches the probe to the exhaust pipe shall be as... internally to the different analyzers. (2) Heat the sample transport system from the engine exhaust pipe to... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Raw gaseous exhaust sampling and...
40 CFR 92.114 - Exhaust gas and particulate sampling and analytical system.
2010-07-01
... transport sample to analyzers. (I) Temperature sensor. A temperature sensor (T1) to measure the NO2 to NO... feet (1.22 m) from the exhaust duct. (iii) The sample transport system from the engine exhaust duct to.... (A) For diesel fueled and biodiesel fueled locomotives and engines, the wall temperature of the HC...
Automatic sample changer system for a chain of X-Ray Spectrometry
International Nuclear Information System (INIS)
Kall, B.
2004-01-01
Nowadays, the science evolves and the used techniques become more pointed. At the same time, instruments are more powerful. This rule also applies in the domain of the nuclear science. The object of these works goes in this sense and touch the branch of the X-Ray spectrometry and that brings back himself to the conception and the realization of an automatic sample changer system for the chain of X-Ray Spectrometry. Baptized KEN-001 , it is an instrument of sample changer ordered from certain distance. Indeed, the sample carriers are placed of advance in compartments on its tray and by a control, KEN-001 put one by one those reflectors in the carries reflective for analysis. Once the analysis is finished, the system is in charge of taking and replacing the reflector in its compartment of origin. Of this way, one wins in time and therefore in number of analysis to do in an interval of time given. This instrument of precision contributes to the improvement of the analysis and the evolution of the technique of the X-Ray fluorescence [fr
International Nuclear Information System (INIS)
Bourret, S.C.
1974-01-01
Two systems resulted from the need for the study of the nuclear decay of short-lived radionuclides. Automation was required for better repeatability, speed of chemical separation after irradiation and for protection from the high radiation fields of the samples. A MCS-8 computer was used as the nucleus of the automatic sample irradiation system because the control system required an extensive multiple-sequential circuit. This approach reduced the sequential problem to a computer program. The automatic chemistry control system is a mixture of a fixed and a computer-based programmable control system. The fixed control receives the irradiated liquid sample from the reactor, extracts the liquid and disposes of the used sample container. The programmable control executes the chemistry program that the user has entered through the teletype. (U.S.)
40 CFR 1065.145 - Gaseous and PM probes, transfer lines, and sampling system components.
2010-07-01
... Scrubber. You may use ammonia scrubbers for any or all gaseous sampling systems to prevent interference.... Follow the ammonia scrubber manufacturer's recommendations or use good engineering judgment in applying ammonia scrubbers. (f) Optional sample-conditioning components for PM sampling. You may use the following...
Study on a new meteorological sampling scheme developed for the OSCAAR code system
International Nuclear Information System (INIS)
Liu Xinhe; Tomita, Kenichi; Homma, Toshimitsu
2002-03-01
One important step in Level-3 Probabilistic Safety Assessment is meteorological sequence sampling, on which the previous studies were mainly related to code systems using the straight-line plume model and more efforts are needed for those using the trajectory puff model such as the OSCAAR code system. This report describes the development of a new meteorological sampling scheme for the OSCAAR code system that explicitly considers population distribution. A group of principles set for the development of this new sampling scheme includes completeness, appropriate stratification, optimum allocation, practicability and so on. In this report, discussions are made about the procedures of the new sampling scheme and its application. The calculation results illustrate that although it is quite difficult to optimize stratification of meteorological sequences based on a few environmental parameters the new scheme do gather the most inverse conditions in a single subset of meteorological sequences. The size of this subset may be as small as a few dozens, so that the tail of a complementary cumulative distribution function is possible to remain relatively static in different trials of the probabilistic consequence assessment code. (author)
High Pressure Atmospheric Sampling Inlet System for Venus or the Gas Giants, Phase I
National Aeronautics and Space Administration — Thorleaf Research, Inc. proposes to develop a miniaturized high pressure atmospheric sampling inlet system for sample acquisition in extreme planetary environments,...
Dual Source Time-of-flight Mass Spectrometer and Sample Handling System
Brinckerhoff, W.; Mahaffy, P.; Cornish, T.; Cheng, A.; Gorevan, S.; Niemann, H.; Harpold, D.; Rafeek, S.; Yucht, D.
We present details of an instrument under development for potential NASA missions to planets and small bodies. The instrument comprises a dual ionization source (laser and electron impact) time-of-flight mass spectrometer (TOF-MS) and a carousel sam- ple handling system for in situ analysis of solid materials acquired by, e.g., a coring drill. This DSTOF instrument could be deployed on a fixed lander or a rover, and has an open design that would accommodate measurements by additional instruments. The sample handling system (SHS) is based on a multi-well carousel, originally de- signed for Champollion/DS4. Solid samples, in the form of drill cores or as loose chips or fines, are inserted through an access port, sealed in vacuum, and transported around the carousel to a pyrolysis cell and/or directly to the TOF-MS inlet. Samples at the TOF-MS inlet are xy-addressable for laser or optical microprobe. Cups may be ejected from their holders for analyzing multiple samples or caching them for return. Samples are analyzed with laser desorption and evolved-gas/electron-impact sources. The dual ion source permits studies of elemental, isotopic, and molecular composition of unprepared samples with a single mass spectrometer. Pulsed laser desorption per- mits the measurement of abundance and isotope ratios of refractory elements, as well as the detection of high-mass organic molecules in solid samples. Evolved gas analysis permits similar measurements of the more volatile species in solids and aerosols. The TOF-MS is based on previous miniature prototypes at JHU/APL that feature high sensitivity and a wide mass range. The laser mode, in which the sample cup is directly below the TOF-MS inlet, permits both ablation and desorption measurements, to cover elemental and molecular species, respectively. In the evolved gas mode, sample cups are raised into a small pyrolysis cell and heated, producing a neutral gas that is elec- tron ionized and pulsed into the TOF-MS. (Any imaging
1981-12-01
side it necessary and IdentOf, bp block number) Cartography Typography C uter Graphics 20.VSsT RACT (Continueaon reverse aide It necessary -d Identif...material with graphic arts quality. There are several systems’ ’a which operate through the computer. The CTI system was designed especially for...cartography and typography is the HERA system. It was designed especially for the printing of difficult material such as chemical structures, electronic
Hanford Environmental Information System (HEIS). Volume 7: Sample and Data Tracking subject area
International Nuclear Information System (INIS)
1994-06-01
The Hanford Environmental Information System (HEIS) Sample and Data Tracking subject area allows insertion of tracking information into a central repository where the data is immediately available for viewing. For example, a technical coordinator is able to view the current status of a particular sampling effort, from sample collection to data package validation dates. Four major types of data comprise the Sample and Data Tracking subject area: data about the mechanisms that groups a set of samples for a particular sampling effort; data about how constituents are grouped and assigned to a sample; data about when, where, and how samples are sent to a laboratory for analysis; and data bout the status of a sample's constituent analysis requirements, i.e., whether the analysis results have been returned from the laboratory
Sakai, Miho; Hayakawa, Yoshihiro; Funada, Yasuhiro; Ando, Takashi; Fukusaki, Eiichiro; Bamba, Takeshi
2017-09-15
In this study, we propose a novel variable sample injection system based on full-loop injection, named the split-flow sample introduction system, for application in supercritical fluid chromatography (SFC). In this system, the mobile phase is split by the differential pressure between two back pressure regulators (BPRs) after full-loop injection suitable for SFC, and this differential pressure determines the introduction rate. Nine compounds with a wide range of characteristics were introduced with high reproducibility and universality, confirming that a robust variable sample injection system was achieved. We also investigated the control factors of our proposed system. Sample introduction was controlled by the ratio between the column-side pressure drops in splitless and split flow, ΔP columnsideinsplitless and ΔP columnsideinsplit , respectively, where ΔP columnsideinsplitless is related to the mobile phase flow rate and composition and the column resistance. When all other conditions are kept constant, increasing the make-up flow induces an additional pressure drop on the column side of the system, which leads to a reduced column-side flow rate, and hence decreased the amount of sample injected, even when the net pressure drop on the column side remains the same. Thus, sample introduction could be highly controlled at low sample introduction rate, regardless of the introduction conditions. This feature is advantageous because, as a control factor, the solvent in the make-up pump is independent of the column-side pressure drop. Copyright © 2017. Published by Elsevier B.V.
Birmele, Michele N.
2011-01-01
The Regenerative, Environmental Control and Life Support System (ECLSS) on the International Space Station (ISS) includes the the Water Recovery System (WRS) and the Oxygen Generation System (OGS). The WRS consists of a Urine Processor Assembly (UPA) and Water Processor Assembly (WPA). This report describes microbial characterization of wastewater and surface samples collected from the WRS and OGS subsystems, returned to KSC, JSC, and MSFC on consecutive shuttle flights (STS-129 and STS-130) in 2009-10. STS-129 returned two filters that contained fluid samples from the WPA Waste Tank Orbital Recovery Unit (ORU), one from the waste tank and the other from the ISS humidity condensate. Direct count by microscopic enumeration revealed 8.38 x 104 cells per mL in the humidity condensate sample, but none of those cells were recoverable on solid agar media. In contrast, 3.32 x lOs cells per mL were measured from a surface swab of the WRS waste tank, including viable bacteria and fungi recovered after S12 days of incubation on solid agar media. Based on rDNA sequencing and phenotypic characterization, a fungus recovered from the filter was determined to be Lecythophora mutabilis. The bacterial isolate was identified by rDNA sequence data to be Methylobacterium radiotolerans. Additional UPA subsystem samples were returned on STS-130 for analysis. Both liquid and solid samples were collected from the Russian urine container (EDV), Distillation Assembly (DA) and Recycle Filter Tank Assembly (RFTA) for post-flight analysis. The bacterium Pseudomonas aeruginosa and fungus Chaetomium brasiliense were isolated from the EDV samples. No viable bacteria or fungi were recovered from RFTA brine samples (N= 6), but multiple samples (N = 11) from the DA and RFTA were found to contain fungal and bacterial cells. Many recovered cells have been identified to genus by rDNA sequencing and carbon source utilization profiling (BiOLOG Gen III). The presence of viable bacteria and fungi from WRS
A tracking system for groundwater sampling and data transfer schedules
International Nuclear Information System (INIS)
Mercier, T.M.
1990-12-01
Since groundwater monitoring programs at the Oak Ridge Y-12 Plant have become more complex and varied and as the occasions to respond to internal and external reporting requirements have become more frequent and time constrained, the need to track groundwater sampling activities and data transfer from the analytical laboratories has become imperative. If backlogs can be caught early, resources can be added or reallocated in the field and in the laboratory in a timely manner to ensure reporting deadlines are met. The tracking system discussed in this paper starts with clear definition of the groundwater monitoring program at the facility. This information is input into base datasets at the beginning of the sampling cycle. As the sampling program progresses, information about well sampling dates and data transfer dates is input into the base datasets. From the base program data and the update data, a status report is periodically generated by a computer program which identifies the type and nature of bottle necks encountered during the implementation of the groundwater monitoring program
A Gas-Spring-Loaded X-Y-Z Stage System for X-ray Microdiffraction Sample Manipulation
International Nuclear Information System (INIS)
Shu Deming; Cai Zhonghou; Lai, Barry
2007-01-01
We have designed and constructed a gas-spring-loaded x-y-z stage system for x-ray microdiffraction sample manipulation at the Advanced Photon Source XOR 2-ID-D station. The stage system includes three DC-motor-driven linear stages and a gas-spring-based heavy preloading structure, which provides antigravity forces to ensure that the stage system keeps high-positioning performance under variable goniometer orientation. Microdiffraction experiments with this new stage system showed significant sample manipulation performance improvement
Combined thermo-chemo-sonic disintegration of waste activated sludge for biogas production.
Kavitha, S; Yukesh Kannah, R; Yeom, Ick Tae; Do, Khac-Uan; Banu, J Rajesh
2015-12-01
In the present study, there was an investigation about the impact of a new combined thermo-chemo-sonic disintegration of waste activated sludge (WAS) on biodegradability. The outcome of sludge disintegration reveals that maximum Suspended Solids (SS) reduction and Chemical Oxygen Demand (COD) solubilization effectuated at a specific energy input of 5290.5kJ/kgTS, and was found to be 20%, 16.4%, 15% and 27%, 22%, and 20%, respectively for the three alkalis (NaOH, KOH, and Ca(OH)2). The conversion coefficient of the Volatile Suspended Solids (VSS) to product Soluble COD (SCOD), calculated by nonlinear regression modeling, was found to be 0.5530gSCOD/gVSS, 0.4587gSCOD/gVSS, and 0.4195gSCOD/gVSS for NaOH, KOH, and Ca(OH)2, respectively. In the biodegradability studies, the parameter evaluation provides an estimate of parameter uncertainty and correlation, and elucidates that there is no significant difference in biodegradability (0.413gCOD/gCOD, 0.367gCOD/gCOD, and 0.342gCOD/gCOD) for three alkalis (NaOH, KOH, and Ca(OH)2). Copyright © 2015 Elsevier Ltd. All rights reserved.
40 CFR 91.421 - Dilute gaseous exhaust sampling and analytical system description.
2010-07-01
... Pump—Constant Volume Sampler (PDP-CVS) system with a heat exchanger, or a Critical Flow Venturi... gas mixture temperature, measured at a point immediately ahead of the critical flow venturi, must be.... (a) General. The exhaust gas sampling system described in this section is designed to measure the...
Energy Technology Data Exchange (ETDEWEB)
Chen, Gang; Lin, Yuehe
2006-12-01
This is an invited book chapter. As with other analytical techniques, sample pretreatments, sample extraction, sample introduction, and related techniques are of extreme importance for micro-electro-mechanical systems (MEMS). Bio-MEMS devices and systems start with a sampling step. The biological sample then usually undergoes some kinds of sample preparation steps before the actual analysis. These steps may involve extracting the target sample from its matrix, removing interferences from the sample, derivatizing the sample to detectable species, or performing a sample preconcentration step. The integration of the components for sample pretreatment into microfluidic devices represents one of the remaining the bottle-neck towards achieving true miniaturized total analysis systems (?TAS). This chapter provides a thorough state-of-art of the developments in this field to date.
Jadcherla, Sudarshan R.; Stoner, Erin; Gupta, Alankar; Bates, D. Gregory; Fernandez, Soledad; Di Lorenzo, Carlo; Linscheid, Thomas
2013-01-01
Background and objectives Abnormal swallowing (dysphagia) among neonates is commonly evaluated using the videofluoroscopic swallow study (VSS). Radiological findings considered high risk for administration of oral feeding include nasopharyngeal reflux, laryngeal penetration, aspiration, or pooling. Our aims were to determine pharyngoesophageal motility correlates in neonates with dysphagia and the impact of multidisciplinary feeding strategy. Methods Twenty dysphagic neonates (mean gestation ± standard deviation [SD] = 30.9 ± 4.9 weeks; median 31.1 weeks; range = 23.7–38.6 weeks) with abnormal VSS results were evaluated at 49.9 ± 16.5 weeks (median 41.36 weeks) postmenstrual age. The subjects underwent a swallow-integrated pharyngoesophageal motility assessment of basal and adaptive swallowing reflexes using a micromanometry catheter and pneumohydraulic water perfusion system. Based on observations during the motility study, multidisciplinary feeding strategies were applied and included postural adaptation, sensory modification, hunger manipulation, and operant conditioning methods. To discriminate pharyngoesophageal manometry correlates between oral feeders and tube feeders, data were stratified based on the primary feeding method at discharge, oral feeding versus tube feeding. Results At discharge, 15 of 20 dysphagic neonates achieved oral feeding success, and the rest required chronic tube feeding. Pharyngoesophageal manometry correlates were significantly different (P dysphagia or its consequences. Manometry may be a better predictor than VSS in identifying patients who are likely to succeed in vigorous intervention programs. PMID:19179881
The sample handling system for the Mars Icebreaker Life mission: from dirt to data.
Davé, Arwen; Thompson, Sarah J; McKay, Christopher P; Stoker, Carol R; Zacny, Kris; Paulsen, Gale; Mellerowicz, Bolek; Glass, Brian J; Willson, David; Bonaccorsi, Rosalba; Rask, Jon
2013-04-01
The Mars Icebreaker Life mission will search for subsurface life on Mars. It consists of three payload elements: a drill to retrieve soil samples from approximately 1 m below the surface, a robotic sample handling system to deliver the sample from the drill to the instruments, and the instruments themselves. This paper will discuss the robotic sample handling system. Collecting samples from ice-rich soils on Mars in search of life presents two challenges: protection of that icy soil--considered a "special region" with respect to planetary protection--from contamination from Earth, and delivery of the icy, sticky soil to spacecraft instruments. We present a sampling device that meets these challenges. We built a prototype system and tested it at martian pressure, drilling into ice-cemented soil, collecting cuttings, and transferring them to the inlet port of the SOLID2 life-detection instrument. The tests successfully demonstrated that the Icebreaker drill, sample handling system, and life-detection instrument can collectively operate in these conditions and produce science data that can be delivered via telemetry--from dirt to data. Our results also demonstrate the feasibility of using an air gap to prevent forward contamination. We define a set of six analog soils for testing over a range of soil cohesion, from loose sand to basalt soil, with angles of repose of 27° and 39°, respectively. Particle size is a key determinant of jamming of mechanical parts by soil particles. Jamming occurs when the clearance between moving parts is equal in size to the most common particle size or equal to three of these particles together. Three particles acting together tend to form bridges and lead to clogging. Our experiments show that rotary-hammer action of the Icebreaker drill influences the particle size, typically reducing particle size by ≈ 100 μm.
Jo, Su Yeon; Lee, Ju Mi; Kim, Hye Lim; Sin, Kyeong Hwa; Lee, Hyeon Ji; Chang, Chulhun Ludgerus; Kim, Hyung Hoi
2017-03-01
ABO blood typing in pre-transfusion testing is a major component of the high workload in blood banks that therefore requires automation. We often experienced discrepant results from an automated system, especially weak serum reactions. We evaluated the discrepant results by the reference manual method to confirm ABO blood typing. In total, 13,113 blood samples were tested with the AutoVue system; all samples were run in parallel with the reference manual method according to the laboratory protocol. The AutoVue system confirmed ABO blood typing of 12,816 samples (97.7%), and these results were concordant with those of the manual method. The remaining 297 samples (2.3%) showed discrepant results in the AutoVue system and were confirmed by the manual method. The discrepant results involved weak serum reactions (serum reactions, samples from patients who had received stem cell transplants, ABO subgroups, and specific system error messages. Among the 98 samples showing ≤1+ reaction grade in the AutoVue system, 70 samples (71.4%) showed a normal serum reaction (≥2+ reaction grade) with the manual method, and 28 samples (28.6%) showed weak serum reaction in both methods. ABO blood tying of 97.7% samples could be confirmed by the AutoVue system and a small proportion (2.3%) needed to be re-evaluated by the manual method. Samples with a 2+ reaction grade in serum typing do not need to be evaluated manually, while those with ≤1+ reaction grade do.
Using joined minicomputer-microcomputer systems for intricate sample and data manipulations
International Nuclear Information System (INIS)
Meng, J.D.
1980-09-01
We have produced, over the past three years, three automated x-ray fluorescence based elemental analysis systems, that combine a minicomputer and a microcomputer to perform intricate sample and data manipulations. The mini-micro combination facilitates the reuse of sizable sections of hardware and programs for different x-ray analysis projects. Each of our systems has been a step closer to an optimum general solution. The combination reaps economic benefits throughout development, fabrication and maintenance, an important consideration for designers of custom-built, one-of-a-kind data analysis systems such as these
Adaptive importance sampling for probabilistic validation of advanced driver assistance systems
Gietelink, O.J.; Schutter, B. de; Verhaegen, M.
2006-01-01
We present an approach for validation of advanced driver assistance systems, based on randomized algorithms. The new method consists of an iterative randomized simulation using adaptive importance sampling. The randomized algorithm is more efficient than conventional simulation techniques. The
Organics removal from landfill leachate and activated sludge production in SBR reactors
International Nuclear Information System (INIS)
Klimiuk, Ewa; Kulikowska, Dorota
2006-01-01
This study is aimed at estimating organic compounds removal and sludge production in SBR during treatment of landfill leachate. Four series were performed. At each series, experiments were carried out at the hydraulic retention time (HRT) of 12, 6, 3 and 2 d. The series varied in SBR filling strategies, duration of the mixing and aeration phases, and the sludge age. In series 1 and 2 (a short filling period, mixing and aeration phases in the operating cycle), the relationship between organics concentration (COD) in the leachate treated and HRT was pseudo-first-order kinetics. In series 3 (with mixing and aeration phases) and series 4 (only aeration phase) with leachate supplied by means of a peristaltic pump for 4 h of the cycle (filling during reaction period) - this relationship was zero-order kinetics. Activated sludge production expressed as the observed coefficient of biomass production (Y obs ) decreased correspondingly with increasing HRT. The smallest differences between reactors were observed in series 3 in which Y obs was almost stable (0.55-0.6 mg VSS/mg COD). The elimination of the mixing phase in the cycle (series 4) caused the Y obs to decrease significantly from 0.32 mg VSS/mg COD at HRT 2 d to 0.04 mg VSS/mg COD at HRT 12 d. The theoretical yield coefficient Y accounted for 0.534 mg VSS/mg COD (series 1) and 0.583 mg VSS/mg COD (series 2). In series 3 and 4, it was almost stable (0.628 mg VSS/mg COD and 0.616 mg VSS/mg COD, respectively). After the elimination of the mixing phase in the operating cycle, the specific biomass decay rate increased from 0.006 d -1 (series 3) to 0.032 d -1 (series 4). The operating conditions employing mixing/aeration or only aeration phases enable regulation of the sludge production. The SBRs operated under aerobic conditions are more favourable at a short hydraulic retention time. At long hydraulic retention time, it can lead to a decrease in biomass concentration in the SBR as a result of cell decay. On the contrary
International Nuclear Information System (INIS)
Hur, Woo Sung; Seong, Poong Hyun
1995-01-01
A great effort has been made to improve the nuclear plant control system by use of digital technologies and a long term schedule for the control system upgrade has been prepared with an aim to implementation in the next generation nuclear plants. In case of digital control system, it is important to decide the sampling period for analysis and design of the system, because the performance and the stability of a digital control system depend on the value of the sampling period of the digital control system. There is, however, currently no systematic method used universally for determining the sampling period of the digital control system. Generally, a traditional way to select the sampling frequency is to use 20 to 30 times the bandwidth of the analog control system which has the same system configuration and parameters as the digital one. In this paper, a new method to select the sampling period is suggested which takes into account of the performance as well as the stability of the digital control system. By use of the Irving's model steam generator, the optimal sampling period of an assumptive digital control system for steam generator level control is estimated and is actually verified in the digital control simulation system for Kori-2 nuclear power plant steam generator level control. Consequently, we conclude the optimal sampling period of the digital control system for Kori-2 nuclear power plant steam generator level control is 1 second for all power ranges. 7 figs., 3 tabs., 8 refs. (Author)
International Nuclear Information System (INIS)
Shang Yanlong; Cai Qi; Chen Lisheng; Zhang Yangwei
2012-01-01
In this paper, the combined method of response surface and importance sampling was applied for calculation of parameter failure probability of the thermodynamic system. The mathematics model was present for the parameter failure of physics process in the thermodynamic system, by which the combination arithmetic model of response surface and importance sampling was established, then the performance degradation model of the components and the simulation process of parameter failure in the physics process of thermodynamic system were also present. The parameter failure probability of the purification water system in nuclear reactor was obtained by the combination method. The results show that the combination method is an effective method for the calculation of the parameter failure probability of the thermodynamic system with high dimensionality and non-linear characteristics, because of the satisfactory precision with less computing time than the direct sampling method and the drawbacks of response surface method. (authors)
Standard Format for Chromatographic-polarimetric System small samples assessment
International Nuclear Information System (INIS)
Naranjo, S.; Fajer, V.; Fonfria, C.; Patinno, R.
2012-01-01
The treatment of samples containing optically active substances to be evaluated as part of quality control of raw material entering industrial process, and also during the modifications exerted on it to obtain the desired final composition is still and unsolved problem for many industries. That is the case of sugarcane industry. Sometimes the troubles implied are enlarged because samples to be evaluated are not bigger than one milliliter. Reduction of gel beds in G-10 and G-50 chromatographic columns having an inner diameter of 16 mm, instead of 25, and bed heights adjustable to requirements by means of sliding stoppers to increase analytical power were evaluated with glucose and sucrose standards in concentrations from 1 to 10 g/dL, using aliquots of 1 ml without undesirable dilutions that could affect either detection or chromatographic profile. Assays with seaweed extracts gave good results that are shown. It is established the advantage to know concentration of a separated substance by the height of its peak and the savings in time and reagents resulting . Sample expanded uncertainty in both systems is compared. It is also presented several programs for data acquisition, storing and processing. (Author)
International Nuclear Information System (INIS)
Houck, E.D.
1992-01-01
This paper covers the development of the fluidic sampler and its testing in a fluidic transfer system. The major findings of this paper are as follows. Fluidic jet samples can dependably produce unbiased samples of acceptable volume. The fluidic transfer system with a fluidic sampler in-line will transfer water to a net lift of 37.2--39.9 feet at an average ratio of 0.02--0.05 gpm (77--192 cc/min). The fluidic sample system circulation rate compares very favorably with the normal 0.016--0.026 gpm (60--100 cc/min) circulation rate that is commonly produced for this lift and solution with the jet-assisted airlift sample system that is normally used at ICPP. The volume of the sample taken with a fluidic sampler is dependant on the motive pressure to the fluidic sampler, the sample bottle size and on the fluidic sampler jet characteristics. The fluidic sampler should be supplied with fluid having the motive pressure of the 140--150 percent of the peak vacuum producing motive pressure for the jet in the sampler. Fluidic transfer systems should be operated by emptying a full pumping chamber to nearly empty or empty during the pumping cycle, this maximizes the solution transfer rate
Reliability estimation system: its application to the nuclear geophysical sampling of ore deposits
International Nuclear Information System (INIS)
Khaykovich, I.M.; Savosin, S.I.
1992-01-01
The reliability estimation system accepted in the Soviet Union for sampling data in nuclear geophysics is based on unique requirements in metrology and methodology. It involves estimating characteristic errors in calibration, as well as errors in measurement and interpretation. This paper describes the methods of estimating the levels of systematic and random errors at each stage of the problem. The data of nuclear geophysics sampling are considered to be reliable if there are no statistically significant, systematic differences between ore intervals determined by this method and by geological control, or by other methods of sampling; the reliability of the latter having been verified. The difference between the random errors is statistically insignificant. The system allows one to obtain information on the parameters of ore intervals with a guaranteed random error and without systematic errors. (Author)
Operability test report for rotary mode core sampling system number 3
International Nuclear Information System (INIS)
Corbett, J.E.
1996-01-01
This report documents the successful completion of operability testing for the Rotary Mode Core Sampling (RMCS) system number-sign 3. The Report includes the test procedure (WHC-SD-WM-OTP-174), exception resolutions, data sheets, and a test report summary
Research on How to Remove Efficiently the Condensate Water of Sampling System
International Nuclear Information System (INIS)
Cho, SungHwan; Kim, MinSoo; Choi, HoYoung; In, WonHo
2015-01-01
Corrosion was caused in the measurement chamber inside the O 2 and H 2 analyzer, and thus measuring the concentration of O 2 and H 2 was not possible. It was confirmed that the cause of the occurrence of condensate water is due to the temperature difference caused during the process of the internal gas of the disposal and degasifier tank being brought into the analyzer. Thus, a heating system was installed inside and outside of the sampling panel for gas to remove generated condensate water in the analyzer and pipe. For the case where condensate water is not removed by the heating system, drain port is also installed in the sampling panel for gas to collect the condensate water of the sampling system. It was verified that there is a great volume of condensate water existing in the pipe line during the purging process after installing manufactured goods. The condensate water was fully removed by the installed heating cable and drain port. The heating cable was operated constantly at a temperature of 80 to 90 .deg. C, which allows the precise measurement of gas concentration and longer maintenance duration by blocking of the condensate water before being produced. To install instruments for measuring the gas, such as an O 2 and H 2 analyzer etc., consideration regarding whether there condensate water is present due to the temperature difference between the measuring system and analyzer is required
Research on How to Remove Efficiently the Condensate Water of Sampling System
Energy Technology Data Exchange (ETDEWEB)
Cho, SungHwan; Kim, MinSoo; Choi, HoYoung; In, WonHo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-10-15
Corrosion was caused in the measurement chamber inside the O{sub 2} and H{sub 2} analyzer, and thus measuring the concentration of O{sub 2} and H{sub 2} was not possible. It was confirmed that the cause of the occurrence of condensate water is due to the temperature difference caused during the process of the internal gas of the disposal and degasifier tank being brought into the analyzer. Thus, a heating system was installed inside and outside of the sampling panel for gas to remove generated condensate water in the analyzer and pipe. For the case where condensate water is not removed by the heating system, drain port is also installed in the sampling panel for gas to collect the condensate water of the sampling system. It was verified that there is a great volume of condensate water existing in the pipe line during the purging process after installing manufactured goods. The condensate water was fully removed by the installed heating cable and drain port. The heating cable was operated constantly at a temperature of 80 to 90 .deg. C, which allows the precise measurement of gas concentration and longer maintenance duration by blocking of the condensate water before being produced. To install instruments for measuring the gas, such as an O{sub 2} and H{sub 2} analyzer etc., consideration regarding whether there condensate water is present due to the temperature difference between the measuring system and analyzer is required.
Shanmugam, Akshaya; Usmani, Mohammad; Mayberry, Addison; Perkins, David L; Holcomb, Daniel E
2018-01-01
Miniaturized imaging devices have pushed the boundaries of point-of-care imaging, but existing mobile-phone-based imaging systems do not exploit the full potential of smart phones. This work demonstrates the use of simple imaging configurations to deliver superior image quality and the ability to handle a wide range of biological samples. Results presented in this work are from analysis of fluorescent beads under fluorescence imaging, as well as helminth eggs and freshwater mussel larvae under white light imaging. To demonstrate versatility of the systems, real time analysis and post-processing results of the sample count and sample size are presented in both still images and videos of flowing samples.
Low-sensitivity H ∞ filter design for linear delta operator systems with sampling time jitter
Guo, Xiang-Gui; Yang, Guang-Hong
2012-04-01
This article is concerned with the problem of designing H ∞ filters for a class of linear discrete-time systems with low-sensitivity to sampling time jitter via delta operator approach. Delta-domain model is used to avoid the inherent numerical ill-condition resulting from the use of the standard shift-domain model at high sampling rates. Based on projection lemma in combination with the descriptor system approach often used to solve problems related to delay, a novel bounded real lemma with three slack variables for delta operator systems is presented. A sensitivity approach based on this novel lemma is proposed to mitigate the effects of sampling time jitter on system performance. Then, the problem of designing a low-sensitivity filter can be reduced to a convex optimisation problem. An important consideration in the design of correlation filters is the optimal trade-off between the standard H ∞ criterion and the sensitivity of the transfer function with respect to sampling time jitter. Finally, a numerical example demonstrating the validity of the proposed design method is given.
Energy Technology Data Exchange (ETDEWEB)
Ren, Nan-Qi; Tang, Jing; Liu, Bing-Feng; Guo, Wan-Qian [State Key Laboratory of Urban Water Resource and Environment, Harbin Institute of Technology, No.202 Haihe Road, Harbin 150090 (China)
2010-04-15
Fermentative H{sub 2} production in continuous stirred tank reactor (CSTR) system with bacteria attached onto granular activated carbon (GAC) was designed to produce H{sub 2} continuously. The H{sub 2} production performances of CSTR with suspended and attached-sludge from molasses were examined and compared at various organic loading rates (8-40 g COD/L/d) at hydraulic retention time of 6 h under mesophilic conditions (35 C). Both reactor systems achieved ethanol-type fermentation in the pH ranges 4.5-4.8 and 3.8-4.4, respectively, while ORP ranges from -450 to -470 mV and from -330 to -350 mV, respectively. The hydrogen production rate in the attached system was higher compared to that of the suspended system (9.72 and 6.65 L/d/L, respectively) while specific hydrogen production rate of 5.13 L/g VSS/d was higher in the suspended system. The attached-sludge CSTR is more stable than the suspended-sludge CSTR with regard to hydrogen production, pH, substrate utilization efficiency and metabolic products (e.g., volatile fatty acids and ethanol) during the whole test. (author)
International Nuclear Information System (INIS)
Sun, Wenjuan; Brown, Stephen; Flay, Nadia; McCarthy, Michael; McBride, John
2016-01-01
The use of x-ray computed tomography for dimensional measurements associated with engineering applications has flourished in recent years. However, error sources associated with the technology are not well understood. In this paper, a novel two-sphere reference sample has been developed and used to investigate the stability of the imaging system that consists of an x-ray tube and a detector. In contrast with other research work reported, this work considered relative positional variation along the x -, y - and z -axes. This sample is a significant improvement over the one sphere sample proposed previously, which can only be used to observe the stability of the imaging system along x - and y -axes. Temperature variations of different parts of the system have been monitored and the relationship between temperature variations and x-ray image stability has been studied. Other effects that may also influence the stability of the imaging system have been discussed. The proposed reference sample and testing method are transferable to other types of x-ray computed tomography systems, for example, systems with transmission targets and systems with sub-micrometre focal spots. (paper)
Procedures for sampling and sample reduction within quality assurance systems for solid biofuels
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
The objective of this experimental study on sampling was to determine the size and number of samples of biofuels required (taken at two sampling points in each case) and to compare two methods of sampling. The first objective of the sample-reduction exercise was to compare the reliability of various sampling methods, and the second objective was to measure the variations introduced as a result of reducing the sample size to form suitable test portions. The materials studied were sawdust, wood chips, wood pellets and bales of straw, and these were analysed for moisture, ash, particle size and chloride. The sampling procedures are described. The study was conducted in Scandinavia. The results of the study were presented in Leipzig in October 2004. The work was carried out as part of the UK's DTI Technology Programme: New and Renewable Energy.
Use of an Electronic Tongue System and Fuzzy Logic to Analyze Water Samples
Braga, Guilherme S.; Paterno, Leonardo G.; Fonseca, Fernando J.
2009-05-01
An electronic tongue (ET) system incorporating 8 chemical sensors was used in combination with two pattern recognition tools, namely principal component analysis (PCA) and Fuzzy logic for discriminating/classification of water samples from different sources (tap, distilled and three brands of mineral water). The Fuzzy program exhibited a higher accuracy than the PCA and allowed the ET to classify correctly 4 in 5 types of water. Exception was made for one brand of mineral water which was sometimes misclassified as tap water. On the other hand, the PCA grouped water samples in three clusters, one with the distilled water; a second with tap water and one brand of mineral water, and the third with the other two other brands of mineral water. Samples in the second and third clusters could not be distinguished. Nevertheless, close grouping between repeated tests indicated that the ET system response is reproducible. The potential use of the Fuzzy logic as the data processing tool in combination with an electronic tongue system is discussed.
Procedures for sampling and sample-reduction within quality assurance systems for solid biofuels
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-04-15
The bias introduced when sampling solid biofuels from stockpiles or containers instead of from moving streams is assessed as well as the number and size of samples required to represent accurately the bulk sample, variations introduced when reducing bulk samples into samples for testing, and the usefulness of sample reduction methods. Details are given of the experimental work carried out in Sweden and Denmark using sawdust, wood chips, wood pellets, forestry residues and straw. The production of a model European Standard for quality assurance of solid biofuels is examined.
Directory of Open Access Journals (Sweden)
Doo Yong Choi
2016-04-01
Full Text Available Rapid detection of bursts and leaks in water distribution systems (WDSs can reduce the social and economic costs incurred through direct loss of water into the ground, additional energy demand for water supply, and service interruptions. Many real-time burst detection models have been developed in accordance with the use of supervisory control and data acquisition (SCADA systems and the establishment of district meter areas (DMAs. Nonetheless, no consideration has been given to how frequently a flow meter measures and transmits data for predicting breaks and leaks in pipes. This paper analyzes the effect of sampling interval when an adaptive Kalman filter is used for detecting bursts in a WDS. A new sampling algorithm is presented that adjusts the sampling interval depending on the normalized residuals of flow after filtering. The proposed algorithm is applied to a virtual sinusoidal flow curve and real DMA flow data obtained from Jeongeup city in South Korea. The simulation results prove that the self-adjusting algorithm for determining the sampling interval is efficient and maintains reasonable accuracy in burst detection. The proposed sampling method has a significant potential for water utilities to build and operate real-time DMA monitoring systems combined with smart customer metering systems.
On the optimal sampling of bandpass measurement signals through data acquisition systems
International Nuclear Information System (INIS)
Angrisani, L; Vadursi, M
2008-01-01
Data acquisition systems (DAS) play a fundamental role in a lot of modern measurement solutions. One of the parameters characterizing a DAS is its maximum sample rate, which imposes constraints on the signals that can be alias-free digitized. Bandpass sampling theory singles out separated ranges of admissible sample rates, which can be significantly lower than carrier frequency. But, how to choose the most convenient sample rate according to the purpose at hand? The paper proposes a method for the automatic selection of the optimal sample rate in measurement applications involving bandpass signals; the effects of sample clock instability and limited resolution are also taken into account. The method allows the user to choose the location of spectral replicas of the sampled signal in terms of normalized frequency, and the minimum guard band between replicas, thus introducing a feature that no DAS currently available on the market seems to offer. A number of experimental tests on bandpass digitally modulated signals are carried out to assess the concurrence of the obtained central frequency with the expected one
Event Processing and Variable Part of Sample Period Determining in Combined Systems Using GA
Strémy, Maximilián; Závacký, Pavol; Jedlička, Martin
2011-01-01
This article deals with combined dynamic systems and usage of modern techniques in dealing with these systems, focusing particularly on sampling period design, cyclic processing tasks and related processing algorithms in the combined event management systems using genetic algorithms.
Gavrielides, Mike; Furney, Simon J; Yates, Tim; Miller, Crispin J; Marais, Richard
2014-01-01
Whole genomes, whole exomes and transcriptomes of tumour samples are sequenced routinely to identify the drivers of cancer. The systematic sequencing and analysis of tumour samples, as well other oncogenomic experiments, necessitates the tracking of relevant sample information throughout the investigative process. These meta-data of the sequencing and analysis procedures include information about the samples and projects as well as the sequencing centres, platforms, data locations, results locations, alignments, analysis specifications and further information relevant to the experiments. The current work presents a sample tracking system for oncogenomic studies (Onco-STS) to store these data and make them easily accessible to the researchers who work with the samples. The system is a web application, which includes a database and a front-end web page that allows the remote access, submission and updating of the sample data in the database. The web application development programming framework Grails was used for the development and implementation of the system. The resulting Onco-STS solution is efficient, secure and easy to use and is intended to replace the manual data handling of text records. Onco-STS allows simultaneous remote access to the system making collaboration among researchers more effective. The system stores both information on the samples in oncogenomic studies and details of the analyses conducted on the resulting data. Onco-STS is based on open-source software, is easy to develop and can be modified according to a research group's needs. Hence it is suitable for laboratories that do not require a commercial system.
Beuchelt, Tina
2017-01-01
European public procurement is becoming more sustainable. However, for goods with global supply chains, sustainable procurement faces several challenges. This paper highlights the sustainability challenges for biomass-based products, discusses the suitability of biomass-focused voluntary sustainability standards (VSS) to address them, and identifies experiences and knowledge gaps in the use of VSS in European public procurement. The paper is based on a comprehensive literature review and a ca...
Improved Rock Core Sample Break-off, Retention and Ejection System, Phase I
National Aeronautics and Space Administration — The proposed effort advances the design of an innovative core sampling and acquisition system with improved core break-off, retention and ejection features. The...
Non-uniformly sampled grids in double pole coordinate system for freeform reflector construction
Ma, Donglin; Pacheco, Shaun; Feng, Zexin; Liang, Rongguang
2015-08-01
We propose a new method to design freeform reflectors by nonuniformly sampling the source intensity distribution in double pole coordinate system. In double pole coordinate system, there is no pole for the whole hemisphere because both poles of the spherical coordinate system are moved to southernmost point of the sphere and overlapped together. With symmetric definition of both angular coordinates in the modified double pole coordinate system, a better match between the source intensity distribution and target irradiance distribution can be achieved for reflectors with large acceptance solid angle, leading to higher light efficiency and better uniformity on the target surface. With non-uniform sampling of the source intensity, we can design circular freeform reflector to obtain uniform rectangular illumination pattern. Aided by the feedback optimization, the freeform reflector can achieve the collection efficiency for ideal point source over 0.7 and relative standard deviation (RSD) less than 0.1.
Statistical sampling strategies
International Nuclear Information System (INIS)
Andres, T.H.
1987-01-01
Systems assessment codes use mathematical models to simulate natural and engineered systems. Probabilistic systems assessment codes carry out multiple simulations to reveal the uncertainty in values of output variables due to uncertainty in the values of the model parameters. In this paper, methods are described for sampling sets of parameter values to be used in a probabilistic systems assessment code. Three Monte Carlo parameter selection methods are discussed: simple random sampling, Latin hypercube sampling, and sampling using two-level orthogonal arrays. Three post-selection transformations are also described: truncation, importance transformation, and discretization. Advantages and disadvantages of each method are summarized
DEFF Research Database (Denmark)
Sun, Yi; Than Linh, Quyen; Hung, Tran Quang
2015-01-01
was capable to detect Salmonella at concentration of 50 cells per test within 40 min. The simple design, together with high level of integration, isothermal amplification, and quantitative analysis of multiple samples in short time will greatly enhance the practical applicability of the LOC system for rapid...... amplification (LAMP) for rapid and quantitative detection of Salmonella spp. in food samples. The whole diagnostic procedures including DNA isolation, isothermal amplification, and real-time detection were accomplished in a single chamber. Up to eight samples could be handled simultaneously and the system...... and usually take a few hours to days to complete. In response to the demand for rapid on line or at site detection of pathogens, in this study, we describe for the first time an eight-chamber lab-on-a-chip (LOC) system with integrated magnetic beads-based sample preparation and loop-mediated isothermal...
O2/CO Ignition System for Mars Sample Return Missions, Phase I
National Aeronautics and Space Administration — Returning a geological sample from the surface of Mars will require an ascent propulsion system with a comparatively large velocity change (delta-V) capability due...
Improved Rock Core Sample Break-off, Retention and Ejection System, Phase II
National Aeronautics and Space Administration — The proposed effort advances the design of an innovative core sampling and acquisition system with improved core break-off, retention and ejection features. Phase 1...
DEFF Research Database (Denmark)
Domingo Felez, Carlos; Mutlu, A. Gizem; Jensen, Marlene Mark
2014-01-01
Autotrophic nitrogen removal is regarded as a resource efficient process to manage nitrogen-rich residual streams. However, nitrous oxide emissions of these processes are poorly documented and strategies to mitigate emissions unknown. In this study, two sequencing batch reactors performing single...... was noted when the duration of aeration was increased while decreasing air flow rate (10.9 +/- 3.2% Delta N2O/Delta TN). The extant ammonium oxidation activity (mgNH(4)(+)-N/gVSS.min) positively correlated with the specific N2O production rate (mgN(2)O-N/gVSS.min) of the systems. Operating under conditions......-stage nitritation/anammox were operated under different aeration strategies, gradually adjusted over six months. At constant but limiting oxygen loading, synthetic reject water was fed (0.75g-N/L.d) and high nitrogen removal efficiencies (83 +/- 5 and 88 +/- 2%) obtained. Dynamics of liquid phase nitrous (N2O...
Sorzano, Carlos Oscars S; Pérez-De-La-Cruz Moreno, Maria Angeles; Burguet-Castell, Jordi; Montejo, Consuelo; Ros, Antonio Aguilar
2015-06-01
Pharmacokinetics (PK) applications can be seen as a special case of nonlinear, causal systems with memory. There are cases in which prior knowledge exists about the distribution of the system parameters in a population. However, for a specific patient in a clinical setting, we need to determine her system parameters so that the therapy can be personalized. This system identification is performed many times by measuring drug concentrations in plasma. The objective of this work is to provide an irregular sampling strategy that minimizes the uncertainty about the system parameters with a fixed amount of samples (cost constrained). We use Monte Carlo simulations to estimate the average Fisher's information matrix associated to the PK problem, and then estimate the sampling points that minimize the maximum uncertainty associated to system parameters (a minimax criterion). The minimization is performed employing a genetic algorithm. We show that such a sampling scheme can be designed in a way that is adapted to a particular patient and that it can accommodate any dosing regimen as well as it allows flexible therapeutic strategies. © 2015 Wiley Periodicals, Inc. and the American Pharmacists Association.
Hawker, Charles D; McCarthy, William; Cleveland, David; Messinger, Bonnie L
2014-03-01
Mislabeled samples are a serious problem in most clinical laboratories. Published error rates range from 0.39/1000 to as high as 1.12%. Standardization of bar codes and label formats has not yet achieved the needed improvement. The mislabel rate in our laboratory, although low compared with published rates, prompted us to seek a solution to achieve zero errors. To reduce or eliminate our mislabeled samples, we invented an automated device using 4 cameras to photograph the outside of a sample tube. The system uses optical character recognition (OCR) to look for discrepancies between the patient name in our laboratory information system (LIS) vs the patient name on the customer label. All discrepancies detected by the system's software then require human inspection. The system was installed on our automated track and validated with production samples. We obtained 1 009 830 images during the validation period, and every image was reviewed. OCR passed approximately 75% of the samples, and no mislabeled samples were passed. The 25% failed by the system included 121 samples actually mislabeled by patient name and 148 samples with spelling discrepancies between the patient name on the customer label and the patient name in our LIS. Only 71 of the 121 mislabeled samples detected by OCR were found through our normal quality assurance process. We have invented an automated camera system that uses OCR technology to identify potential mislabeled samples. We have validated this system using samples transported on our automated track. Full implementation of this technology offers the possibility of zero mislabeled samples in the preanalytic stage.
Okazaki, Ryuji; Sawada, Hirotaka; Yamanouchi, Shinji; Tachibana, Shogo; Miura, Yayoi N.; Sakamoto, Kanako; Takano, Yoshinori; Abe, Masanao; Itoh, Shoichi; Yamada, Keita; Yabuta, Hikaru; Okamoto, Chisato; Yano, Hajime; Noguchi, Takaaki; Nakamura, Tomoki; Nagao, Keisuke
2017-07-01
The spacecraft Hayabusa2 was launched on December 3, 2014, to collect and return samples from a C-type asteroid, 162173 Ryugu (provisional designation, 1999 JU3). It is expected that the samples collected contain organic matter and water-bearing minerals and have key information to elucidate the origin and history of the Solar System and the evolution of bio-related organics prior to delivery to the early Earth. In order to obtain samples with volatile species without terrestrial contamination, based on lessons learned from the Hayabusa mission, the sample catcher and container of Hayabusa2 were refined from those used in Hayabusa. The improvements include (1) a mirror finish of the inner wall surface of the sample catcher and the container, (2) adoption of an aluminum metal sealing system, and (3) addition of a gas-sampling interface for gas collection and evacuation. The former two improvements were made to limit contamination of the samples by terrestrial atmosphere below 1 Pa after the container is sealed. The gas-sampling interface will be used to promptly collect volatile species released from the samples in the sample container after sealing of the container. These improvements maintain the value of the returned samples.
Kertesz, Vilmos; Van Berkel, Gary J.
2016-07-12
A system for sampling a surface includes a surface sampling probe comprising a solvent liquid supply conduit and a distal end, and a sample collector for suspending a sample collection liquid adjacent to the distal end of the probe. A first electrode provides a first voltage to solvent liquid at the distal end of the probe. The first voltage produces a field sufficient to generate electrospray plume at the distal end of the probe. A second electrode provides a second voltage and is positioned to produce a plume-directing field sufficient to direct the electrospray droplets and ions to the suspended sample collection liquid. The second voltage is less than the first voltage in absolute value. A voltage supply system supplies the voltages to the first electrode and the second electrode. The first electrode can apply the first voltage directly to the solvent liquid. A method for sampling for a surface is also disclosed.
International Nuclear Information System (INIS)
BLACK, D.M.; KLEM, M.J.
2003-01-01
Approximately 400 Multi-canister overpacks (MCO) containing spent nuclear fuel are to be interim stored at the Canister Storage Building (CSB). Several MCOs (monitored MCOs) are designated to be gas sampled periodically at the CSB sampling/weld station (Bader 2002a). The monitoring program includes pressure, temperature and gas composition measurements of monitored MCOs during their first two years of interim storage at the CSB. The MCO sample cart (CART-001) is used at the sampling/weld station to measure the monitored MCO gas temperature and pressure, obtain gas samples for laboratory analysis and refill the monitored MCO with high purity helium as needed. The sample cart and support equipment were functionally and operationally tested and validated before sampling of the first monitored MCO (H-036). This report documents the results of validation testing using training MCO (TR-003) at the CSB. Another report (Bader 2002b) documents the sample results from gas sampling of the first monitored MCO (H-036). Validation testing of the MCO gas sampling system showed the equipment and procedure as originally constituted will satisfactorily sample the first monitored MCO. Subsequent system and procedural improvements will provide increased flexibility and reliability for future MCO gas sampling. The physical operation of the sampling equipment during testing provided evidence that theoretical correlation factors for extrapolating MCO gas composition from sample results are unnecessarily conservative. Empirically derived correlation factors showed adequate conservatism and support use of the sample system for ongoing monitored MCO sampling
Energy Technology Data Exchange (ETDEWEB)
Swaminathan-Gopalan, Krishnan; Stephani, Kelly A., E-mail: ksteph@illinois.edu [Department of Mechanical Science and Engineering, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)
2016-02-15
A systematic approach for calibrating the direct simulation Monte Carlo (DSMC) collision model parameters to achieve consistency in the transport processes is presented. The DSMC collision cross section model parameters are calibrated for high temperature atmospheric conditions by matching the collision integrals from DSMC against ab initio based collision integrals that are currently employed in the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA) and Data Parallel Line Relaxation (DPLR) high temperature computational fluid dynamics solvers. The DSMC parameter values are computed for the widely used Variable Hard Sphere (VHS) and the Variable Soft Sphere (VSS) models using the collision-specific pairing approach. The recommended best-fit VHS/VSS parameter values are provided over a temperature range of 1000-20 000 K for a thirteen-species ionized air mixture. Use of the VSS model is necessary to achieve consistency in transport processes of ionized gases. The agreement of the VSS model transport properties with the transport properties as determined by the ab initio collision integral fits was found to be within 6% in the entire temperature range, regardless of the composition of the mixture. The recommended model parameter values can be readily applied to any gas mixture involving binary collisional interactions between the chemical species presented for the specified temperature range.
Chatterjee, Pritha; Ghangrekar, M M; Rao, Surampalli
2018-02-01
A hybrid upflow anaerobic sludge blanket (UASB)-moving bed biofilm (MBB) and rope bed biofilm (RBB) reactor was designed for treatment of sewage. Possibility of enhancing granulation in an UASB reactor using moving media to improve sludge retention was explored while treating low-strength wastewater. The presence of moving media in the top portion of the UASB reactor allowed a high solid retention time even at very short hydraulic retention times and helped in maintaining selection pressure in the sludge bed to promote formation of different sized sludge granules with an average settling velocity of 67 m/h. These granules were also found to contain plenty of extracellular polymeric substance (EPS) such as 58 mg of polysaccharides (PS) per gram of volatile suspended solids (VSS) and protein (PN) content of 37 mg/g VSS. Enriched sludge of nitrogen-removing bacteria forming a porous biofilm on the media in RBB was also observed in a concentration of around 894 g/m 2 . The nitrogen removing sludge also had a high EPS content of around 22 mg PS/g VSS and 28 mg PN/g VSS. This hybrid UASB-MBB-RBB reactor with enhanced anaerobic granular sludge treating both carbonaceous and nitrogenous matter may be a sustainable solution for decentralized sewage treatment.
An improved VSS NLMS algorithm for active noise cancellation
Sun, Yunzhuo; Wang, Mingjiang; Han, Yufei; Zhang, Congyan
2017-08-01
In this paper, an improved variable step size NLMS algorithm is proposed. NLMS has fast convergence rate and low steady state error compared to other traditional adaptive filtering algorithm. But there is a contradiction between the convergence speed and steady state error that affect the performance of the NLMS algorithm. Now, we propose a new variable step size NLMS algorithm. It dynamically changes the step size according to current error and iteration times. The proposed algorithm has simple formulation and easily setting parameters, and effectively solves the contradiction in NLMS. The simulation results show that the proposed algorithm has a good tracking ability, fast convergence rate and low steady state error simultaneously.
DEFF Research Database (Denmark)
Dziembowski, Stefan
here and discuss other problems caused by the adaptiveness. All protocols in the thesis are formally specified and the proofs of their security are given. [1]Ronald Cramer, Ivan Damgård, Stefan Dziembowski, Martin Hirt, and Tal Rabin. Efficient multiparty computations with dishonest minority......In this thesis we study a problem of doing Verifiable Secret Sharing (VSS) and Multiparty Computations in a model where private channels between the players and a broadcast channel is available. The adversary is active, adaptive and has an unbounded computing power. The thesis is based on two...... to a polynomial time black-box reduction, the complexity of adaptively secure VSS is the same as that of ordinary secret sharing (SS), where security is only required against a passive, static adversary. Previously, such a connection was only known for linear secret sharing and VSS schemes. We then show...
Chen, Ming; He, Jing; Cao, Zizheng; Tang, Jin; Chen, Lin; Wu, Xian
2014-09-01
In this paper, we propose and experimentally demonstrate a symbol synchronization and sampling frequency synchronization techniques in real-time direct-detection optical orthogonal frequency division multiplexing (DDO-OFDM) system, over 100-km standard single mode fiber (SSMF) using a cost-effective directly modulated distributed feedback (DFB) laser. The experiment results show that the proposed symbol synchronization based on training sequence (TS) has a low complexity and high accuracy even at a sampling frequency offset (SFO) of 5000-ppm. Meanwhile, the proposed pilot-assisted sampling frequency synchronization between digital-to-analog converter (DAC) and analog-to-digital converter (ADC) is capable of estimating SFOs with an accuracy of technique can also compensate SFO effects within a small residual SFO caused by deviation of SFO estimation and low-precision or unstable clock source. The two synchronization techniques are suitable for high-speed DDO-OFDM transmission systems.
Safety analysis report for packaging (onsite) sample pig transport system
International Nuclear Information System (INIS)
MCCOY, J.C.
1999-01-01
This Safety Analysis Report for Packaging (SARP) provides a technical evaluation of the Sample Pig Transport System as compared to the requirements of the U.S. Department of Energy, Richland Operations Office (RL) Order 5480.1, Change 1, Chapter III. The evaluation concludes that the package is acceptable for the onsite transport of Type B, fissile excepted radioactive materials when used in accordance with this document
Safety analysis report for packaging (onsite) sample pig transport system
Energy Technology Data Exchange (ETDEWEB)
MCCOY, J.C.
1999-03-16
This Safety Analysis Report for Packaging (SARP) provides a technical evaluation of the Sample Pig Transport System as compared to the requirements of the U.S. Department of Energy, Richland Operations Office (RL) Order 5480.1, Change 1, Chapter III. The evaluation concludes that the package is acceptable for the onsite transport of Type B, fissile excepted radioactive materials when used in accordance with this document.
International Nuclear Information System (INIS)
Bontha, J.R.; Golcar, G.R.; Hannigan, N.
2000-01-01
The BNFL Inc. flowsheet for the pretreatment and vitrification of the Hanford High Level Tank waste includes the use of several hundred Reverse Flow Diverters (RFDs) for sampling and transferring the radioactive slurries and Pulsed Jet mixers to homogenize or suspend the tank contents. The Pulsed Jet mixing and the RFD sampling devices represent very simple and efficient methods to mix and sample slurries, respectively, using compressed air to achieve the desired operation. The equipment has no moving parts, which makes them very suitable for mixing and sampling highly radioactive wastes. However, the effectiveness of the mixing and sampling systems are yet to be demonstrated when dealing with Hanford slurries, which exhibit a wide range of physical and theological properties. This report describes the results of the testing of BNFL's Pulsed Jet mixing and RFD sampling systems in a 13-ft ID and 15-ft height dish-bottomed tank at Battelle's 336 building high-bay facility using AZ-101/102 simulants containing up to 36-wt% insoluble solids. The specific objectives of the work were to: Demonstrate the effectiveness of the Pulsed Jet mixing system to thoroughly homogenize Hanford-type slurries over a range of solids loading; Minimize/optimize air usage by changing sequencing of the Pulsed Jet mixers or by altering cycle times; and Demonstrate that the RFD sampler can obtain representative samples of the slurry up to the maximum RPP-WTP baseline concentration of 25-wt%
A nuclear radiation multi-parameter measurement system based on pulse-shape sampling
International Nuclear Information System (INIS)
Qiu Xiaolin; Fang Guoming; Xu Peng; Di Yuming
2007-01-01
In this paper, A nuclear radiation multi-parameter measurement system based on pulse-shape sampling is introduced, including the system's characteristics, composition, operating principle, experiment data and analysis. Compared with conventional nuclear measuring apparatus, it has some remarkable advantages such as the synchronous detection using multi-parameter measurement in the same measurement platform and the general analysis of signal data by user-defined program. (authors)
An in-vacuum wall current monitor and low cost signal sampling system
International Nuclear Information System (INIS)
Yin, Y.; Rawnsley, W.R.; Mackenzie, G.H.
1993-11-01
The beam bunches extracted from the TRIUMF cyclotron are usually about 4 ns long, contain ∼ 4 x 10 7 protons, and are spaced at 43 ns. A wall current monitor capable of giving the charge distribution within a bunch, on a bunch by bunch basis, has recently been installed together with a sampling system for routine display in the control room. The wall current monitor is enclosed in a vacuum vessel and no ceramic spacer is required. This enhances the response to high frequencies, ferrite rings extend the low frequency response. Bench measurements show a flat response between a few hundred kilohertz and 4.6 GHz. For a permanent display in the control room the oscilloscope will be replaced by a Stanford Research Systems fast sampler module, a scanner module, and an interface module made at TRIUMF. The time to acquire one 10 ns distribution encompassing the beam bunch is 30 ms with a sample width of 100 ps and an average sample spacing of 13 ps. The scan, sample, and retrace signals are buffered carried on 70 m differential lines to the control room. An analog scope in XYZ mode provides a real time display. Signal averaging can be performed by using a digital oscilloscope in YT mode. (author). 6 refs., 2 tabs., 7 figs
MoonDB — A Data System for Analytical Data of Lunar Samples
Lehnert, K.; Ji, P.; Cai, M.; Evans, C.; Zeigler, R.
2018-04-01
MoonDB is a data system that makes analytical data from the Apollo lunar sample collection and lunar meteorites accessible by synthesizing published and unpublished datasets in a relational database with an online search interface.
International Nuclear Information System (INIS)
Pohlman, J.W.; Knies, D.L.; Grabowski, K.S.; DeTurck, T.M.; Treacy, D.J.; Coffin, R.B.
2000-01-01
A facility at the Naval Research Laboratory (NRL), Washington, DC, has been developed to extract, trap, cryogenically distill and graphitize carbon from a suite of organic and inorganic carbon pools for analysis by accelerator mass spectrometry (AMS). The system was developed to investigate carbon pools associated with the formation and stability of methane hydrates. However, since the carbon compounds found in hydrate fields are ubiquitous in aquatic ecosystems, this apparatus is applicable to a number of oceanographic and environmental sample types. Targeted pools are dissolved methane, dissolved organic carbon (DOC), dissolved inorganic carbon (DIC), solid organic matrices (e.g., seston, tissue and sediments), biomarkers and short chained (C 1 -C 5 ) hydrocarbons from methane hydrates. In most instances, the extraction, distillation and graphitization events are continuous within the system, thus, minimizing the possibility of fractionation or contamination during sample processing. A variety of methods are employed to extract carbon compounds and convert them to CO 2 for graphitization. Dissolved methane and DIC from the same sample are sparged and cryogenically separated before the methane is oxidized in a high temperature oxygen stream. DOC is oxidized to CO 2 by 1200 W ultraviolet photo-oxidation lamp, and solids oxidized in sealed, evacuated tubes. Hydrocarbons liberated from the disassociation of gas hydrates are cryogenically separated with a cryogenic temperature control unit, and biomarkers separated and concentrated by preparative capillary gas chromatography (PCGC). With this system, up to 20 samples, standards or blanks can be processed per day
Directory of Open Access Journals (Sweden)
Madsen M
2002-03-01
Full Text Available Bacteriological follow-up samples were taken from 41 chicken (Gallus gallus flocks in floor systems, where Salmonella enterica (Salmonella had been detected either directly in bacteriological samples or indirectly by serological samples. Three types of follow-up samples were compared to each other within each flock: 1 5 pairs of socks, analysed as 5 samples, 2 2 pairs of socks, analysed as one sample, and 3 60 faecal samples, analysed as one pooled sample. Agreement between sampling methods was evaluated by the following statistical tests: 'Kappa', 'The adjusted rand', McNemar's test for marginal symmetry, Proportion of agreement P0, P+, P-, and Odds Ratio. The highest agreement was found between the 2 types of sock sampling, while the lowest agreement was found by comparing 60 faecal samples with 5 pairs of socks. Two pairs of socks analysed as one pool appeared to be just as effective in detecting S. enterica as the 60 faecal samples. In broiler flocks, 5 pairs of socks were used both in the routine samples taken at about 3 weeks of age for the establishment of infection of the flock, and as one of the follow-up samples taken shortly before slaughter age, which means that the only notable differences between the 2 sampling rounds were the age of the broilers and of their litter. S. enterica was detected more frequently in samples from broilers about 3 weeks old, than in similar samples taken from broilers a few days prior to slaughter at ca. 33–40 days of age.
Development project of an automatic sampling system for part time unmanned pipeline terminals
Energy Technology Data Exchange (ETDEWEB)
Moreira, Gullherme O.; De Almelda, Marcio M. G.; Ramos, Ricardo R. [Petrobas, (Brazil); Potten, Gary [Cameron Measurement Systems, (United States)
2010-07-01
The Sao Paulo - Brasilia Pipeline (OSBRA) is a highly automated pipeline using a SCADA system which operates from a control room. A new quality management system standard was established for transportation and storage operations. The products had to be sampled on an automatic basis. This paper reports the development of an automatic sampling system (ASS) in accordance with the new quality control standard. The prototype was developed to be implemented through a human-machine interface (HMI) from the control room SCADA screens. A technical cooperation agreement(TCA) was drawn up for development of this new ASS product. The TCA was a joint cooperation between the Holding, the Operator and the cooperators. The prototype will be on-field tested at Senador Canedo tank farm to SPEC requirements. The current performance of the ASS establishes reasonable expectations for further successful development.
Li, Jin-Na; Er, Meng-Joo; Tan, Yen-Kheng; Yu, Hai-Bin; Zeng, Peng
2015-09-01
This paper investigates an adaptive sampling rate control scheme for networked control systems (NCSs) subject to packet disordering. The main objectives of the proposed scheme are (a) to avoid heavy packet disordering existing in communication networks and (b) to stabilize NCSs with packet disordering, transmission delay and packet loss. First, a novel sampling rate control algorithm based on statistical characteristics of disordering entropy is proposed; secondly, an augmented closed-loop NCS that consists of a plant, a sampler and a state-feedback controller is transformed into an uncertain and stochastic system, which facilitates the controller design. Then, a sufficient condition for stochastic stability in terms of Linear Matrix Inequalities (LMIs) is given. Moreover, an adaptive tracking controller is designed such that the sampling period tracks a desired sampling period, which represents a significant contribution. Finally, experimental results are given to illustrate the effectiveness and advantages of the proposed scheme. Copyright © 2015 ISA. Published by Elsevier Ltd. All rights reserved.
SAIL—a software system for sample and phenotype availability across biobanks and cohorts
Gostev, Mikhail; Fernandez-Banet, Julio; Rung, Johan; Dietrich, Joern; Prokopenko, Inga; Ripatti, Samuli; McCarthy, Mark I.; Brazma, Alvis; Krestyaninova, Maria
2011-01-01
Summary: The Sample avAILability system—SAIL—is a web based application for searching, browsing and annotating biological sample collections or biobank entries. By providing individual-level information on the availability of specific data types (phenotypes, genetic or genomic data) and samples within a collection, rather than the actual measurement data, resource integration can be facilitated. A flexible data structure enables the collection owners to provide descriptive information on their samples using existing or custom vocabularies. Users can query for the available samples by various parameters combining them via logical expressions. The system can be scaled to hold data from millions of samples with thousands of variables. Availability: SAIL is available under Aferro-GPL open source license: https://github.com/sail. Contact: gostev@ebi.ac.uk, support@simbioms.org Supplementary information: Supplementary data are available at Bioinformatics online and from http://www.simbioms.org. PMID:21169373
Slattery, Jim
2005-01-01
To evaluate various designs for a quality assurance system to detect and control human errors in a national screening programme for diabetic retinopathy. A computer simulation was performed of some possible ways of sampling the referral decisions made during grading and of different criteria for initiating more intensive QA investigations. The effectiveness of QA systems was assessed by the ability to detect a grader making occasional errors in referral. Substantial QA sample sizes are needed to ensure against inappropriate failure to refer. Detection of a grader who failed to refer one in ten cases can be achieved with a probability of 0.58 using an annual sample size of 300 and 0.77 using a sample size of 500. An unmasked verification of a sample of non-referrals by a specialist is the most effective method of internal QA for the diabetic retinopathy screening programme. Preferential sampling of those with some degree of disease may improve the efficiency of the system.
International Nuclear Information System (INIS)
REICH, F.R.
1999-01-01
An engineering task plan was developed that presents the resources, responsibilities, and schedules for the development, test, and deployment of the nested, fixed-depth fluidic sampling and at-tank analysis system. The sampling system, deployed in the privatization contract double-shell tank feed tank, will provide waste samples for assuring the readiness of the tank for shipment to the privatization contractor for vitrification. The at-tank analysis system will provide ''real-time'' assessments of the sampled wastes' chemical and physical properties. These systems support the Hanford Phase 1B Privatization Contract
Remote laser drilling and sampling system for the detection of concealed explosives
Wild, D.; Pschyklenk, L.; Theiß, C.; Holl, G.
2017-05-01
The detection of hazardous materials like explosives is a central issue in national security in the field of counterterrorism. One major task includes the development of new methods and sensor systems for the detection. Many existing remote or standoff methods like infrared or raman spectroscopy find their limits, if the hazardous material is concealed in an object. Imaging technologies using x-ray or terahertz radiation usually yield no information about the chemical content itself. However, the exact knowledge of the real threat potential of a suspicious object is crucial for disarming the device. A new approach deals with a laser drilling and sampling system for the use as verification detector for suspicious objects. Central part of the system is a miniaturised, diode pumped Nd:YAG laser oscillator-amplifier. The system allows drilling into most materials like metals, synthetics or textiles with bore hole diameters in the micron scale. During the drilling process, the hazardous material can be sampled for further investigation with suitable detection methods. In the reported work, laser induced breakdown spectroscopy (LIBS) is used to monitor the drilling process and to classify the drilled material. Also experiments were carried out to show the system's ability to not ignite even sensitive explosives like triacetone triperoxide (TATP). The detection of concealed hazardous material is shown for different explosives using liquid chromatography and ion mobility spectrometry.
2010-04-01
... OTC test sample collection systems for drugs of abuse testing. 809.40 Section 809.40 Food and Drugs... Restrictions on the sale, distribution, and use of OTC test sample collection systems for drugs of abuse testing. (a) Over-the-counter (OTC) test sample collection systems for drugs of abuse testing (§ 864.3260...
Sommer, D; Enderlein, D; Antakli, A; Schönenbrücher, H; Slaghuis, J; Redmann, T; Lierz, M
2012-01-01
The efficiency of two commercial PCR methods based on real-time technology, the foodproof® Salmonella detection system and the BAX® PCR Assay Salmonella system was compared to standardized culture methods (EN ISO 6579:2002 - Annex D) for the detection of Salmonella spp. in poultry samples. Four sample matrices (feed, dust, boot swabs, feces) obtained directly from poultry flocks, as well as artificially spiked samples of the same matrices, were used. All samples were tested for Salmonella spp. using culture methods first as the gold standard. In addition samples spiked with Salmonella Enteridis were tested to evaluate the sensitivity of both PCR methods. Furthermore all methods were evaluated in an annual ring-trial of the National Salmonella Reference Laboratory of Germany. Salmonella detection in the matrices feed, dust and boot swabs were comparable in both PCR systems whereas the results from feces differed markedly. The quality, especially the freshness, of the fecal samples had an influence on the sensitivity of the real-time PCR and the results of the culture methods. In fresh fecal samples an initial spiking level of 100cfu/25g Salmonella Enteritidis was detected. Two-days-dried fecal samples allowed the detection of 14cfu/25g. Both real- time PCR protocols appear to be suitable for the detection of Salmonella spp. in all four matrices. The foodproof® system detected eight samples more to be positive compared to the BAX® system, but had a potential false positive result in one case. In 7-days-dried samples none of the methods was able to detect Salmonella likely through letal cell damage. In general the advantage of PCR analyses over the culture method is the reduction of working time from 4-5 days to only 2 days. However, especially for the analysis of fecal samples official validation should be conducted according to the requirement of EN ISO6579:2002 - Annex D.
Classifier-Guided Sampling for Complex Energy System Optimization
Energy Technology Data Exchange (ETDEWEB)
Backlund, Peter B. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Eddy, John P. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)
2015-09-01
This report documents the results of a Laboratory Directed Research and Development (LDRD) effort enti tled "Classifier - Guided Sampling for Complex Energy System Optimization" that was conducted during FY 2014 and FY 2015. The goal of this proj ect was to develop, implement, and test major improvements to the classifier - guided sampling (CGS) algorithm. CGS is type of evolutionary algorithm for perform ing search and optimization over a set of discrete design variables in the face of one or more objective functions. E xisting evolutionary algorithms, such as genetic algorithms , may require a large number of o bjecti ve function evaluations to identify optimal or near - optimal solutions . Reducing the number of evaluations can result in significant time savings, especially if the objective function is computationally expensive. CGS reduce s the evaluation count by us ing a Bayesian network classifier to filter out non - promising candidate designs , prior to evaluation, based on their posterior probabilit ies . In this project, b oth the single - objective and multi - objective version s of the CGS are developed and tested on a set of benchm ark problems. As a domain - specific case study, CGS is used to design a microgrid for use in islanded mode during an extended bulk power grid outage.
The EnzymeTracker: an open-source laboratory information management system for sample tracking.
Triplet, Thomas; Butler, Gregory
2012-01-26
In many laboratories, researchers store experimental data on their own workstation using spreadsheets. However, this approach poses a number of problems, ranging from sharing issues to inefficient data-mining. Standard spreadsheets are also error-prone, as data do not undergo any validation process. To overcome spreadsheets inherent limitations, a number of proprietary systems have been developed, which laboratories need to pay expensive license fees for. Those costs are usually prohibitive for most laboratories and prevent scientists from benefiting from more sophisticated data management systems. In this paper, we propose the EnzymeTracker, a web-based laboratory information management system for sample tracking, as an open-source and flexible alternative that aims at facilitating entry, mining and sharing of experimental biological data. The EnzymeTracker features online spreadsheets and tools for monitoring numerous experiments conducted by several collaborators to identify and characterize samples. It also provides libraries of shared data such as protocols, and administration tools for data access control using OpenID and user/team management. Our system relies on a database management system for efficient data indexing and management and a user-friendly AJAX interface that can be accessed over the Internet. The EnzymeTracker facilitates data entry by dynamically suggesting entries and providing smart data-mining tools to effectively retrieve data. Our system features a number of tools to visualize and annotate experimental data, and export highly customizable reports. It also supports QR matrix barcoding to facilitate sample tracking. The EnzymeTracker was designed to be easy to use and offers many benefits over spreadsheets, thus presenting the characteristics required to facilitate acceptance by the scientific community. It has been successfully used for 20 months on a daily basis by over 50 scientists. The EnzymeTracker is freely available online at http
Badescu, Mircea; Bonitz, Robert; Kulczycki, Erick; Aisen, Norman; Dandino, Charles M.; Cantrell, Brett S.; Gallagher, William; Shevin, Jesse; Ganino, Anthony; Haddad, Nicolas;
2013-01-01
The 2011 Decadal Survey for planetary science released by the National Research Council of the National Academies identified Comet Surface Sample Return (CSSR) as one of five high priority potential New Frontiers-class missions in the next decade. The main objectives of the research described in this publication are: develop a concept for an end-to-end system for collecting and storing a comet sample to be returned to Earth; design, fabricate and test a prototype Dynamic Acquisition and Retrieval Tool (DART) capable of collecting 500 cc sample in a canister and eject the canister with a predetermined speed; identify a set of simulants with physical properties at room temperature that suitably match the physical properties of the comet surface as it would be sampled. We propose the use of a dart that would be launched from the spacecraft to impact and penetrate the comet surface. After collecting the sample, the sample canister would be ejected at a speed greater than the comet's escape velocity and captured by the spacecraft, packaged into a return capsule and returned to Earth. The dart would be composed of an inner tube or sample canister, an outer tube, a decelerator, a means of capturing and retaining the sample, and a mechanism to eject the canister with the sample for later rendezvous with the spacecraft. One of the significant unknowns is the physical properties of the comet surface. Based on new findings from the recent Deep Impact comet encounter mission, we have limited our search of solutions for sampling materials to materials with 10 to 100 kPa shear strength in loose or consolidated form. As the possible range of values for the comet surface temperature is also significantly different than room temperature and testing at conditions other than the room temperature can become resource intensive, we sought sample simulants with physical properties at room temperature similar to the expected physical properties of the comet surface material. The chosen
Effects of data sampling rate on image quality in fan-beam-CT system
International Nuclear Information System (INIS)
Iwata, Akira; Yamagishi, Nobutoshi; Suzumura, Nobuo; Horiba, Isao.
1984-01-01
Investigation was made into the relationship between spatial resolution or artifacts and data sampling rate in order to pursue the causes of the degradation of CT image quality by computer simulation. First the generation of projection data and reconstruction calculating process are described, and then the results are shown about the relation between angular sampling interval and spatical resolution or artifacts, and about the relation between projection data sampling interval and spatial resolution or artifacts. It was clarified that the formulation of the relationship between spatial resolution and data sampling rate performed so far for parallel X-ray beam was able to be applied to fan beam. As a conclusion, when other reconstruction parameters are the same in fan beam CT systems, spatial resolution can be determined by projection data sampling rate rather than angular sampling rate. The mechanism of artifact generation due to the insufficient number of angular samples was made clear. It was also made clear that there was a definite relationship among measuring region, angular sampling rate and projection data sampling rate, and the amount of artifacts depending upon projection data sampling rate was proportional to the amount of spatial frequency components (Aliasing components) of a test object above the Nyquist frequency of projection data. (Wakatsuki, Y.)
Zhu, Zhongyunshen; Song, Yuxin; Zhang, Zhenpu; Sun, Hao; Han, Yi; Li, Yaoyao; Zhang, Liyao; Xue, Zhongying; Di, Zengfeng; Wang, Shumin
2017-09-01
We demonstrate Au-assisted vapor-solid-solid (VSS) growth of Ge nanowires (NWs) by molecular beam epitaxy at the substrate temperature of ˜180 °C, which is compatible with the temperature window for Si-based integrated circuit. Low temperature grown Ge NWs hold a smaller size, similar uniformity, and better fit with Au tips in diameter, in contrast to Ge NWs grown at around or above the eutectic temperature of Au-Ge alloy in the vapor-liquid-solid (VLS) growth. Six ⟨110⟩ growth orientations were observed on Ge (110) by the VSS growth at ˜180 °C, differing from only one vertical growth direction of Ge NWs by the VLS growth at a high temperature. The evolution of NWs dimension and morphology from the VLS growth to the VSS growth is qualitatively explained by analyzing the mechanism of the two growth modes.
International Nuclear Information System (INIS)
Dowell, J.L.; Akers, J.C.
1995-01-01
The system this document describes controls several functions of the Core Sample Truck(s) used to obtain nuclear waste samples from various underground storage tanks at Hanford. The system will monitor the sampling process and provide alarms and other feedback to insure the sampling process is performed within the prescribed operating envelope. The intended audience for this document is anyone associated with rotary or push mode core sampling. This document describes the Alarm and Control logic installed on Rotary Mode Core Sample Trucks (RMCST) number-sign 2, 3, and 4. It is intended to define the particular requirements of the RMCST alarm and control operation (not defined elsewhere) sufficiently for detailed design to implement on a Programmable Logic Controller (PLC)
Berezhkovskiy, Leonid M
2013-02-01
The steady state, V(ss), terminal volume of distribution, V(β), and the terminal half-life, t(1/2), are commonly obtained from the drug plasma concentration-time profile, C(p)(t), following intravenous dosing. Unlike V(ss) that can be calculated based on the physicochemical properties of drugs considering the equilibrium partitioning between plasma and organ tissues, t(1/2) and V(β) cannot be calculated that way because they depend on the rates of drug transfer between blood and tissues. Considering the physiological pharmacokinetic model pertinent to the terminal phase of drug elimination, a novel equation that calculates t(1/2) (and consequently V(β)) was derived. It turns out that V(ss), the total body clearance, Cl, equilibrium blood-plasma concentration ratio, r; and the physiological parameters of the body such as cardiac output, and blood and tissue volumes are sufficient for determination of terminal kinetics. Calculation of t(1/2) by the obtained equation appears to be in good agreement with the experimentally observed vales of this parameter in pharmacokinetic studies in rat, monkey, dog, and human. The equation for the determination of the pre-exponent of the terminal phase of C(p)(t) is also found. The obtained equation allows to predict t(1/2) in human assuming that V(ss) and Cl were either obtained by allometric scaling or, respectively, calculated in silico or based on in vitro drug stability measurements. For compounds that have high clearance, the derived equation may be applied to calculate r just using the routine data on Cl, V(ss), and t(1/2), rather than doing the in vitro assay to measure this parameter. Copyright © 2012 Wiley Periodicals, Inc.
Air bubbles and hemolysis of blood samples during transport by pneumatic tube systems.
Mullins, Garrett R; Bruns, David E
2017-10-01
Transport of blood samples through pneumatic tube systems (PTSs) generates air bubbles in transported blood samples and, with increasing duration of transport, the appearance of hemolysis. We investigated the role of air-bubble formation in PTS-induced hemolysis. Air was introduced into blood samples for 0, 1, 3 or 5min to form air bubbles. Hemolysis in the blood was assessed by (H)-index, lactate dehydrogenase (LD) and potassium in plasma. In an effort to prevent PTS-induced hemolysis, blood sample tubes were completely filled, to prevent air bubble formation, and compared with partially filled samples after PTS transport. We also compared hemolysis in anticoagulated vs clotted blood subjected to PTS transport. As with transport through PTSs, the duration of air bubble formation in blood by a gentle stream of air predicted the extent of hemolysis as measured by H-index (pair space in a blood sample prevented bubble formation and fully protected the blood from PTS-induced hemolysis (ptransport and was partially protected from hemolysis vs anticoagulated blood as indicated by lower LD (ptransport. Prevention of air bubble formation in blood samples during PTS transport protects samples from hemolysis. Copyright © 2017 Elsevier B.V. All rights reserved.
Pacific Northwest National Laboratory Facility Radionuclide Emission Points and Sampling Systems
International Nuclear Information System (INIS)
Barfuss, Brad C.; Barnett, J. M.; Ballinger, Marcel Y.
2009-01-01
Battelle-Pacific Northwest Division operates numerous research and development laboratories in Richland, Washington, including those associated with the Pacific Northwest National Laboratory (PNNL) on the Department of Energy's Hanford Site that have the potential for radionuclide air emissions. The National Emission Standard for Hazardous Air Pollutants (NESHAP 40 CFR 61, Subparts H and I) requires an assessment of all effluent release points that have the potential for radionuclide emissions. Potential emissions are assessed annually. Sampling, monitoring, and other regulatory compliance requirements are designated based upon the potential-to-emit dose criteria found in the regulations. The purpose of this document is to describe the facility radionuclide air emission sampling program and provide current and historical facility emission point system performance, operation, and design information. A description of the buildings, exhaust points, control technologies, and sample extraction details is provided for each registered or deregistered facility emission point. Additionally, applicable stack sampler configuration drawings, figures, and photographs are provided
Pacific Northwest National Laboratory Facility Radionuclide Emission Points and Sampling Systems
Energy Technology Data Exchange (ETDEWEB)
Barfuss, Brad C.; Barnett, J. Matthew; Ballinger, Marcel Y.
2009-04-08
Battelle—Pacific Northwest Division operates numerous research and development laboratories in Richland, Washington, including those associated with the Pacific Northwest National Laboratory (PNNL) on the Department of Energy’s Hanford Site that have the potential for radionuclide air emissions. The National Emission Standard for Hazardous Air Pollutants (NESHAP 40 CFR 61, Subparts H and I) requires an assessment of all effluent release points that have the potential for radionuclide emissions. Potential emissions are assessed annually. Sampling, monitoring, and other regulatory compliance requirements are designated based upon the potential-to-emit dose criteria found in the regulations. The purpose of this document is to describe the facility radionuclide air emission sampling program and provide current and historical facility emission point system performance, operation, and design information. A description of the buildings, exhaust points, control technologies, and sample extraction details is provided for each registered or deregistered facility emission point. Additionally, applicable stack sampler configuration drawings, figures, and photographs are provided.
Microbial Methane Fermentation Kinetics for Toxicant Exposure.
1981-08-31
Algorithms of k and K s.*.*....*.............. . .... 241 Inhibition Coefficient Model .. .... ...... .... 252 Activity Model...enrichment culture was developed with sludge from an anaerobic digester. This system, a 400-liter, complete-mix ( CSTR ) reac- tor operated at a 50-day...reasonably constant. However, in a real CSTR , longer SRTs result in lower VSS levels. This is an area worthy of further study. Effect of Temperature
A Geology Sampling System for Small Bodies
Naids, Adam J.; Hood, Anthony D.; Abell, Paul; Graff, Trevor; Buffington, Jesse
2016-01-01
Human exploration of microgravity bodies is being investigated as a precursor to a Mars surface mission. Asteroids, comets, dwarf planets, and the moons of Mars all fall into this microgravity category and some are being discussed as potential mission targets. Obtaining geological samples for return to Earth will be a major objective for any mission to a small body. Currently, the knowledge base for geology sampling in microgravity is in its infancy. Humans interacting with non-engineered surfaces in microgravity environment pose unique challenges. In preparation for such missions a team at the NASA Johnson Space Center has been working to gain experience on how to safely obtain numerous sample types in such an environment. This paper describes the type of samples the science community is interested in, highlights notable prototype work, and discusses an integrated geology sampling solution.
A Geology Sampling System for Microgravity Bodies
Hood, Anthony; Naids, Adam
2016-01-01
Human exploration of microgravity bodies is being investigated as a precursor to a Mars surface mission. Asteroids, comets, dwarf planets, and the moons of Mars all fall into this microgravity category and some are been discussed as potential mission targets. Obtaining geological samples for return to Earth will be a major objective for any mission to a microgravity body. Currently the knowledge base for geology sampling in microgravity is in its infancy. Humans interacting with non-engineered surfaces in microgravity environment pose unique challenges. In preparation for such missions a team at the NASA Johnson Space Center has been working to gain experience on how to safely obtain numerous sample types in such an environment. This paper describes the type of samples the science community is interested in, highlights notable prototype work, and discusses an integrated geology sampling solution.
Energy Technology Data Exchange (ETDEWEB)
Keller, Eric J.; Collins, Jeremy D. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Crowley-Matoka, Megan [Northwestern University Feinberg School of Medicine, Center for Bioethics and Medical Humanities (United States); Chrisman, Howard B. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Milad, Magdy P. [Northwestern University Feinberg School of Medicine, Department of Obstetrics and Gynecology-Reproductive Endocrinology and Infertility (United States); Vogelzang, Robert L., E-mail: vogelzang@northwestern.edu [Northwestern University Feinberg School of Medicine, Department of Radiology (United States)
2017-06-15
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
Energy Technology Data Exchange (ETDEWEB)
Kim, Young-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Dong Gyu, E-mail: gknife@plaza.snu.ac.kr [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Han, Jung Ho [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Park, Jeong-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Chae-Yong [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Paek, Sun Ha; Jung, Hee-Won [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of)
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 {+-} 0.03 cm{sup 3} (range, 0.03-1.00 cm{sup 3}), and the mean marginal dose was 12.2 {+-} 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of {>=}20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average {>=}20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
International Nuclear Information System (INIS)
Keller, Eric J.; Collins, Jeremy D.; Crowley-Matoka, Megan; Chrisman, Howard B.; Milad, Magdy P.; Vogelzang, Robert L.
2017-01-01
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
Energy Technology Data Exchange (ETDEWEB)
Anders, E.; Muller, W.H. [Technical Univ. of Berlin, Berlin (Germany). Chair of Continuum Mechanics and Material Theory
2008-07-01
Climate change, declining resources and over-consumption result in a need for sustainable resource allocation, habitat conservation and claim for new technologies and prospects for damage-containment. In order to increase knowledge of the environment and to define potential hazards, it is necessary to get an understanding of the deep biosphere. In addition, the benthic conditions of sediment structure and gas hydrates, temperature, pressure and bio-geochemistry must be maintained during the sequences of sampling, retrieval, transfer, storage and downstream analysis. In order to investigate highly instable gas hydrates, which decomposes under pressure and temperature change, a suite of research technologies have been developed by the Technische Universitat Berlin (TUB), Germany. This includes the pressurized core sub-sampling and extrusion system (PRESS) that was developed in the European Union project called HYACE/HYACINTH. The project enabled well-defined sectioning and transfer of drilled pressure-cores obtained by a rotary corer and fugro pressure corer into transportation and investigation chambers. This paper described HYACINTH pressure coring and the HYACINTH core transfer. Autoclave coring tools and HYACINTH core logging, coring tools, and sub-sampling were also discussed. It was concluded that possible future applications include, but were not limited to, research in shales and other tight formations, carbon dioxide sequestration, oil and gas exploration, coalbed methane, and microbiology of the deep biosphere. To meet the corresponding requirements and to incorporate the experiences from previous expeditions, the pressure coring system would need to be redesigned to adapt it to the new applications. 3 refs., 5 figs.
Development of a system using the library of the Genie spectroscopy software and exchange of samples
International Nuclear Information System (INIS)
Lapolli, Andre L.; Munita, Casimiro S.
2011-01-01
One the great difficulties in using the NAA method is in regards to the time that the operator spends exchanging the samples after each measurement. It becomes a big problem in routine analyses when various chemical elements are determined and then each sample must be measured at different decay times. The application of the automatic sample exchanger reduces the time analysis by several hours and reduces the tedious manual operation. Then, the effective use of NAA depends on the availability of a suitable automatic sample changer. There are some systems that are sold commercially, however many laboratories can not acquire them because they are costly. This paper presents altered programs the G2KNAA.REX, which created a screen making possible automatic or manual acquisitions by calling the old program NAAACQ.rex for the procurement manual and the new program NAAACQ2.rex for automatic requisitions. In conclusion, as can be seen in the program lines, the synchronization to automation, which unites the three systems (the computer, the Canberra Set, the sample exchanger) is done in a timely manner. The system was tested and is functioning in a satisfactory manner. (author)
International Nuclear Information System (INIS)
Toernqvist, T.E.; Dijk, G.J. Van
1993-01-01
The authors address the question of how to determine the period of activity (sedimentation) of fossil (Holocene) fluvial systems in vertically aggrading environments. The available data base consists of almost 100 14 C ages from the Rhine-Meuse delta. Radiocarbon samples from the tops of lithostratigraphically correlative organic beds underneath overbank deposits (sample type 1) yield consistent ages, indicating a synchronous onset of overbank deposition over distances of at least up to 20 km along channel belts. Similarly, 14 C ages from the base of organic residual channel fills (sample type 3) generally indicate a clear termination of within-channel sedimentation. In contrast, 14 C ages from the base of organic beds overlying overbank deposits (sample type 2), commonly assumed to represent the end of fluvial sedimentation, show a large scatter reaching up to 1000 14 C years. It is concluded that a combination of sample types 1 and 3 generally yields a satisfactory delimitation of the period of activity of a fossil fluvial system. 30 refs., 11 figs., 4 tabs
Hatamoto, Masashi; Ohtsuki, Kota; Maharjan, Namita; Ono, Shinya; Dehama, Kazuya; Sakamoto, Kenichi; Takahashi, Masanobu; Yamaguchi, Takashi
2016-03-01
A sulfur-redox-reaction-activated up-flow anaerobic sludge blanket (UASB) and down-flow hanging sponge (DHS) system, combined with an anaerobic/anoxic sequencing batch reactor (A2SBR), has been used for municipal sewage treatment for over 2 years. The present system achieved a removal rate of 95±14% for BOD, 74±22% for total nitrogen, and 78±25% for total phosphorus, including low water temperature conditions. Sludge conversion rates during the operational period were 0.016 and 0.218 g-VSS g-COD-removed(-1) for the UASB, and DHS, respectively, which are similar to a conventional UASB-DHS system, which is not used of sulfur-redox-reaction, for sewage treatment. Using the sulfur-redox reaction made advanced treatment of municipal wastewater with minimal sludge generation possible, even in winter. Furthermore, the occurrence of a unique phenomenon, known as the anaerobic sulfur oxidation reaction, was confirmed in the UASB reactor under the winter season. Copyright © 2016. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Wo, Y.M.; Dainee Nor Fardzila Ahmad Tugi; Khairul Nizam Razali
2015-01-01
The effects of sample density on the measurement efficiency of the gamma spectrometry system were studied by using four sets multi nuclide standard sources of various densities between 0.3 - 1.4 g/ ml. The study was conducted on seven unit 25 % coaxial HPGe detector gamma spectrometry systems in Radiochemistry and Environment Laboratory (RAS). Difference on efficiency against gamma emitting radionuclides energy and measurement systems were compared and discussed. Correction factor for self absorption caused by difference in sample matrix density of the gamma systems were estimated. The correction factors are to be used in quantification of radionuclides concentration in various densities of service and research samples in RAS. (author)
Probabilistic techniques using Monte Carlo sampling for multi- component system diagnostics
International Nuclear Information System (INIS)
Aumeier, S.E.; Lee, J.C.; Akcasu, A.Z.
1995-01-01
We outline the structure of a new approach at multi-component system fault diagnostics which utilizes detailed system simulation models, uncertain system observation data, statistical knowledge of system parameters, expert opinion, and component reliability data in an effort to identify incipient component performance degradations of arbitrary number and magnitude. The technique involves the use of multiple adaptive Kalman filters for fault estimation, the results of which are screened using standard hypothesis testing procedures to define a set of component events that could have transpired. Latin Hypercube sample each of these feasible component events in terms of uncertain component reliability data and filter estimates. The capabilities of the procedure are demonstrated through the analysis of a simulated small magnitude binary component fault in a boiling water reactor balance of plant. The results show that the procedure has the potential to be a very effective tool for incipient component fault diagnosis
Whang, Liang-Ming; Liu, Pao-Wen G; Ma, Chih-Chung; Cheng, Sheng-Shung
2008-02-28
This study investigated potential application of two biosurfactants, surfactin (SF) and rhamnolipid (RL), for enhanced biodegradation of diesel-contaminated water and soil with a series of bench-scale experiments. The rhamnolipid used in this study, a commonly isolated glycolipid biosurfactant, was produced by Pseudomonas aeruginosa J4, while the surfactin, a lipoprotein type biosurfactant, was produced by Bacillus subtilis ATCC 21332. Both biosurfactants were able to reduce surface tension to less than 30 dynes/cm from 72 dynes/cm with critical micelle concentration (CMC) values of 45 and 50 mg/L for surfactin and rhamnolipid, respectively. In addition, the results of diesel dissolution experiments also demonstrated their ability in increasing diesel solubility with increased biosurfactant addition. In diesel/water batch experiments, an addition of 40 mg/L of surfactin significantly enhanced biomass growth (2500 mg VSS/L) as well as increased diesel biodegradation percentage (94%), compared to batch experiments with no surfactin addition (1000 mg VSS/L and 40% biodegradation percentage). Addition of surfactin more than 40 mg/L, however, decreased both biomass growth and diesel biodegradation efficiency, with a worse diesel biodegradation percentage (0%) at 400 mg/L of SF addition. Similar trends were also observed for both specific rate constants of biomass growth and diesel degradation, as surfactin addition increased from 0 to 400 mg/L. Addition of rhamnolipid to diesel/water systems from 0 to 80 mg/L substantially increased biomass growth and diesel biodegradation percentage from 1000 to 2500 mg VSS/L and 40 to 100%, respectively. Rhamnolipid addition at a concentration of 160 mg/L provided similar results to those of an 80 mg/L addition. Finally, potential application of surfactin and rhamnolipid in stimulating indigenous microorganisms for enhanced bioremediation of diesel-contaminated soil was also examined. The results confirmed their enhancing capability
Carden, J. L.; Browner, R.
1982-01-01
The preparation and analysis of standardized waste samples for controlled ecological life support systems (CELSS) are considered. Analysis of samples from wet oxidation experiments, the development of ion chromatographic techniques utilizing conventional high pressure liquid chromatography (HPLC) equipment, and an investigation of techniques for interfacing an ion chromatograph (IC) with an inductively coupled plasma optical emission spectrometer (ICPOES) are discussed.
Directory of Open Access Journals (Sweden)
F. Raicich
2003-01-01
Full Text Available For the first time in the Mediterranean Sea various temperature sampling strategies are studied and compared to each other by means of the Observing System Simulation Experiment technique. Their usefulness in the framework of the Mediterranean Forecasting System (MFS is assessed by quantifying their impact in a Mediterranean General Circulation Model in numerical twin experiments via univariate data assimilation of temperature profiles in summer and winter conditions. Data assimilation is performed by means of the optimal interpolation algorithm implemented in the SOFA (System for Ocean Forecasting and Analysis code. The sampling strategies studied here include various combinations of eXpendable BathyThermograph (XBT profiles collected along Volunteer Observing Ship (VOS tracks, Airborne XBTs (AXBTs and sea surface temperatures. The actual sampling strategy adopted in the MFS Pilot Project during the Targeted Operational Period (TOP, winter-spring 2000 is also studied. The data impact is quantified by the error reduction relative to the free run. The most effective sampling strategies determine 25–40% error reduction, depending on the season, the geographic area and the depth range. A qualitative relationship can be recognized in terms of the spread of information from the data positions, between basin circulation features and spatial patterns of the error reduction fields, as a function of different spatial and seasonal characteristics of the dynamics. The largest error reductions are observed when samplings are characterized by extensive spatial coverages, as in the cases of AXBTs and the combination of XBTs and surface temperatures. The sampling strategy adopted during the TOP is characterized by little impact, as a consequence of a sampling frequency that is too low. Key words. Oceanography: general (marginal and semi-enclosed seas; numerical modelling
Directory of Open Access Journals (Sweden)
F. Raicich
Full Text Available For the first time in the Mediterranean Sea various temperature sampling strategies are studied and compared to each other by means of the Observing System Simulation Experiment technique. Their usefulness in the framework of the Mediterranean Forecasting System (MFS is assessed by quantifying their impact in a Mediterranean General Circulation Model in numerical twin experiments via univariate data assimilation of temperature profiles in summer and winter conditions. Data assimilation is performed by means of the optimal interpolation algorithm implemented in the SOFA (System for Ocean Forecasting and Analysis code. The sampling strategies studied here include various combinations of eXpendable BathyThermograph (XBT profiles collected along Volunteer Observing Ship (VOS tracks, Airborne XBTs (AXBTs and sea surface temperatures. The actual sampling strategy adopted in the MFS Pilot Project during the Targeted Operational Period (TOP, winter-spring 2000 is also studied.
The data impact is quantified by the error reduction relative to the free run. The most effective sampling strategies determine 25–40% error reduction, depending on the season, the geographic area and the depth range. A qualitative relationship can be recognized in terms of the spread of information from the data positions, between basin circulation features and spatial patterns of the error reduction fields, as a function of different spatial and seasonal characteristics of the dynamics. The largest error reductions are observed when samplings are characterized by extensive spatial coverages, as in the cases of AXBTs and the combination of XBTs and surface temperatures. The sampling strategy adopted during the TOP is characterized by little impact, as a consequence of a sampling frequency that is too low.
Key words. Oceanography: general (marginal and semi-enclosed seas; numerical modelling
International Nuclear Information System (INIS)
Schwendiman, L.C.; Glissmeyer, J.A.
1992-04-01
The 291-Z-1 and 296-Z-3 stack effluent particulate sampling and monitoring systems are being evaluated for compliance with Atlantic Richfield Hanford Company's Interim Criteria for such systems. This evaluation is part of a study by Battelle-Northwest of gaseous effluent sampling systems in ARHCO facilities. This letter report presents a preliminary evaluation of the mentioned facilities and the indicated improvements needed to meet the Interim Criteria so that conceptual design work for improved systems can be initiated. There is currently underway a detailed study at the two stacks including a series of sampling experiments, the findings of which will not be included in this report. The gaseous effluent sampling system at the 291-Z-1 and 296-Z-3 stacks are very dissimilar and will be treated in separate sections of this report. The discussions for each sampling system will include a brief description and a preliminary evaluation of the systems
Aerobot Sampling and Handling System, Phase I
National Aeronautics and Space Administration — Honeybee Robotics proposes to: ?Derive and document the functional and technical requirements for Aerobot surface sampling and sample handling across a range of...
Directory of Open Access Journals (Sweden)
TEMITOPE RAPHAEL AYODELE
2016-04-01
Full Text Available Monte Carlo simulation using Simple Random Sampling (SRS technique is popularly known for its ability to handle complex uncertainty problems. However, to produce a reasonable result, it requires huge sample size. This makes it to be computationally expensive, time consuming and unfit for online power system applications. In this article, the performance of Latin Hypercube Sampling (LHS technique is explored and compared with SRS in term of accuracy, robustness and speed for small signal stability application in a wind generator-connected power system. The analysis is performed using probabilistic techniques via eigenvalue analysis on two standard networks (Single Machine Infinite Bus and IEEE 16–machine 68 bus test system. The accuracy of the two sampling techniques is determined by comparing their different sample sizes with the IDEAL (conventional. The robustness is determined based on a significant variance reduction when the experiment is repeated 100 times with different sample sizes using the two sampling techniques in turn. Some of the results show that sample sizes generated from LHS for small signal stability application produces the same result as that of the IDEAL values starting from 100 sample size. This shows that about 100 sample size of random variable generated using LHS method is good enough to produce reasonable results for practical purpose in small signal stability application. It is also revealed that LHS has the least variance when the experiment is repeated 100 times compared to SRS techniques. This signifies the robustness of LHS over that of SRS techniques. 100 sample size of LHS produces the same result as that of the conventional method consisting of 50000 sample size. The reduced sample size required by LHS gives it computational speed advantage (about six times over the conventional method.
Policy Analysis Screening System (PASS) demonstration: sample queries and terminal instructions
Energy Technology Data Exchange (ETDEWEB)
None
1979-10-16
This document contains the input and output for the Policy Analysis Screening System (PASS) demonstration. This demonstration is stored on a portable disk at the Environmental Impacts Division. Sample queries presented here include: (1) how to use PASS; (2) estimated 1995 energy consumption from Mid-Range Energy-Forecasting System (MEFS) data base; (3) pollution projections from Strategic Environmental Assessment System (SEAS) data base; (4) diesel auto regulations; (5) diesel auto health effects; (6) oil shale health and safety measures; (7) water pollution effects of SRC; (8) acid rainfall from Energy Environmental Statistics (EES) data base; 1990 EIA electric generation by fuel type; sulfate concentrations by Federal region; forecast of 1995 SO/sub 2/ emissions in Region III; and estimated electrical generating capacity in California to 1990. The file name for each query is included.
The Effect of Pneumatic Tube Systems on the Hemolysis of Biochemistry Blood Samples.
Cakirca, Gokhan; Erdal, Huseyin
2017-05-01
Pneumatic tube systems (PTSs) are widely used in many hospitals because they lead to reduced turnaround times and cost efficiency. However, PTSs may affect the quality of the blood samples transported to the laboratory. The aim of this study was to investigate the effect of the PTS used in our hospital on the hemolysis of the biochemical blood samples transported to the laboratory. A total of 148 samples were manually transported to the laboratory by hospital staff, 148 samples were transported with the PTS, and 113 were transported with the PTS without use of sponge-rubber inserts (PTSws). Hemolysis rates and the levels of biochemical analytes for the different transportation methods were compared. No significant difference was found between the samples transported manually and with the PTS with regard to hemolysis rate and the levels of biochemical analytes. However, the samples transported with the PTSws showed a significant difference compared with the samples transported manually and with the PTS with regard to hemolysis rate and potassium and lactate dehydrogenase levels. The percentages of the samples that exceeded the permissible threshold for the hemolysis among the samples transported manually, with the PTS, and with the PTSws were 10%, 8%, and 47%, respectively. A PTS can be used safely for transporting biochemistry blood samples to the laboratory. However, a sponge-rubber insert that holds sample tubes must be used with the PTS to prevent the hemolysis of blood samples. Copyright © 2016 Emergency Nurses Association. Published by Elsevier Inc. All rights reserved.
The EnzymeTracker: an open-source laboratory information management system for sample tracking
Directory of Open Access Journals (Sweden)
Triplet Thomas
2012-01-01
Full Text Available Abstract Background In many laboratories, researchers store experimental data on their own workstation using spreadsheets. However, this approach poses a number of problems, ranging from sharing issues to inefficient data-mining. Standard spreadsheets are also error-prone, as data do not undergo any validation process. To overcome spreadsheets inherent limitations, a number of proprietary systems have been developed, which laboratories need to pay expensive license fees for. Those costs are usually prohibitive for most laboratories and prevent scientists from benefiting from more sophisticated data management systems. Results In this paper, we propose the EnzymeTracker, a web-based laboratory information management system for sample tracking, as an open-source and flexible alternative that aims at facilitating entry, mining and sharing of experimental biological data. The EnzymeTracker features online spreadsheets and tools for monitoring numerous experiments conducted by several collaborators to identify and characterize samples. It also provides libraries of shared data such as protocols, and administration tools for data access control using OpenID and user/team management. Our system relies on a database management system for efficient data indexing and management and a user-friendly AJAX interface that can be accessed over the Internet. The EnzymeTracker facilitates data entry by dynamically suggesting entries and providing smart data-mining tools to effectively retrieve data. Our system features a number of tools to visualize and annotate experimental data, and export highly customizable reports. It also supports QR matrix barcoding to facilitate sample tracking. Conclusions The EnzymeTracker was designed to be easy to use and offers many benefits over spreadsheets, thus presenting the characteristics required to facilitate acceptance by the scientific community. It has been successfully used for 20 months on a daily basis by over 50
Hollow-fiber membrane bioreactor for the treatment of high-strength landfill leachate
Rizkallah, Marwan
2013-07-15
Performance assessment of membrane bioreactor (MBR) technology for the treatability of high-strength landfill leachate is relatively limited or lacking. This study examines the feasibility of treating high-strength landfill leachate using a hollow-fiber MBR. For this purpose, a laboratory-scale MBR was constructed and operated to treat leachate with a chemical oxygen demand (COD) of 9000-11,000 mg/l, a 5-day biochemical oxygen demand (BOD5) of 4000-6,000 mg/l, volatile suspended solids (VSS) of 300-500 mg/l, total nitrogen (TN) of 2000-6000 mg/l, and an ammonia-nitrogen (NH3-N) of 1800-4000 mg/l. VSS was used with the BOD and COD data to simulate the biological activity in the activated sludge. Removal efficiencies > 95-99% for BOD5, VSS, TN and NH3-N were attained. The coupled experimental and simulation results contribute in filling a gap in managing high-strength landfill leachate and providing guidelines for corresponding MBR application. © The Author(s) 2013.
A dual slope charge sampling analog front-end for a wireless neural recording system.
Lee, Seung Bae; Lee, Byunghun; Gosselin, Benoit; Ghovanloo, Maysam
2014-01-01
This paper presents a novel dual slope charge sampling (DSCS) analog front-end (AFE) architecture, which amplifies neural signals by taking advantage of the charge sampling concept for analog signal conditioning, such as amplification and filtering. The presented DSCS-AFE achieves amplification, filtering, and sampling in a simultaneous fashion, while consuming very small amount of power. The output of the DSCS-AFE produces a pulse width modulated (PWM) signal that is proportional to the input voltage amplitude. A circular shift register (CSR) utilizes time division multiplexing (TDM) of the PWM pulses to create a pseudo-digital TDM-PWM signal that can feed a wireless transmitter. The 8-channel system-on-a-chip was fabricated in a 0.35-μm CMOS process, occupying 2.4 × 2.1 mm(2) and consuming 255 μW from a 1.8V supply. Measured input-referred noise for the entire system, including the FPGA in order to recover PWM signal is 6.50 μV(rms) in the 288 Hz~10 kHz range. For each channel, sampling rate is 31.25 kHz, and power consumption is 31.8 μW.
The Behavior of Corrosion Products in Sampling Systems under Boiling Water Reactor Conditions
Energy Technology Data Exchange (ETDEWEB)
Hermansson, Hans-Peter
1977-08-15
A high pressure loop has been used to simulate sampling systems employed under BWR conditions. The reliability of the sampling method was studied in a series of six test runs. A variety of parameters that are thought to influence the reliability of the sampling was investigated. These included piping geometry, water oxygen content, flow, temperature and temperature gradients. Amongst other things the results indicate that the loss by deposition of iron containing corrosion products does not exceed 50 %; this figure is only influenced to a minor extent by the above mentioned parameters. The major part of the corrosion products thus deposited is found along the first few meters of the piping and cooler coil. A moderate prolongation of a pipe which is already relatively long should thus be incapable of producing a major influence on the sampling error
Energy Technology Data Exchange (ETDEWEB)
LOCKREM, L.L.
1999-08-13
This data package presents sampling data and analytical results from the March 28, 1999, vapor sampling of Hanford Site single-shell tank 241-C-106 during active sluicing. Samples were obtained from the 296-C-006 ventilation system stack and ambient air at several locations. Characterization Project Operations (CPO) was responsible for the collection of all SUMMATM canister samples. The Special Analytical Support (SAS) vapor team was responsible for the collection of all triple sorbent trap (TST), sorbent tube train (STT), polyurethane foam (PUF), and particulate filter samples collected at the 296-C-006 stack. The SAS vapor team used the non-electrical vapor sampling (NEVS) system to collect samples of the air, gases, and vapors from the 296-C-006 stack. The SAS vapor team collected and analyzed these samples for Lockheed Martin Hanford Corporation (LMHC) and Tank Waste Remediation System (TWRS) in accordance with the sampling and analytical requirements specified in the Waste Retrieval Sluicing System Vapor Sampling and Analysis Plan (SAP) for Evaluation of Organic Emissions, Process Test Phase III, HNF-4212, Rev. 0-A, (LMHC, 1999). All samples were stored in a secured Radioactive Materials Area (RMA) until the samples were radiologically released and received by SAS for analysis. The Waste Sampling and Characterization Facility (WSCF) performed the radiological analyses. The samples were received on April 5, 1999.
Energy Technology Data Exchange (ETDEWEB)
Welker, T.F.
1997-07-01
The quality of gas has changed drastically in the past few years. Most gas is wet with hydrocarbons, water, and heavier contaminants that tend to condense if not handled properly. If a gas stream is contaminated with condensables, the sampling of that stream must be done in a manner that will ensure all of the components in the stream are introduced into the sample container as the composite. The sampling and handling of wet gas is extremely difficult under ideal conditions. There are no ideal conditions in the real world. The problems related to offshore operations and other wet gas systems, as well as the transportation of the sample, are additional problems that must be overcome if the analysis is to mean anything to the producer and gatherer. The sampling of wet gas systems is decidedly more difficult than sampling conventional dry gas systems. Wet gas systems were generally going to result in the measurement of one heating value at the inlet of the pipe and a drastic reduction in the heating value of the gas at the outlet end of the system. This is caused by the fallout or accumulation of the heavier products that, at the inlet, may be in the vapor state in the pipeline; hence, the high gravity and high BTU. But, in fact, because of pressure and temperature variances, these liquids condense and form a liquid that is actually running down the pipe as a stream or is accumulated in drips to be blown from the system. (author)
High efficiency mixed species radioiodine air sampling, readout, and dose assessment system
International Nuclear Information System (INIS)
Distenfeld, C.; Klemish, J.
1976-05-01
Reactor accidents require monitoring to assess the impact to persons in the environment. This implies methods and apparatus to accurately and economically sample and evaluate possible released activity. The development of a prototype iodine air sampling system that can differentiate against noble gas activity and be evaluated by standard Civil Defense instrumentation is reported. The apparatus can efficiently (95 percent) collect organic or inorganic, particulate or gaseous radioiodine in concentrations below stable atmospheric iodine, and under severe ambient conditions. Response to noble fission gases was reduced to less than 4 x 10 -4 of an equal iodine airborne activity by heating the collector to approximately 100 0 C. Reliable sample size, +-5 percent, was achieved by using a simple air flow regulator. Thyroid dose commitment was mathematically and graphically related to the iodine isotope distribution expected in the environment and to the response of the Civil Defense CDV-700 instrument used to evaluate the sample. Sensitivity of the method allows dose assessment of 1 to 2 rads to a child's thyroid
A data acquisition system for indentification of 90Sr/ 90Y in environmental samples
International Nuclear Information System (INIS)
Medin, G.; Brajnik, D.; Starcic, M.; Stanovnik, A.
1996-01-01
Often, in the stage of research and development of new techniques for detection of ionizing radiation, elaborate electronic systems are required. In this paper, we describe the relatively complex detector and electronic system used for a relatively simple but nevertheless demanding measurement of the beta emitting radionuclides 90 Sr/ 90 Y in environmental samples. The detection limit of 1 Bq in a thin, disc-shaped sample, was obtained by careful elimination of background. Contribution of other radionuclides in the sample, were eliminated or at least considerably reduced by using a silica aerogel as Cherenkov radiator and thin multiwire chamber in coincidence. Cosmic ray signals were reduced by large scintillation counters in anticoincidence. Finally, persisting RF pick-up signals were eliminated by using the signal from a wire antenna and identical MWPC preamplifier and discriminator for a veto to the master coincidence. For each accepted event, both timing and pulse height information was recorded with a personal computer
Pereira, L S F; Pedrotti, M F; Vecchia, P Dalla; Pereira, J S F; Flores, E M M
2018-06-20
A simple and automated system based on combustion followed by a pyrohydrolysis reaction was proposed for further halogens determination. This system was applied for digestion of soils containing high (90%) and also low (10%) organic matter content for further halogens determination. The following parameters were evaluated: sample mass, use of microcrystalline cellulose and heating time. For analytes absorption, a diluted alkaline solution (6 mL of 25 mmol L -1 NH 4 OH) was used in all experiments. Up to 400 mg of soil with high organic matter content and 100 mg of soil with low organic matter content (mixed with 400 mg of cellulose) could be completely digested using the proposed system. Quantitative results for all halogens were obtained using less than 12 min of sample preparation step (about 1.8 min for sample combustion and 10 min for pyrohydrolysis). The accuracy was evaluated using a certified reference material of coal and spiked samples. No statistical difference was observed between the certified values and results obtained by the proposed method. Additionally, the recoveries obtained using spiked samples were in the range of 98-103% with relative standard deviation values lower than 5%. The limits of quantification obtained for F, Cl, Br and I for soil with high (400 mg of soil) and low (100 mg of soil) organic matter were in the range of 0.01-2 μg g -1 and 0.07-59 μg g -1 , respectively. The proposed system was considered as a simple and suitable alternative for soils digestion for further halogens determination by ion chromatography and inductively coupled plasma mass spectrometry techniques. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Zio, E.; Pedroni, N.
2010-01-01
The quantitative reliability assessment of a thermal-hydraulic (T-H) passive safety system of a nuclear power plant can be obtained by (i) Monte Carlo (MC) sampling the uncertainties of the system model and parameters, (ii) computing, for each sample, the system response by a mechanistic T-H code and (iii) comparing the system response with pre-established safety thresholds, which define the success or failure of the safety function. The computational effort involved can be prohibitive because of the large number of (typically long) T-H code simulations that must be performed (one for each sample) for the statistical estimation of the probability of success or failure. In this work, Line Sampling (LS) is adopted for efficient MC sampling. In the LS method, an 'important direction' pointing towards the failure domain of interest is determined and a number of conditional one-dimensional problems are solved along such direction; this allows for a significant reduction of the variance of the failure probability estimator, with respect, for example, to standard random sampling. Two issues are still open with respect to LS: first, the method relies on the determination of the 'important direction', which requires additional runs of the T-H code; second, although the method has been shown to improve the computational efficiency by reducing the variance of the failure probability estimator, no evidence has been given yet that accurate and precise failure probability estimates can be obtained with a number of samples reduced to below a few hundreds, which may be required in case of long-running models. The work presented in this paper addresses the first issue by (i) quantitatively comparing the efficiency of the methods proposed in the literature to determine the LS important direction; (ii) employing artificial neural network (ANN) regression models as fast-running surrogates of the original, long-running T-H code to reduce the computational cost associated to the
National Aeronautics and Space Administration — Global Navigation Satellite System (GNSS) daily 30-second sampled data available from the Crustal Dynamics Data Information System (CDDIS). Global Navigation...
Nachman, Paul; Pinnick, R. G.; Hill, Steven C.; Chen, Gang; Chang, Richard K.; Mayo, Michael W.; Fernandez, Gilbert L.
1996-03-01
We report the design and operation of a prototype conditional-sampling spectrograph detection system that can record the fluorescence spectra of individual, micrometer-sized aerosols as they traverse an intense 488-nm intracavity laser beam. The instrument's image-intensified CCD detector is gated by elastic scattering or by undispersed fluorescence from particles that enter the spectrograph's field of view. It records spectra only from particles with preselected scattering-fluorescence levels (a fiber-optic-photomultiplier subsystem provides the gating signal). This conditional-sampling procedure reduces data-handling rates and increases the signal-to-noise ratio by restricting the system's exposures to brief periods when aerosols traverse the beam. We demonstrate these advantages by reliably capturing spectra from individual fluorescent microspheres dispersed in an airstream. The conditional-sampling procedure also permits some discrimination among different types of particles, so that spectra may be recorded from the few interesting particles present in a cloud of background aerosol. We demonstrate such discrimination by measuring spectra from selected fluorescent microspheres in a mixture of two types of microspheres, and from bacterial spores in a mixture of spores and nonfluorescent kaolin particles.
Directory of Open Access Journals (Sweden)
S. E. Brown
2018-03-01
Full Text Available Nitrous oxide (N2O fluxes measured using the eddy-covariance method capture the spatial and temporal heterogeneity of N2O emissions. Most closed-path trace-gas analyzers for eddy-covariance measurements have large-volume, multi-pass absorption cells that necessitate high flow rates for ample frequency response, thus requiring high-power sample pumps. Other sampling system components, including rain caps, filters, dryers, and tubing, can also degrade system frequency response. This field trial tested the performance of a closed-path eddy-covariance system for N2O flux measurements with improvements to use less power while maintaining the frequency response. The new system consists of a thermoelectrically cooled tunable diode laser absorption spectrometer configured to measure both N2O and carbon dioxide (CO2. The system features a relatively small, single-pass sample cell (200 mL that provides good frequency response with a lower-powered pump ( ∼ 250 W. A new filterless intake removes particulates from the sample air stream with no additional mixing volume that could degrade frequency response. A single-tube dryer removes water vapour from the sample to avoid the need for density or spectroscopic corrections, while maintaining frequency response. This eddy-covariance system was collocated with a previous tunable diode laser absorption spectrometer model to compare N2O and CO2 flux measurements for two full growing seasons (May 2015 to October 2016 in a fertilized cornfield in Southern Ontario, Canada. Both spectrometers were placed outdoors at the base of the sampling tower, demonstrating ruggedness for a range of environmental conditions (minimum to maximum daily temperature range: −26.1 to 31.6 °C. The new system rarely required maintenance. An in situ frequency-response test demonstrated that the cutoff frequency of the new system was better than the old system (3.5 Hz compared to 2.30 Hz and similar to that of a closed
Brown, Shannon E.; Sargent, Steve; Wagner-Riddle, Claudia
2018-03-01
Nitrous oxide (N2O) fluxes measured using the eddy-covariance method capture the spatial and temporal heterogeneity of N2O emissions. Most closed-path trace-gas analyzers for eddy-covariance measurements have large-volume, multi-pass absorption cells that necessitate high flow rates for ample frequency response, thus requiring high-power sample pumps. Other sampling system components, including rain caps, filters, dryers, and tubing, can also degrade system frequency response. This field trial tested the performance of a closed-path eddy-covariance system for N2O flux measurements with improvements to use less power while maintaining the frequency response. The new system consists of a thermoelectrically cooled tunable diode laser absorption spectrometer configured to measure both N2O and carbon dioxide (CO2). The system features a relatively small, single-pass sample cell (200 mL) that provides good frequency response with a lower-powered pump ( ˜ 250 W). A new filterless intake removes particulates from the sample air stream with no additional mixing volume that could degrade frequency response. A single-tube dryer removes water vapour from the sample to avoid the need for density or spectroscopic corrections, while maintaining frequency response. This eddy-covariance system was collocated with a previous tunable diode laser absorption spectrometer model to compare N2O and CO2 flux measurements for two full growing seasons (May 2015 to October 2016) in a fertilized cornfield in Southern Ontario, Canada. Both spectrometers were placed outdoors at the base of the sampling tower, demonstrating ruggedness for a range of environmental conditions (minimum to maximum daily temperature range: -26.1 to 31.6 °C). The new system rarely required maintenance. An in situ frequency-response test demonstrated that the cutoff frequency of the new system was better than the old system (3.5 Hz compared to 2.30 Hz) and similar to that of a closed-path CO2 eddy-covariance system (4
International Nuclear Information System (INIS)
Williams, R.E.
1981-07-01
A pneumatic sample-transfer system is needed to be able to rapidly retrieve samples irradiated with 14-MeV neutrons at the Rotating Target Neutron Source (RTNS-I). The rabbit system, already in place for many years, has been refurbished with modern system components controlled by an LSI-11 minicomputer. Samples can now be counted three seconds after an irradiation. There are many uses for this expanded 14-MeV neutron activation capability. Several fission products difficult to isolate from mixed fission fragments can be produced instead through (n,p) or (n,α) reactions with stable isotopes. Mass-separated samples of Nd, Mo, and Se, for example, can be irradiated to produce Pr, Nb, and As radionuclides sufficient for decay scheme studies. The system may also be used for multielement fast-neutron activation analysis because the neutron flux is greater than 2 x 10 11 n/cm 2 -sec. Single element analyses of Si and O are also possible. Finally, measurements of fast-neutron cross sections producing short-lived activation products can be performed with this system. A description of the rabbit system and instructions for its use are presented in this report
System and method for laser assisted sample transfer to solution for chemical analysis
Van Berkel, Gary J; Kertesz, Vilmos
2014-01-28
A system and method for laser desorption of an analyte from a specimen and capturing of the analyte in a suspended solvent to form a testing solution are described. The method can include providing a specimen supported by a desorption region of a specimen stage and desorbing an analyte from a target site of the specimen with a laser beam centered at a radiation wavelength (.lamda.). The desorption region is transparent to the radiation wavelength (.lamda.) and the sampling probe and a laser source emitting the laser beam are on opposite sides of a primary surface of the specimen stage. The system can also be arranged where the laser source and the sampling probe are on the same side of a primary surface of the specimen stage. The testing solution can then be analyzed using an analytical instrument or undergo further processing.
An Inductively-Powered Wireless Neural Recording System with a Charge Sampling Analog Front-End.
Lee, Seung Bae; Lee, Byunghun; Kiani, Mehdi; Mahmoudi, Babak; Gross, Robert; Ghovanloo, Maysam
2016-01-15
An inductively-powered wireless integrated neural recording system (WINeR-7) is presented for wireless and battery less neural recording from freely-behaving animal subjects inside a wirelessly-powered standard homecage. The WINeR-7 system employs a novel wide-swing dual slope charge sampling (DSCS) analog front-end (AFE) architecture, which performs amplification, filtering, sampling, and analog-to-time conversion (ATC) with minimal interference and small amount of power. The output of the DSCS-AFE produces a pseudo-digital pulse width modulated (PWM) signal. A circular shift register (CSR) time division multiplexes (TDM) the PWM pulses to create a TDM-PWM signal, which is fed into an on-chip 915 MHz transmitter (Tx). The AFE and Tx are supplied at 1.8 V and 4.2 V, respectively, by a power management block, which includes a high efficiency active rectifier and automatic resonance tuning (ART), operating at 13.56 MHz. The 8-ch system-on-a-chip (SoC) was fabricated in a 0.35-μm CMOS process, occupying 5.0 × 2.5 mm 2 and consumed 51.4 mW. For each channel, the sampling rate is 21.48 kHz and the power consumption is 19.3 μW. In vivo experiments were conducted on freely behaving rats in an energized homecage by continuously delivering 51.4 mW to the WINeR-7 system in a closed-loop fashion and recording local field potentials (LFP).
Sampling rare events in nonequilibrium and nonstationary systems.
Berryman, Joshua T; Schilling, Tanja
2010-12-28
Although many computational methods for rare event sampling exist, this type of calculation is not usually practical for general nonequilibrium conditions, with macroscopically irreversible dynamics and away from both stationary and metastable states. A novel method for calculating the time-series of the probability of a rare event is presented which is designed for these conditions. The method is validated for the cases of the Glauber-Ising model under time-varying shear flow, the Kawasaki-Ising model after a quench into the region between nucleation dominated and spinodal decomposition dominated phase change dynamics, and the parallel open asymmetric exclusion process. The method requires a subdivision of the phase space of the system: it is benchmarked and found to scale well for increasingly fine subdivisions, meaning that it can be applied without detailed foreknowledge of the physically important reaction pathways.
Wang, Dongbo; Zhao, Jianwei; Zeng, Guangming; Chen, Yinguang; Bond, Philip L; Li, Xiaoming
2015-10-20
Recent studies demonstrate that, besides being used for production of biodegradable plastics, poly(hydroxyalkanoate) (PHA) that is accumulated in heterotrophic microorganisms during wastewater treatment has another novel application direction, i.e., being utilized for enhancing methane yield during the anaerobic digestion of waste-activated sludge (WAS). To date, however, the underlying mechanism of how PHA affects methane production remains largely unknown, and this limits optimization and application of the strategy. This study therefore aims to fill this knowledge gap. Experimental results showed that with the increase of sludge PHA levels from 21 to 184 mg/g of volatile suspended solids (VSS) the methane yield linearly increased from 168.0 to 246.1 mL/g of VSS (R(2) = 0.9834). Compared with protein and carbohydrate (the main components of a cell), PHA exhibited a higher biochemical methane potential on a unit VSS basis. It was also found that the increased PHA not only enhanced cell disruption of PHA cells but also benefited the soluble protein conversion of both PHA- and non-PHA cells. Moreover, the reactor fed with higher PHA sludge showed greater sludge hydrolysis and acidification than those fed with the lower PHA sludges. Further investigations using fluorescence in situ hybridization and enzyme analysis revealed that the increased PHA enhanced the abundance of methanogenic Archaea and increased the activities of protease, acetate kinase, and coenzyme F420, which were consistent with the observed methane yield. This work provides insights into PHA-involved WAS digestion systems and may have important implications for future operation of wastewater treatment plants.
Seibel, C; Fieback, T M
2015-09-01
For thermogravimetric analysis, it has been shown that, depending on the type of sample container, different kinetic results could be obtained despite regarding the same reaction under constant conditions. This is due to limiting macrokinetic effects which are strongly dependant on the type of sample carrying system. This prompted the need for sample containers which deliver results minimally limited by diffusive mass transport. In this way, two container systems were developed, both characterized by a forced flow stream through a solid, porous bed: one from bottom to top (counter-current flow) and one from top to bottom (co-current flow). Optical test measurements were performed, the results indicating that reaction proceedings are almost fully independent of the geometrical shape of the sample containers. The Boudouard reaction was investigated with a standard crucible and the new developed systems; the reaction rates determined differed significantly, up to a factor of 6.2 at 1373 K.
Garzón-Zúñiga, M A; Buelna, G
2011-01-01
Based on results obtained in the laboratory a WWTP composed of a septic tank and an aerated percolating filter packed with organic media was built for a school. The system can treat 18 m3 d(-1) and was operated with a hydraulic loading rate of 0.078 (m3 m(-2) d(-1). For 360 days different operational conditions including start-up; stabilization; operation with aeration and non aeration; effect of rainy season, breaks from activities due to holidays and restart; were monitored and described in the article. Once stabilized, the system was able to remove, without the need for mechanical aeration, 97% of BOD5, 71% of COD, 93% of TKN, 11% of PO(4-)-P, 95% of TSS, 96% of VSS, in addition to having a removal efficiency of 4 log units of Faecal Coliforms (FC) and 100% helminthes eggs (HE). With this quality, the treated wastewater can be chlorinated and reused to irrigate green areas and/or in toilets. Although sanitary wastewater has a high concentration of Total-N (250 mg L(-1)) and a C/N ratio of less than 1, the system removed 65% of Total-N. Finally it was observed that after non activity periods, there was neither system failure nor the need to re-stabilize the system.
International Nuclear Information System (INIS)
Dyekman, D.L.
1998-01-01
The Washington State Department of Ecology (Ecology) approved the construction and operation of Rotary Mode Core Sampling (RMCS) System Two on November 22, 1993 (NOC-93-04). This approval supported the characterization of waste in the single-shell tanks (SSTS) and double-shell tanks (DSTS) on the Hanford Site. The waste tank characterization sampling and analysis effort is vital to the safe operations of the Hanford Site tank farms, and the timely collection of the information necessary to support retrieval, pretreatment, disposal planning, and final closure strategy. This is based on the Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 93-05 Implementation Plan (DOE-RL-94-001), US Department of Energy, Richland Operations Office (DOE-RL) proposed the expedited construction and operation of two additional RMCS systems to support characterization of waste stored in SSTs and DSTS. RMCS currently is scheduled for approximately 50 (active or passively ventilated) of the 149 SSTs in the 200 East and 200 West Areas. If necessary, the RMCS will be used to sample other tanks currently not scheduled, subject to the requirements of this document and any applicable Ecology approval order. The typical components of the RMCS systems are shown in Figure 1. It should be noted that the Flammable Gas Detector cart is not being used during RMCS at this time. RMCS is scheduled for approximately 40 tanks that are not actively ventilated. These tanks operate at atmospheric pressure with passive (breather) high-efficiency particulate air (HEPA) filters. The RMCS system uses nitrogen gas to cool and purge the drill bit assembly. Without the use of a portable ventilation system, the additional gas from RMCS might unsafely pressurize tanks that are not actively ventilated. The RMCS system also will generate aerosols and dust in the tank vapor head space. HEPA filters will be required on the portable exhauster during rotary mode core drilling to control radionuclide
Heemels, W.P.M.H.; Teel, A.R.; Wouw, van de N.; Nesic, D.
2010-01-01
There are many communication imperfections in networked control systems (NCS) such as varying transmission delays, varying sampling/transmission intervals, packet loss, communication constraints and quantization effects. Most of the available literature on NCS focuses on only some of these aspects,
Xiao, Ning-Cong; Li, Yan-Feng; Wang, Zhonglai; Peng, Weiwen; Huang, Hong-Zhong
2013-01-01
In this paper the combinations of maximum entropy method and Bayesian inference for reliability assessment of deteriorating system is proposed. Due to various uncertainties, less data and incomplete information, system parameters usually cannot be determined precisely. These uncertainty parameters can be modeled by fuzzy sets theory and the Bayesian inference which have been proved to be useful for deteriorating systems under small sample sizes. The maximum entropy approach can be used to cal...
International Nuclear Information System (INIS)
Beardsley, C.C.
1999-01-01
As part of the demonstration testing of the Purge Water Management System (PWMS) technology at the Savannah River Site (SRS), four wells were equipped with PWMS units in 1997 and a series of sampling events were conducted at each during 1997-1998. Three of the wells were located in A/M Area while the fourth was located at the Old Radioactive Waste Burial Ground in the General Separations Area.The PWMS is a ''closed-loop'', non-contact, system used to collect and return purge water to the originating aquifer after a sampling event without having significantly altered the water quality. One of the primary concerns as to its applicability at SRS, and elsewhere, is whether the PWMS might resample groundwater that is returned to the aquifer during the previous sampling event. The purpose of the present investigation was to compare groundwater chemical analysis data collected at the four test wells using the PWMS vs. historical data collected using the standard monitoring program methodology to determine if the PWMS provides representative monitoring samples.The analysis of the groundwater chemical concentrations indicates that the PWMS sampling methodology acquired representative groundwater samples at monitoring wells ABP-1A, ABP-4, ARP-3 and BGO-33C. Representative groundwater samples are achieved if the PWMS does not resample groundwater that has been purged and returned during a previous sampling event. Initial screening calculations, conducted prior to the selection of these four wells, indicated that groundwater velocities were high enough under the ambient hydraulic gradients to preclude resampling from occurring at the time intervals that were used at each well. Corroborating evidence included a tracer test that was conducted at BGO-33C, the high degree of similarity between analyte concentrations derived from the PWMS samples and those obtained from historical protocol sampling, as well as the fact that PWMS data extend all previously existing concentration
Soares, Ana; Kampas, Pantelis; Maillard, Sarah; Wood, Elizabeth; Brigg, Jon; Tillotson, Martin; Parsons, Simon A; Cartmell, Elise
2010-03-15
There is a need to investigate processes that enable sludge re-use while enhancing sewage treatment efficiency. Mechanically disintegrated thickened surplus activated sludge (SAS) and fermented primary sludge were compared for their capacity to produce a carbon source suitable for BNR by completing nutrient removal predictive tests. Mechanically disintegration of SAS using a deflaker enhanced volatile fatty acids (VFAs) content from 92 to 374 mg l(-1) (4.1-fold increase). In comparison, primary sludge fermentation increased the VFAs content from 3.5 g l(-1) to a final concentration of 8.7 g l(-1) (2.5-fold increase). The carbon source obtained from disintegration and fermentation treatments improved phosphate (PO(4)-P) release and denitrification by up to 0.04 mg NO(3)-Ng(-1)VSS min(-1) and 0.031 mg PO(4)-Pg(-1)VSS min(-1), respectively, in comparison to acetate (0.023 mg NO(3)-Ng(-1)VSS min(-1)and 0.010 mg PO(4)-Pg(-1)VSS min(-1)). Overall, both types of sludge were suitable for BNR but disintegrated SAS displayed lower carbon to nutrient ratios of 8 for SCOD:PO(4)-P and 9 for SCOD:NO(3)-N. On the other hand, SAS increased the concentration of PO(4)-P in the settled sewage by a further 0.97 g PO(4)-P kg(-1)SCOD indicating its potential negative impact towards nutrient recycling in the BNR process. (c) 2009 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Kanlayanee Meesap
2012-01-01
Full Text Available The anaerobic hybrid reactor consisting of sludge and packed zones was operated with organic pollutant loading rates from 6.2 to 8.2 g COD/L day, composed mainly of suspended solids (SS and oil and grease (O&G concentrations between 5.2 to 10.2 and 0.9 to 1.9 g/L, respectively. The overall process performance in terms of chemical oxygen demands (COD, SS, and O&G removals was 73, 63, and 56%, respectively. When the organic pollutant concentrations were increased, the resultant methane potentials were higher, and the methane yield increased to 0.30 L CH4/g CODremoved. It was observed these effects on the microbial population and activity in the sludge and packed zones. The eubacterial population and activity in the sludge zone increased to 6.4 × 109 copies rDNA/g VSS and 1.65 g COD/g VSS day, respectively, whereas those in the packed zone were lower. The predominant hydrolytic and fermentative bacteria were Pseudomonas, Clostridium, and Bacteroidetes. In addition, the archaeal population and activity in the packed zone were increased from to 9.1 × 107 copies rDNA/g VSS and 0.34 g COD-CH4/g VSS day, respectively, whereas those in the sludge zone were not much changed. The most represented species of methanogens were the acetoclastic Methanosaeta, the hydrogenotrophic Methanobacterium sp., and the hydrogenotrophic Methanomicrobiaceae.
International Nuclear Information System (INIS)
Kim, Young-Hoon; Kim, Dong Gyu; Han, Jung Ho; Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo; Park, Jeong-Hoon; Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee; Kim, Chae-Yong; Paek, Sun Ha; Jung, Hee-Won
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 ± 0.03 cm 3 (range, 0.03-1.00 cm 3 ), and the mean marginal dose was 12.2 ± 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of ≥20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average ≥20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
Mitchell, Eugene E., Ed.
The simulation of a sampled-data system is described that uses a full parallel hybrid computer. The sampled data system simulated illustrates the proportional-integral-derivative (PID) discrete control of a continuous second-order process representing a stirred-tank. The stirred-tank is simulated using continuous analog components, while PID…
International Nuclear Information System (INIS)
Ravishankar, R.; Bandyopadhyay, T.; Sarkar, P.K.
2011-01-01
Particle Accelerators are becoming part of the society with more and more medical and Industrial types are added every year in addition to research type of accelerators. The outflow of materials to the public domain from such accelerator facilities need to checked carefully and must be released after ensuring the activities of such materials should not exceed the regulatory limits. Health Physics Unit, VECC is involved in analyzing food product samples, seized samples which are suspected to contain Uranium etc and other environmental samples in addition to analyzing radioactive materials evolved from Operational Health Physics work. Most of these analyses involve γ Spectrometric Systems of high efficiency and high resolution types. The efficacy of the analysis and results depends on various parameters of the spectrometric system. The electrical noise from the power supply system and other noises picked up, even in the range of a few milli volts range, have been found to affect the stability of the system. These effects may not be present initially during installation but may creep in due course due to various reasons including weather conditions, wear and tear etc. Unless these problems are attended in regular intervals, the stability of the spectrometric systems and hence the results of analysis of the low active and environmental samples, will not be satisfactory. The work describes the practical problems faced by Health Physics Unit, the methods employed in identifying the problems, the necessary remedial measures taken, the final outcome in the stability and the procedures framed in order to avoid in future. (author)
The search for and analysis of direct samples of early Solar System aqueous fluids.
Zolensky, Michael E; Bodnar, Robert J; Yurimoto, Hisayoshi; Itoh, Shoichi; Fries, Marc; Steele, Andrew; Chan, Queenie H-S; Tsuchiyama, Akira; Kebukawa, Yoko; Ito, Motoo
2017-05-28
We describe the current state of the search for direct, surviving samples of early, inner Solar System fluids-fluid inclusions in meteorites. Meteoritic aqueous fluid inclusions are not rare, but they are very tiny and their characterization is at the state of the art for most analytical techniques. Meteoritic fluid inclusions offer us a unique opportunity to study early Solar System brines in the laboratory. Inclusion-by-inclusion analyses of the trapped fluids in carefully selected samples will, in the immediate future, provide us detailed information on the evolution of fluids as they interacted with anhydrous solid materials. Thus, real data can replace calculated fluid compositions in thermochemical calculations of the evolution of water and aqueous reactions in comets, asteroids, moons and the terrestrial planets.This article is part of the themed issue 'The origin, history and role of water in the evolution of the inner Solar System'. © 2017 The Author(s).
Energy Technology Data Exchange (ETDEWEB)
Fradin, J.
1958-12-03
This report presents a system aimed at sampling active solution from a specific transport container (SCRGR model) while transferring this solution with a maximum safety. The sampling principle is described (a flexible tube connected to the receiving container, with a needle at the other end which goes through a rubber membrane and enters a plunger tube). Its benefits are outlined (operator protection, reduction of contamination risk; only the rubber membrane is removed and replaced). Some manufacturing details are described concerning the membrane and the cover.
A flexible system to capture sample vials in a storage box - the box vial scanner.
Nowakowski, Steven E; Kressin, Kenneth R; Deick, Steven D
2009-01-01
Tracking sample vials in a research environment is a critical task and doing so efficiently can have a large impact on productivity, especially in high volume laboratories. There are several challenges to automating the capture process, including the variety of containers used to store samples. We developed a fast and robust system to capture the location of sample vials being placed in storage that allows the laboratories the flexibility to use sample containers of varying dimensions. With a single scan, this device captures the box identifier, the vial identifier and the location of each vial within a freezer storage box. The sample vials are tracked through a barcode label affixed to the cap while the boxes are tracked by a barcode label on the side of the box. Scanning units are placed at the point of use and forward data to a sever application for processing the scanned data. Scanning units consist of an industrial barcode reader mounted in a fixture positioning the box for scanning and providing lighting during the scan. The server application transforms the scan data into a list of storage locations holding vial identifiers. The list is then transferred to the laboratory database. The box vial scanner captures the IDs and location information for an entire box of sample vials into the laboratory database in a single scan. The system accommodates a wide variety of vials sizes by inserting risers under the sample box and a variety of storage box layouts are supported via the processing algorithm on the server.
Pitard, Francis F
1993-01-01
Pierre Gy's Sampling Theory and Sampling Practice, Second Edition is a concise, step-by-step guide for process variability management and methods. Updated and expanded, this new edition provides a comprehensive study of heterogeneity, covering the basic principles of sampling theory and its various applications. It presents many practical examples to allow readers to select appropriate sampling protocols and assess the validity of sampling protocols from others. The variability of dynamic process streams using variography is discussed to help bridge sampling theory with statistical process control. Many descriptions of good sampling devices, as well as descriptions of poor ones, are featured to educate readers on what to look for when purchasing sampling systems. The book uses its accessible, tutorial style to focus on professional selection and use of methods. The book will be a valuable guide for mineral processing engineers; metallurgists; geologists; miners; chemists; environmental scientists; and practit...
Lin, Wen; Hong, Jin-Liern; Shen, Guoxiang; Wu, Rachel T.; Wu, Yuwen; Huang, Mou-Tuan; Newmark, Harold L.; Huang, Qingrong; Khor, Tin Oo; Heimbach, Tycho; Kong, Ah-Ng
2010-01-01
The pharmacokinetic disposition of a dietary cancer chemopreventive compound dibenzoylmethane (DBM) was studied in male Sprague-Dawley rats after intravenous (i.v.) and oral (p.o.) administrations. Following a single i.v. bolus dose, the mean plasma clearance (CL) of DBM was low as compared to the hepatic blood flow. DBM displayed a high volume of distribution (Vss). The elimination terminal t1/2 was long. The mean CL, Vss and AUC0-∞/dose were similar between the i.v. 10 and 10 mg/kg doses. A...
Operability test procedure for the Rotary Mode Core Sampling System Exhausters 3 and 4
International Nuclear Information System (INIS)
WSaldo, E.J.
1995-01-01
This document provides a procedure for performing operability testing of the Rotary Mode Core Sampling System Exhausters 3 ampersand 4. Upon completion of testing activities an operability testing report will be issued
Design of modified annulus air sampling system for the detection of leakage in waste transfer line
International Nuclear Information System (INIS)
Deokar, U.V; Khot, A.R.; Mathew, P.; Ganesh, G.; Tripathi, R.M.; Srivastava, Srishti
2018-01-01
Various liquid waste streams are generated during the operation of reprocessing plant. The High Level (HL), Intermediate Level (IL) and Low Level (LL) liquid wastes generated, are transferred from reprocessing plant to Waste Management Facility. These respective waste streams are transferred through pipe-in-pipe lines along the shielded concrete trench. For detection of radioactive leakage from primary waste transfer line into secondary line, sampling of the annulus air between the two pipes is carried out. The currently installed pressurized annulus air sampling system did not have online leakage detection provision. Hence, there are chances of personal exposure and airborne activity in the working area. To overcome these design flaws, free air flow modified online annulus air sampling system with more safety features is designed
International Nuclear Information System (INIS)
Rivero Jimenez, Rene A; Merlin Linares, Julio C; Blanco de Armas, Madelin; Navea Leyva, Leonor M
2009-01-01
Hepatitis C virus (CHV) blood-transmission is a health problem in Cuba and in the world. Some types of diagnostic immunoassays have been developed for the blood certification and in general have a high diagnostic sensitivity and specificity in healthy donors. However, its behavior in samples from multi-transfusion patients could by less effective. To assess the diagnostic effectiveness of the UMELISA HCV third generation Cuban immunoassay (TecnoSUMA, S.A. La Habana), Cuba) in samples from multi-transfusion patients, in parallel, 335 sera from patients were processed by UBI HCV EIA 4.0 (United Biomedical, EE.UU) and UMELISA HCV third generation, and the samples with incongruous results were verified by PCR COBAS AmpliScreen HCV Test, v2 system (Roche, EE.UU.) Comparing the UMELISA HCV third generation system with the UBI HCV EIA 4.0 it was achieved a Sd of 95,8% CI(95%): 92,5-99,15 and a Ed of 100% CI (95%): 99,7-100, with IY: 0,96 (0,93-0,99) with k: 0,0582 ID (95%): 0,9276-0,9888, p = 0,000. Both immunoassay systems were satisfactory for immunodiagnosis of multi-transfusion patients
International Nuclear Information System (INIS)
1997-01-01
This report describes the results of Phase 1 efforts to develop a Rapid Surface Sampling and Archival Record (RSSAR) System for the detection of semivolatile organic contaminants on concrete, transite, and metal surfaces. The characterization of equipment and building surfaces for the presence of contaminants as part of building decontamination and decommissioning activities is an immensely large tacks of concern to both government and industry. Contaminated and clean materials must be clearly identified and segregated so that the clean materials can be recycled or reused, if possible, or disposed of more cheaply as nonhazardous waste. Characterization of building and equipment surfaces will be needed during initial investigations, during cleanup operations, and during the final confirmatory process, increasing the total number of samples well beyond that needed for initial characterization. This multiplicity of information places a premium on the ability to handle and track data as efficiently as possible. Aware of the shortcomings of traditional surface characterization technology, GE, with DOE support has undertaken a 12-month effort to complete Phase 1 of a proposed four-phase program to develop the RSSAR system. The objectives of this work are to provide instrumentation to cost-effectively sample concrete and steel surfaces, provide a quick-look indication for the presence or absence of contaminants, and collect samples for later, more detailed analysis in a readily accessible and addressable form. The Rapid Surface Sampling and Archival Record (RSSAR) System will be a modular instrument made up of several components: (1) sampling heads for concrete surfaces, steel surfaces, and bulk samples; (2) quick-look detectors for photoionization and ultraviolet; (3) multisample trapping module to trap and store vaporized contaminants in a manner suitable for subsequent detailed lab-based analyses
Energy Technology Data Exchange (ETDEWEB)
Hsieh, Kai-Ta; Liu, Pei-Han [Department of Applied Chemistry, National Chiao Tung University, 1001 University Rd, Hsinchu, 300, Taiwan (China); Urban, Pawel L. [Department of Applied Chemistry, National Chiao Tung University, 1001 University Rd, Hsinchu, 300, Taiwan (China); Institute of Molecular Science, National Chiao Tung University, 1001 University Rd, Hsinchu, 300, Taiwan (China)
2015-09-24
Most real samples cannot directly be infused to mass spectrometers because they could contaminate delicate parts of ion source and guides, or cause ion suppression. Conventional sample preparation procedures limit temporal resolution of analysis. We have developed an automated liquid–liquid extraction system that enables unsupervised repetitive treatment of dynamic samples and instantaneous analysis by mass spectrometry (MS). It incorporates inexpensive open-source microcontroller boards (Arduino and Netduino) to guide the extraction and analysis process. Duration of every extraction cycle is 17 min. The system enables monitoring of dynamic processes over many hours. The extracts are automatically transferred to the ion source incorporating a Venturi pump. Operation of the device has been characterized (repeatability, RSD = 15%, n = 20; concentration range for ibuprofen, 0.053–2.000 mM; LOD for ibuprofen, ∼0.005 mM; including extraction and detection). To exemplify its usefulness in real-world applications, we implemented this device in chemical profiling of pharmaceutical formulation dissolution process. Temporal dissolution profiles of commercial ibuprofen and acetaminophen tablets were recorded during 10 h. The extraction-MS datasets were fitted with exponential functions to characterize the rates of release of the main and auxiliary ingredients (e.g. ibuprofen, k = 0.43 ± 0.01 h{sup −1}). The electronic control unit of this system interacts with the operator via touch screen, internet, voice, and short text messages sent to the mobile phone, which is helpful when launching long-term (e.g. overnight) measurements. Due to these interactive features, the platform brings the concept of the Internet-of-Things (IoT) to the chemistry laboratory environment. - Highlights: • Mass spectrometric analysis normally requires sample preparation. • Liquid–liquid extraction can isolate analytes from complex matrices. • The proposed system automates
International Nuclear Information System (INIS)
Hsieh, Kai-Ta; Liu, Pei-Han; Urban, Pawel L.
2015-01-01
Most real samples cannot directly be infused to mass spectrometers because they could contaminate delicate parts of ion source and guides, or cause ion suppression. Conventional sample preparation procedures limit temporal resolution of analysis. We have developed an automated liquid–liquid extraction system that enables unsupervised repetitive treatment of dynamic samples and instantaneous analysis by mass spectrometry (MS). It incorporates inexpensive open-source microcontroller boards (Arduino and Netduino) to guide the extraction and analysis process. Duration of every extraction cycle is 17 min. The system enables monitoring of dynamic processes over many hours. The extracts are automatically transferred to the ion source incorporating a Venturi pump. Operation of the device has been characterized (repeatability, RSD = 15%, n = 20; concentration range for ibuprofen, 0.053–2.000 mM; LOD for ibuprofen, ∼0.005 mM; including extraction and detection). To exemplify its usefulness in real-world applications, we implemented this device in chemical profiling of pharmaceutical formulation dissolution process. Temporal dissolution profiles of commercial ibuprofen and acetaminophen tablets were recorded during 10 h. The extraction-MS datasets were fitted with exponential functions to characterize the rates of release of the main and auxiliary ingredients (e.g. ibuprofen, k = 0.43 ± 0.01 h"−"1). The electronic control unit of this system interacts with the operator via touch screen, internet, voice, and short text messages sent to the mobile phone, which is helpful when launching long-term (e.g. overnight) measurements. Due to these interactive features, the platform brings the concept of the Internet-of-Things (IoT) to the chemistry laboratory environment. - Highlights: • Mass spectrometric analysis normally requires sample preparation. • Liquid–liquid extraction can isolate analytes from complex matrices. • The proposed system automates the
SLIMS--a user-friendly sample operations and inventory management system for genotyping labs.
Van Rossum, Thea; Tripp, Ben; Daley, Denise
2010-07-15
We present the Sample-based Laboratory Information Management System (SLIMS), a powerful and user-friendly open source web application that provides all members of a laboratory with an interface to view, edit and create sample information. SLIMS aims to simplify common laboratory tasks with tools such as a user-friendly shopping cart for subjects, samples and containers that easily generates reports, shareable lists and plate designs for genotyping. Further key features include customizable data views, database change-logging and dynamically filled pre-formatted reports. Along with being feature-rich, SLIMS' power comes from being able to handle longitudinal data from multiple time-points and biological sources. This type of data is increasingly common from studies searching for susceptibility genes for common complex diseases that collect thousands of samples generating millions of genotypes and overwhelming amounts of data. LIMSs provide an efficient way to deal with this data while increasing accessibility and reducing laboratory errors; however, professional LIMS are often too costly to be practical. SLIMS gives labs a feasible alternative that is easily accessible, user-centrically designed and feature-rich. To facilitate system customization, and utilization for other groups, manuals have been written for users and developers. Documentation, source code and manuals are available at http://genapha.icapture.ubc.ca/SLIMS/index.jsp. SLIMS was developed using Java 1.6.0, JSPs, Hibernate 3.3.1.GA, DB2 and mySQL, Apache Tomcat 6.0.18, NetBeans IDE 6.5, Jasper Reports 3.5.1 and JasperSoft's iReport 3.5.1.
Sample problems for the novice user of the AMPX-II system
International Nuclear Information System (INIS)
Ford, W.E. III; Roussin, R.W.; Petrie, L.M.; Diggs, B.R.; Comolander, H.E.
1979-01-01
Contents of the IBM version of the APMX system distributed by the Radiation Shielding Information Center (APMX-II) are described. Sample problems which demonstrate the procedure for implementing AMPX-II modules to generate point cross sections; generate multigroup neutron, photon production, and photon interaction cross sections for various transport codes; collapse multigroup cross sections; check, edit, and punch multigroup cross sections; and execute a one-dimensional discrete ordinates transport calculation are detailed. 25 figures, 9 tables
Sampling system of atmospheric water vapour for analysis of the γ sub(D) relationship
International Nuclear Information System (INIS)
Foloni, L.L.; Villa Nova, N.A.; Salati, E.
1979-01-01
The development of a system to water vapour air, for natural isotopic composition analysis of hydrogen is presented. The system uses molecular sieve, type '4A', without cooling agent and permits the choice of a sampling time, variyng from a few minutes to many hours, through the control of the admission of vapour flux. The system has good performance in field conditions, with errors of the order of + -3,0 0 /00 in the γ sub(D)( 0 /00) measurements [pt
Test plan for the Sample Transfer Canister system
International Nuclear Information System (INIS)
Flanagan, B.D.
1998-01-01
The Sample Transfer Canister will be used by the Waste Receiving and Processing Facility (WRAP) for the transport of small quantity liquid samples that meet the definition of a limited quantity radioactive material, and may also be corrosive and/or flammable. These samples will be packaged and shipped in accordance with the US Department of Transportation (DOT) regulation 49 CFR 173.4, ''Exceptions for small quantities.'' The Sample Transfer Canister is of a ''French Can'' design, intended to be mated with a glove box for loading/unloading. Transport will typically take place north of the Wye Barricade between WRAP and the 222-S Laboratory. The Sample Transfer Canister will be shipped in an insulated ice chest, but the ice chest will not be a part of the small quantity package during prototype testing
DEFF Research Database (Denmark)
Andreasen, Sune Zoëga
the technology on a large scale from fulfilling its potential for maturing into applied technologies and products. In this work, we have taken the first steps towards realizing a capable and truly automated “sample-to-answer” analysis system, aimed at small molecule detection and quantification from a complex...... sample matrix. The main result is a working prototype of a microfluidic system, integrating both centrifugal microfluidics for sample handling, supported liquid membrane extraction (SLM) for selective and effective sample treatment, as well as in-situ electrochemical detection. As a case study...
Chango, Gabriela; Palacio, Edwin; Cerdà, Víctor
2018-08-15
A simple potentiometric chip-based multipumping flow system (MPFS) has been developed for the simultaneous determination of fluoride, chloride, pH, and redox potential in water samples. The proposed system was developed by using a poly(methyl methacrylate) chip microfluidic-conductor using the advantages of flow techniques with potentiometric detection. For this purpose, an automatic system has been designed and built by optimizing the variables involved in the process, such as: pH, ionic strength, stirring and sample volume. This system was applied successfully to water samples getting a versatile system with an analysis frequency of 12 samples per hour. Good correlation between chloride and fluoride concentration measured with ISE and ionic chromatography technique suggests satisfactory reliability of the system. Copyright © 2018 Elsevier B.V. All rights reserved.
Vogt, F; Karlowatz, M; Jakusch, M; Mizaikoff, B
2003-04-01
For efficient development assessment, and calibration of new chemical analyzers a large number of independently prepared samples of target analytes is necessary. Whereas mixing units for gas analysis are readily available, there is a lack of instrumentation for accurate preparation of liquid samples containing volatile organic compounds (VOCs). Manual preparation of liquid samples containing VOCs at trace concentration levels is a particularly challenging and time consuming task. Furthermore, regularly scheduled calibration of sensors and analyzer systems demands for computer controlled automated sample preparation systems. In this paper we present a novel liquid mixing device enabling extensive measurement series with focus on volatile organic compounds, facilitating analysis of water polluted by traces of volatile hydrocarbons. After discussing the mixing system and control software, first results obtained by coupling with an FT-IR spectrometer are reported. Properties of the mixing system are assessed by mid-infrared attenuated total reflection (ATR) spectroscopy of methanol-acetone mixtures and by investigation of multicomponent samples containing volatile hydrocarbons such as 1,2,4-trichlorobenzene and tetrachloroethylene. Obtained ATR spectra are evaluated by principal component regression (PCR) algorithms. It is demonstrated that the presented sample mixing device provides reliable multicomponent mixtures with sufficient accuracy and reproducibility at trace concentration levels.
Microcontroller-based system for estimate of calcium in serum samples.
Neelamegam, Periyaswmy; Jamaludeen, Abdul Sheriff; Ragendran, Annamalai; Murugrananthan, Krishanamoorthy
2010-01-01
In this study, a microcontroller-based control unit was designed and constructed for the estimation of serum calcium in blood samples. The proposed optoelectronic instrument used a red light emitting diode (LED) as a light source and photodiode as a sensor. The performance of the system was compared with that of a commercial instrument in measuring calcium ion. The quantitative analysis of calcium in a catalyst using arsenazo III as colorimetric reagent was used to test the device. The calibration curve for calcium binding with arsenazo III was drawn to check the range of linearity, which was between 0.1 to 4.5 mM L⁻¹. The limit of detection (LOD) is 0.05 mM L⁻¹. Absorbance changes over the pH range of 2-12 were determined to optimize the assay, with maximum absorption at pH 9.0. Interferences in absorbance from monovalent (K+ and Na+) and divalent (Mg²+) cations were also studied. The results show that the system works successfully.
Discrete Multiwavelet Critical-Sampling Transform-Based OFDM System over Rayleigh Fading Channels
Directory of Open Access Journals (Sweden)
Sameer A. Dawood
2015-01-01
Full Text Available Discrete multiwavelet critical-sampling transform (DMWCST has been proposed instead of fast Fourier transform (FFT in the realization of the orthogonal frequency division multiplexing (OFDM system. The proposed structure further reduces the level of interference and improves the bandwidth efficiency through the elimination of the cyclic prefix due to the good orthogonality and time-frequency localization properties of the multiwavelet transform. The proposed system was simulated using MATLAB to allow various parameters of the system to be varied and tested. The performance of DMWCST-based OFDM (DMWCST-OFDM was compared with that of the discrete wavelet transform-based OFDM (DWT-OFDM and the traditional FFT-based OFDM (FFT-OFDM over flat fading and frequency-selective fading channels. Results obtained indicate that the performance of the proposed DMWCST-OFDM system achieves significant improvement compared to those of DWT-OFDM and FFT-OFDM systems. DMWCST improves the performance of the OFDM system by a factor of 1.5–2.5 dB and 13–15.5 dB compared with the DWT and FFT, respectively. Therefore the proposed system offers higher data rate in wireless mobile communications.
Energy Technology Data Exchange (ETDEWEB)
Nilsson, Patrik T.; Malik, Azhar; Pagels, Joakim; Lindskog, Magnus; Rissler, Jenny; Gudmundsson, Anders; Bohgard, Mats; Sanati, Mehri [Lund University, Division of Ergonomics and Aerosol Technology, P.O. Box 118, Lund (Sweden)
2011-07-15
The objective of this work was to design and evaluate an experimental setup to be used for field studies of particle formation in biomass gasification processes. The setup includes a high-temperature dilution probe and a denuder to separate solid particles from condensable volatile material. The efficiency of the setup to remove volatile material from the sampled stream and the influence from condensation on particles with different morphologies is presented. In order to study the sampling setup model, aerosols were created with a nebulizer to produce compact and solid KCl particles and a diffusion flame burner to produce agglomerated and irregular soot particles. The nebulizer and soot generator was followed by an evaporation-condensation section where volatile material, dioctylsebacete (DOS), was added to the system as a tar model compound. The model aerosol particles were heated to 200 C to create a system containing both solid particles and volatile organic material in gas phase. The heated aerosol particles were sampled and diluted at the same temperature with the dilution probe. Downstream the probe, the DOS was adsorbed in the denuder. This was achieved by slowly decreasing the temperature of the diluted sample towards ambient level in the denuder. Thereby the supersaturation of organic vapors was reduced which decreased the probability for tar condensation and nucleation of new particles. Both the generation system and the sampling technique gave reproducible results. A DOS collection efficiency of >99% was achieved if the denuder inlet concentration was diluted to less than 1-6 mg/m{sup 3} depending on the denuder flow rate. Concentrations higher than that lead to significant impact on the resulting KCl size distribution. The choice of model compounds was done to study the effect from the particle morphology on the achieved particle characteristics after the sampling setup. When similar amounts of volatile material condensed on soot agglomerates and
Sampling algorithms for validation of supervised learning models for Ising-like systems
Portman, Nataliya; Tamblyn, Isaac
2017-12-01
In this paper, we build and explore supervised learning models of ferromagnetic system behavior, using Monte-Carlo sampling of the spin configuration space generated by the 2D Ising model. Given the enormous size of the space of all possible Ising model realizations, the question arises as to how to choose a reasonable number of samples that will form physically meaningful and non-intersecting training and testing datasets. Here, we propose a sampling technique called ;ID-MH; that uses the Metropolis-Hastings algorithm creating Markov process across energy levels within the predefined configuration subspace. We show that application of this method retains phase transitions in both training and testing datasets and serves the purpose of validation of a machine learning algorithm. For larger lattice dimensions, ID-MH is not feasible as it requires knowledge of the complete configuration space. As such, we develop a new ;block-ID; sampling strategy: it decomposes the given structure into square blocks with lattice dimension N ≤ 5 and uses ID-MH sampling of candidate blocks. Further comparison of the performance of commonly used machine learning methods such as random forests, decision trees, k nearest neighbors and artificial neural networks shows that the PCA-based Decision Tree regressor is the most accurate predictor of magnetizations of the Ising model. For energies, however, the accuracy of prediction is not satisfactory, highlighting the need to consider more algorithmically complex methods (e.g., deep learning).
Godvin Sharmila, V; Kavitha, S; Rajashankar, K; Yeom, Ick Tae; Rajesh Banu, J
2015-12-01
This investigation explores the influence of titanium dioxide (TiO2) in deflocculating (removal of extracellular polymeric substance - EPS) the sludge and subsequent biomass disintegration by bacterial pretreatment. The EPS removed at an optimized TiO2 dosage of 0.03g/g of SS of TiO2 and a solar radiation exposure time of 15min to enhance the subsequent bacterial disintegration. The outcomes of the bacterial pretreatment reveal SS reduction and COD solubilization for the deflocculated (EPS removed and bacterially pretreated) sludge was observed to be 22.8% and 22.9% which was comparatively greater than flocculated (raw sludge inoculated with bacteria) and control (raw) sludge. The higher methane production potential of about 0.43(gCOD/gVSS) was obtained in deflocculated sludge than the flocculated (0.20gCOD/gVSS) and control (0.073gCOD/gVSS). Economic assessment of this study provides a net profit of about 131.9USD/Ton in deflocculated sludge. Copyright © 2015 Elsevier Ltd. All rights reserved.
Conduction-band valley spin splitting in single-layer H-T l2O
Ma, Yandong; Kou, Liangzhi; Du, Aijun; Huang, Baibiao; Dai, Ying; Heine, Thomas
2018-02-01
Despite numerous studies, coupled spin and valley physics is currently limited to two-dimensional (2D) transition-metal dichalcogenides (TMDCs). Here, we predict an exceptional 2D valleytronic material associated with the spin-valley coupling phenomena beyond 2D TMDCs—single-layer (SL) H-T l2O . It displays large valley spin splitting (VSS), significantly larger than that of 2D TMDCs, and a finite band gap, which are both critically attractive for the integration of valleytronics and spintronics. More importantly, in sharp contrast to all the experimentally confirmed 2D valleytronic materials, where the strong valence-band VSS (0.15-0.46 eV) supports the spin-valley coupling, the VSS in SL H-T l2O is pronounced in its conduction band (0.61 eV), but negligibly small in its valence band (21 meV), thus opening a way for manipulating the coupled spin and valley physics. Moreover, SL H-T l2O possesses extremely high carrier mobility, as large as 9.8 ×103c m2V-1s-1 .
Develop of a system of sampling of condensable species with the vapor of water in the air
International Nuclear Information System (INIS)
Gonzalez Beermann, P. A.
1999-01-01
Implements a method for the determination of the dioxide of dissolved sulfur when condensing the vapor of water in samples of air. To carry out this project it was necessary to design, to build and to gauge the sampling system, a generating SO 2 , a meter of relative humidity, a system of dilution of gases and the system to make the laundries of the glassware, as well as a device to carry out the mensuration of the flow of air. The determination of the anions dissolved in those condensed one carries out for ionic chromatography. The calibration test made to the system of designed sampling demonstrated that behaves of stable form and reproducible for flows between 0,3 and 1,0 L/min. Of the tests of efficiency in the gathering of dioxide of sulfur, it was found that this it reached a maximum of 93% for a sampling flow 0,6 L/min. Lower conditions of relative humidity of 66%. It was found that using this sampling method and the later analysis of the one condensed by ionic chromatography is possible to detect the anions fluoride, chloride, saltpeter, nitrate and sulfate dissolved in concentrations of approximately 1 μg/m 3 . the limit of detection obtained for the soluble species in μg/m 3 of air it was of 1,0 for the fluoride, 4,0 for chloride, 5,0 for saltpeter, 8,0 for nitrate and 8,0 for dioxide of sulfur (reported as sulfate) [es
Sample Return Systems for Extreme Environments
National Aeronautics and Space Administration — In Phase I we were able to demonstrate that sample return missions utilizing high velocity penetrators (0.1- 1 km/s) could provide substantial new capabilities for...
A high volume sampling system for isotope determination of volatile halocarbons and hydrocarbons
Directory of Open Access Journals (Sweden)
E. Bahlmann
2011-10-01
Full Text Available The isotopic composition of volatile organic compounds (VOCs can provide valuable information on their sources and fate not deducible from mixing ratios alone. In particular the reported carbon stable isotope ratios of chloromethane and bromomethane from different sources cover a δ13C-range of almost 100‰ making isotope ratios a very promising tool for studying the biogeochemistry of these compounds. So far, the determination of the isotopic composition of C1 and C2 halocarbons others than chloromethane is hampered by their low mixing ratios.
In order to determine the carbon isotopic composition of C1 and C2 halocarbons with mixing ratios as low as 1 pptv (i a field suitable cryogenic high volume sampling system and (ii a chromatographic set up for processing these samples have been developed and validated. The sampling system was tested at two different sampling sites, an urban and a coastal location in Northern Germany. The average δ13C-values for bromomethane at the urban site were −42.9 ± 1.1‰ and agreed well with previously published results. But at the coastal site bromomethane was substantially enriched in 13C by almost 10‰. Less pronounced differences were observed for chlorodifluoromethane, 1,1,1-trichloroethane and chloromethane. We suggest that these differences are related to the turnover of these compounds in ocean surface waters. Furthermore we report first carbon isotope ratios for iodomethane (−40.4‰ to −79.8‰, bromoform (−13.8‰ to 22.9‰, and other halocarbons.
Sample Return Systems for Extreme Environments
National Aeronautics and Space Administration — The proposed work seeks to design, develop and test a hard impact penetrator/sampler that can withstand the hard impact and enable the sample to be returned to...
Ziebart, Christina; Giangregorio, Lora M; Gibbs, Jenna C; Levine, Iris C; Tung, James; Laing, Andrew C
2017-06-14
A wide variety of accelerometer systems, with differing sensor characteristics, are used to detect impact loading during physical activities. The study examined the effects of system characteristics on measured peak impact loading during a variety of activities by comparing outputs from three separate accelerometer systems, and by assessing the influence of simulated reductions in operating range and sampling rate. Twelve healthy young adults performed seven tasks (vertical jump, box drop, heel drop, and bilateral single leg and lateral jumps) while simultaneously wearing three tri-axial accelerometers including a criterion standard laboratory-grade unit (Endevco 7267A) and two systems primarily used for activity-monitoring (ActiGraph GT3X+, GCDC X6-2mini). Peak acceleration (gmax) was compared across accelerometers, and errors resulting from down-sampling (from 640 to 100Hz) and range-limiting (to ±6g) the criterion standard output were characterized. The Actigraph activity-monitoring accelerometer underestimated gmax by an average of 30.2%; underestimation by the X6-2mini was not significant. Underestimation error was greater for tasks with greater impact magnitudes. gmax was underestimated when the criterion standard signal was down-sampled (by an average of 11%), range limited (by 11%), and by combined down-sampling and range-limiting (by 18%). These effects explained 89% of the variance in gmax error for the Actigraph system. This study illustrates that both the type and intensity of activity should be considered when selecting an accelerometer for characterizing impact events. In addition, caution may be warranted when comparing impact magnitudes from studies that use different accelerometers, and when comparing accelerometer outputs to osteogenic impact thresholds proposed in literature. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.
Schmid, Christina; Baumstark, Annette; Pleus, Stefan; Haug, Cornelia; Tesar, Martina; Freckmann, Guido
2014-03-01
The partial pressure of oxygen (pO2) in blood samples can affect glucose measurements with oxygen-sensitive systems. In this study, we assessed the influence of different pO2 levels on blood glucose (BG) measurements with five glucose oxidase (GOD) systems and one glucose dehydrogenase (GDH) system. All selected GOD systems were indicated by the manufacturers to be sensitive to increased oxygen content of the blood sample. Venous blood samples of 16 subjects (eight women, eight men; mean age, 52 years; three with type 1 diabetes, four with type 2 diabetes, and nine without diabetes) were collected. Aliquots of each sample were adjusted to the following pO2 values: ≤45 mm Hg, approximately 70 mm Hg, and ≥150 mm Hg. For each system, five consecutive measurements on each sample were performed using the same test strip lot. Relative differences between the mean BG value at a pO2 level of approximately 70 mm Hg, which was considered to be similar to pO2 values in capillary blood samples, and the mean BG value at pO2 levels ≤45 mm Hg and ≥150 mm Hg were calculated. The GOD systems showed mean relative differences between 11.8% and 44.5% at pO2 values ≤45 mm Hg and between -14.6% and -21.2% at pO2 values ≥150 mm Hg. For the GDH system, the mean relative differences were -0.3% and -0.2% at pO2 values ≤45 mm Hg and ≥150 mm Hg, respectively. The magnitude of the pO2 impact on BG measurements seems to vary among the tested oxygen-sensitive GOD systems. The pO2 range in which oxygen-sensitive systems operate well should be provided in the product information.
International Nuclear Information System (INIS)
Hordosy, G.
2006-01-01
KARATE is a code system developed in KFKI AERI. It is routinely used for core calculation. Its depletion module are now tested against the radiochemical measurements of spent fuel samples from the Novovoronezh Unit IV, performed in RIAR, Dimitrovgrad. Due to the insufficient knowledge of operational history of the unit, the irradiation history of the samples was taken from formerly published Russian calculations. The calculation of isotopic composition was performed by the MULTICEL module of program system. The agreement between the calculated and measured values of the concentration of the most important actinides and fission products is investigated (Authors)
Touch And Go Camera System (TAGCAMS) for the OSIRIS-REx Asteroid Sample Return Mission
Bos, B. J.; Ravine, M. A.; Caplinger, M.; Schaffner, J. A.; Ladewig, J. V.; Olds, R. D.; Norman, C. D.; Huish, D.; Hughes, M.; Anderson, S. K.; Lorenz, D. A.; May, A.; Jackman, C. D.; Nelson, D.; Moreau, M.; Kubitschek, D.; Getzandanner, K.; Gordon, K. E.; Eberhardt, A.; Lauretta, D. S.
2018-02-01
NASA's OSIRIS-REx asteroid sample return mission spacecraft includes the Touch And Go Camera System (TAGCAMS) three camera-head instrument. The purpose of TAGCAMS is to provide imagery during the mission to facilitate navigation to the target asteroid, confirm acquisition of the asteroid sample, and document asteroid sample stowage. The cameras were designed and constructed by Malin Space Science Systems (MSSS) based on requirements developed by Lockheed Martin and NASA. All three of the cameras are mounted to the spacecraft nadir deck and provide images in the visible part of the spectrum, 400-700 nm. Two of the TAGCAMS cameras, NavCam 1 and NavCam 2, serve as fully redundant navigation cameras to support optical navigation and natural feature tracking. Their boresights are aligned in the nadir direction with small angular offsets for operational convenience. The third TAGCAMS camera, StowCam, provides imagery to assist with and confirm proper stowage of the asteroid sample. Its boresight is pointed at the OSIRIS-REx sample return capsule located on the spacecraft deck. All three cameras have at their heart a 2592 × 1944 pixel complementary metal oxide semiconductor (CMOS) detector array that provides up to 12-bit pixel depth. All cameras also share the same lens design and a camera field of view of roughly 44° × 32° with a pixel scale of 0.28 mrad/pixel. The StowCam lens is focused to image features on the spacecraft deck, while both NavCam lens focus positions are optimized for imaging at infinity. A brief description of the TAGCAMS instrument and how it is used to support critical OSIRIS-REx operations is provided.
Colombi, Davide; Dinkel, Julien; Weinheimer, Oliver; Obermayer, Berenike; Buzan, Teodora; Nabers, Diana; Bauer, Claudia; Oltmanns, Ute; Palmowski, Karin; Herth, Felix; Kauczor, Hans Ulrich; Sverzellati, Nicola
2015-01-01
Objectives To describe changes over time in extent of idiopathic pulmonary fibrosis (IPF) at multidetector computed tomography (MDCT) assessed by semi-quantitative visual scores (VSs) and fully automatic histogram-based quantitative evaluation and to test the relationship between these two methods of quantification. Methods Forty IPF patients (median age: 70 y, interquartile: 62-75 years; M:F, 33:7) that underwent 2 MDCT at different time points with a median interval of 13 months (interquartile: 10-17 months) were retrospectively evaluated. In-house software YACTA quantified automatically lung density histogram (10th-90th percentile in 5th percentile steps). Longitudinal changes in VSs and in the percentiles of attenuation histogram were obtained in 20 untreated patients and 20 patients treated with pirfenidone. Pearson correlation analysis was used to test the relationship between VSs and selected percentiles. Results In follow-up MDCT, visual overall extent of parenchymal abnormalities (OE) increased in median by 5 %/year (interquartile: 0 %/y; +11 %/y). Substantial difference was found between treated and untreated patients in HU changes of the 40th and of the 80th percentiles of density histogram. Correlation analysis between VSs and selected percentiles showed higher correlation between the changes (Δ) in OE and Δ 40th percentile (r=0.69; phistogram analysis at one year follow-up of IPF patients, whether treated or untreated: Δ 40th percentile might reflect the change in overall extent of lung abnormalities, notably of ground-glass pattern; furthermore Δ 80th percentile might reveal the course of reticular opacities. PMID:26110421
Ye, Min; Nagar, Swati; Korzekwa, Ken
2015-01-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data was often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding, and blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for terminal elimination half-life (t1/2, 100% of drugs), peak plasma concentration (Cmax, 100%), area under the plasma concentration-time curve (AUC0–t, 95.4%), clearance (CLh, 95.4%), mean retention time (MRT, 95.4%), and steady state volume (Vss, 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. PMID:26531057
Standardized sampling system for reactor coolants
International Nuclear Information System (INIS)
Divine, J.R.; Munson, L.F.; Nelson, J.L.; McDowell, R.L.; Jankowski, M.W.
1982-09-01
A three-pronged approach was developed to reach the objectives of acceptable coolant sampling, assessment of occupational exposure from corrosion products, and model development for the transport and buildup of corrosion products. Emphasis is on sampler design
Visser, Ate; Singleton, Michael J; Hillegonds, Darren J; Velsko, Carol A; Moran, Jean E; Esser, Bradley K
2013-11-15
Noble gases dissolved in groundwater can reveal paleotemperatures, recharge conditions, and precise travel times. The collection and analysis of noble gas samples are cumbersome, involving noble gas purification, cryogenic separation and static mass spectrometry. A quicker and more efficient sample analysis method is required for introduced tracer studies and laboratory experiments. A Noble Gas Membrane Inlet Mass Spectrometry (NG-MIMS) system was developed to measure noble gases at natural abundances in gas and water samples. The NG-MIMS system consists of a membrane inlet, a dry-ice water trap, a carbon-dioxide trap, two getters, a gate valve, a turbomolecular pump and a quadrupole mass spectrometer equipped with an electron multiplier. Noble gases isotopes (4)He, (22)Ne, (38)Ar, (84)Kr and (132)Xe are measured every 10 s. The NG-MIMS system can reproduce measurements made on a traditional noble gas mass spectrometer system with precisions of 2%, 8%, 1%, 1% and 3% for He, Ne, Ar, Kr and Xe, respectively. Noble gas concentrations measured in an artificial recharge pond were used to monitor an introduced xenon tracer and to reconstruct temperature variations to within 2 °C. Additional experiments demonstrated the capability to measure noble gases in gas and in water samples, in real time. The NG-MIMS system is capable of providing analyses sufficiently accurate and precise for introduced noble gas tracers at managed aquifer recharge facilities, groundwater fingerprinting based on excess air and noble gas recharge temperature, and field and laboratory studies investigating ebullition and diffusive exchange. Copyright © 2013 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Rieger, J.T.; Bryce, R.W.
1990-01-01
Ground-water samples collected for hazardous-waste and radiological monitoring have come under strict regulatory and quality assurance requirements as a result of laws such as the Resource Conservation and Recovery Act. To comply with these laws, the labeling system used to identify environmental samples had to be upgraded to ensure proper handling and to protect collection personnel from exposure to sample contaminants and sample preservatives. The sample label now used as the Pacific Northwest Laboratory is a complete sample document. In the event other paperwork on a labeled sample were lost, the necessary information could be found on the label
Lam, H K
2012-02-01
This paper investigates the stability of sampled-data output-feedback (SDOF) polynomial-fuzzy-model-based control systems. Representing the nonlinear plant using a polynomial fuzzy model, an SDOF fuzzy controller is proposed to perform the control process using the system output information. As only the system output is available for feedback compensation, it is more challenging for the controller design and system analysis compared to the full-state-feedback case. Furthermore, because of the sampling activity, the control signal is kept constant by the zero-order hold during the sampling period, which complicates the system dynamics and makes the stability analysis more difficult. In this paper, two cases of SDOF fuzzy controllers, which either share the same number of fuzzy rules or not, are considered. The system stability is investigated based on the Lyapunov stability theory using the sum-of-squares (SOS) approach. SOS-based stability conditions are obtained to guarantee the system stability and synthesize the SDOF fuzzy controller. Simulation examples are given to demonstrate the merits of the proposed SDOF fuzzy control approach.
Ewing, Margaret M; Thompson, Jonelle M; McLaren, Robert S; Purpero, Vincent M; Thomas, Kelli J; Dobrowski, Patricia A; DeGroot, Gretchen A; Romsos, Erica L; Storts, Douglas R
2016-07-01
Quantification of the total amount of human DNA isolated from a forensic evidence item is crucial for DNA normalization prior to short tandem repeat (STR) DNA analysis and a federal quality assurance standard requirement. Previous commercial quantification methods determine the total human DNA and total human male DNA concentrations, but provide limited information about the condition of the DNA sample. The PowerQuant(®) System includes targets for quantification of total human and total human male DNA as well as targets for evaluating whether the human DNA is degraded and/or PCR inhibitors are present in the sample. A developmental validation of the PowerQuant(®) System was completed, following SWGDAM Validation Guidelines, to evaluate the assay's specificity, sensitivity, precision and accuracy, as well as the ability to detect degraded DNA or PCR inhibitors. In addition to the total human DNA and total human male DNA concentrations in a sample, data from the degradation target and internal PCR control (IPC) provide a forensic DNA analyst meaningful information about the quality of the isolated human DNA and the presence of PCR inhibitors in the sample that can be used to determine the most effective workflow and assist downstream interpretation. Copyright © 2016 The Author(s). Published by Elsevier Ireland Ltd.. All rights reserved.
A simple vibrating sample magnetometer for macroscopic samples
Lopez-Dominguez, V.; Quesada, A.; Guzmán-Mínguez, J. C.; Moreno, L.; Lere, M.; Spottorno, J.; Giacomone, F.; Fernández, J. F.; Hernando, A.; García, M. A.
2018-03-01
We here present a simple model of a vibrating sample magnetometer (VSM). The system allows recording magnetization curves at room temperature with a resolution of the order of 0.01 emu and is appropriated for macroscopic samples. The setup can be mounted with different configurations depending on the requirements of the sample to be measured (mass, saturation magnetization, saturation field, etc.). We also include here examples of curves obtained with our setup and comparison curves measured with a standard commercial VSM that confirms the reliability of our device.
International Nuclear Information System (INIS)
SASAKI, L.M.
1999-01-01
This sampling and analysis plan identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained to address vapor issues related to the sluicing of tank 241-C-106. Sampling will be performed in accordance with Waste Retrieval Sluicing System Emissions Collection Phase III (Jones 1999) and Process Test Plan Phase III, Waste Retrieval Sluicing System Emissions Collection (Powers 1999). Analytical requirements include those specified in Request for Ecology Concurrence on Draft Strategy/Path Forward to Address Concerns Regarding Organic Emissions from C-106 Sluicing Activities (Peterson 1998). The Waste Retrieval Sluicing System was installed to retrieve and transfer high-heat sludge from tank 241-C-106 to tank 241-AY-102, which is designed for high-heat waste storage. During initial sluicing of tank 241-C-106 in November 1998, operations were halted due to detection of unexpected high volatile organic compounds in emissions that exceeded regulatory permit limits. Several workers also reported smelling sharp odors and throat irritation. Vapor grab samples from the 296-C-006 ventilation system were taken as soon as possible after detection; the analyses indicated that volatile and semi-volatile organic compounds were present. In December 1998, a process test (phase I) was conducted in which the pumps in tanks 241-C-106 and 241-AY-102 were operated and vapor samples obtained to determine constituents that may be present during active sluicing of tank 241-C-106. The process test was suspended when a jumper leak was detected. On March 7, 1999, phase I1 of the process test was performed; the sluicing system was operated for approximately 7 hours and was ended using the controlled shutdown method when the allowable amount of solids were transferred to 241-AY-102. The phase II test was successful, however, further testing is required to obtain vapor samples at higher emission levels
Hiraki, M.; Yamada, Y.; Chavas, L. M. G.; Matsugaki, N.; Igarashi, N.; Wakatsuki, S.
2013-03-01
To achieve fully-automated and/or remote data collection in high-throughput X-ray experiments, the Structural Biology Research Centre at the Photon Factory (PF) has installed PF automated mounting system (PAM) for sample exchange robots at PF macromolecular crystallography beamlines BL-1A, BL-5A, BL-17A, AR-NW12A and AR-NE3A. We are upgrading the experimental systems, including the PAM for stable and efficient operation. To prevent human error in automated data collection, we installed a two-dimensional barcode reader for identification of the cassettes and sample pins. Because no liquid nitrogen pipeline in the PF experimental hutch is installed, the users commonly add liquid nitrogen using a small Dewar. To address this issue, an automated liquid nitrogen filling system that links a 100-liter tank to the robot Dewar has been installed on the PF macromolecular beamline. Here we describe this new implementation, as well as future prospects.
A multi-laser system for a fast sampling Thomson scattering diagnostic
International Nuclear Information System (INIS)
Trost, P.K.; Carlstrom, T.N.; DeBoo, J.C.; Greenfield, C.M.; Hsieh, C.L.; Snider, R.T.
1990-10-01
A multi-laser system is being developed for the DIII-D Thomson scattering diagnostic. This system combines the beams from up to eight Nd:YAG lasers onto a common beamline in which the beams are nearly parallel and are all focused into a small, common area within the desired scattering volume. Each laser can be fired at a constant rate (20 Hz per laser) for a high average repetition rate, or together in a ''burst,'' which will give very high sampling rates (10--20 kHz) for short periods. The burst mode will be triggerable by plasma events, which will allow for study of transient phenomena, but will require non-periodic firing of the lasers. Beamline diagnostics include position sensitive detectors for computer controlled feedback alignment of the 35 m beamline, an image position detection system for monitoring the alignment of the collection lens to the scattering volume, and a 1-D reticon camera for divergence monitoring. The effects of the non-periodic firing of the lasers will be monitored with the reticon camera. 3 refs., 5 figs
National Aeronautics and Space Administration — We propose to develop a proof-of-concept Micro-Sample Extraction System (µSES) to enable microfluidic instruments, currently under development at NASA Goddard Space...
A synchrotron radiation microtomography system for the analysis of trabecular bone samples.
Salomé, M; Peyrin, F; Cloetens, P; Odet, C; Laval-Jeantet, A M; Baruchel, J; Spanne, P
1999-10-01
X-ray computed microtomography is particularly well suited for studying trabecular bone architecture, which requires three-dimensional (3-D) images with high spatial resolution. For this purpose, we describe a three-dimensional computed microtomography (microCT) system using synchrotron radiation, developed at ESRF. Since synchrotron radiation provides a monochromatic and high photon flux x-ray beam, it allows high resolution and a high signal-to-noise ratio imaging. The principle of the system is based on truly three-dimensional parallel tomographic acquisition. It uses a two-dimensional (2-D) CCD-based detector to record 2-D radiographs of the transmitted beam through the sample under different angles of view. The 3-D tomographic reconstruction, performed by an exact 3-D filtered backprojection algorithm, yields 3-D images with cubic voxels. The spatial resolution of the detector was experimentally measured. For the application to bone investigation, the voxel size was set to 6.65 microm, and the experimental spatial resolution was found to be 11 microm. The reconstructed linear attenuation coefficient was calibrated from hydroxyapatite phantoms. Image processing tools are being developed to extract structural parameters quantifying trabecular bone architecture from the 3-D microCT images. First results on human trabecular bone samples are presented.
Rapid surface sampling and archival record system
Energy Technology Data Exchange (ETDEWEB)
Barren, E.; Penney, C.M.; Sheldon, R.B. [GE Corporate Research and Development Center, Schenectady, NY (United States)] [and others
1995-10-01
A number of contamination sites exist in this country where the area and volume of material to be remediated is very large, approaching or exceeding 10{sup 6} m{sup 2} and 10{sup 6} m{sup 3}. Typically, only a small fraction of this material is actually contaminated. In such cases there is a strong economic motivation to test the material with a sufficient density of measurements to identify which portions are uncontaminated, so extensively they be left in place or be disposed of as uncontaminated waste. Unfortunately, since contamination often varies rapidly from position to position, this procedure can involve upwards of one million measurements per site. The situation is complicated further in many cases by the difficulties of sampling porous surfaces, such as concrete. This report describes a method for sampling concretes in which an immediate distinction can be made between contaminated and uncontaminated surfaces. Sample acquisition and analysis will be automated.
The new Chalk River AMS ion source, sample changer and external sample magazine
International Nuclear Information System (INIS)
Koslowsky, V.T.; Bray, N.; Imahori, Y.; Andrews, H.R.; Davies, W.G.
1997-01-01
A new sample magazine, sample changer and ion source have been developed and are in routine use at Chalk River. The system features a readily accessible 40-sample magazine at ground potential that is external to the ion source and high-voltage cage. The samples are held in an inert atmosphere and can be individually examined or removed; they can be exchanged en masse as a complete magazine concurrent with an AMS measurement. On-line sample changing is done with a pneumatic rabbit transfer system employing two stages of differential pumping. At Chalk River this is routinely performed across a 200 kV potential. Sample positioning is precise, and hundreds of 36 Cl and 129 I samples have been measured over a period of several days without interruption or alteration of ion source operating conditions. (author)
International Nuclear Information System (INIS)
Lockwood, R.E.; Blankinship, D.R.
1994-01-01
Environmental monitoring programs often require accurate determination of sampling site locations in aquatic environments. This is especially true when a open-quotes pictureclose quotes of high resolution is needed for observing a changing variable in a given area and location is assumed to be important to the distribution of that variable. Sample site location can be difficult if few visible land marks are available for reference on a large body of water. The use of navigational systems such as Global Positioning System (GPS) and its predecessor, Loran-C, provide an excellent method for sample site location. McFarland (1992) discusses the practicality of GPS for location determination. This article discusses the use of Loran-C in a sampling scheme implemented at the South Texas Project Electrical Generating Station (STPEGS), Wadsworth, Texas
International Nuclear Information System (INIS)
Sheng, Wenjuan; Guo, Aihuang; Liu, Yang; Azmi, Asrul Izam; Peng, Gang-Ding
2011-01-01
We present a novel technique that optimizes the real-time remote monitoring and control of dispersed civil infrastructures. The monitoring system is based on fiber Bragg gating (FBG) sensors, and transfers data via Ethernet. This technique combines parallel operation and self-adaptive sampling to increase the data acquisition rate in remote controllable structural monitoring systems. The compact parallel operation mode is highly efficient at achieving the highest possible data acquisition rate for the FBG sensor based local data acquisition system. Self-adaptive sampling is introduced to continuously coordinate local acquisition and remote control for data acquisition rate optimization. Key issues which impact the operation of the whole system, such as the real-time data acquisition rate, data processing capability, and buffer usage, are investigated. The results show that, by introducing parallel operation and self-adaptive sampling, the data acquisition rate can be increased by several times without affecting the system operating performance on both local data acquisition and remote process control
International Nuclear Information System (INIS)
Kuniewski, Sebastian P.; Weide, Johannes A.M. van der; Noortwijk, Jan M. van
2009-01-01
The paper presents a sampling-inspection strategy for the evaluation of time-dependent reliability of deteriorating systems, where the deterioration is assumed to initiate at random times and at random locations. After initiation, defects are weakening the system's resistance. The system becomes unacceptable when at least one defect reaches a critical depth. The defects are assumed to initiate at random times modeled as event times of a non-homogeneous Poisson process (NHPP) and to develop according to a non-decreasing time-dependent gamma process. The intensity rate of the NHPP is assumed to be a combination of a known time-dependent shape function and an unknown proportionality constant. When sampling inspection (i.e. inspection of a selected subregion of the system) results in a number of defect initiations, Bayes' theorem can be used to update prior beliefs about the proportionality constant of the NHPP intensity rate to the posterior distribution. On the basis of a time- and space-dependent Poisson process for the defect initiation, an adaptive Bayesian model for sampling inspection is developed to determine the predictive probability distribution of the time to failure. A potential application is, for instance, the inspection of a large vessel or pipeline suffering pitting/localized corrosion in the oil industry. The possibility of imperfect defect detection is also incorporated in the model.
A system for on-line monitoring of light element concentration distributions in thin samples
Energy Technology Data Exchange (ETDEWEB)
Brands, P.J.M. E-mail: p.j.m.brands@tue.nl; Mutsaers, P.H.A.; Voigt, M.J.A. de
1999-09-02
At the Cyclotron Laboratory, a scanning proton microprobe is used to determine concentration distributions in biomedical samples. The data acquired in these measurements used to be analysed in a time consuming off-line analysis. To avoid the loss of valuable measurement and analysis time, DYANA was developed. DYANA is an on-line method for the analysis of data from biomedical measurements. By using a database of background shapes, light elements such as Na and Mg, can be fitted even more precisely than in conventional fitting procedures. The entire analysis takes only several seconds and is performed while the acquisition system is gathering a new subset of data. Data acquisition must be guaranteed and may not be interfered by other parallel processes. Therefore, the analysis, the data acquisition and the experiment control is performed on a PCI-based Pentium personal computer (PC), running a real-time operating system. A second PC is added to run a graphical user interface for interaction with the experimenter and the monitoring of the analysed results. The system is here illustrated using atherosclerotic tissue but is applicable to all kinds of thin samples.
Bolhuis, Peter
Important reaction-diffusion processes, such as biochemical networks in living cells, or self-assembling soft matter, span many orders in length and time scales. In these systems, the reactants' spatial dynamics at mesoscopic length and time scales of microns and seconds is coupled to the reactions between the molecules at microscopic length and time scales of nanometers and milliseconds. This wide range of length and time scales makes these systems notoriously difficult to simulate. While mean-field rate equations cannot describe such processes, the mesoscopic Green's Function Reaction Dynamics (GFRD) method enables efficient simulation at the particle level provided the microscopic dynamics can be integrated out. Yet, many processes exhibit non-trivial microscopic dynamics that can qualitatively change the macroscopic behavior, calling for an atomistic, microscopic description. The recently developed multiscale Molecular Dynamics Green's Function Reaction Dynamics (MD-GFRD) approach combines GFRD for simulating the system at the mesocopic scale where particles are far apart, with microscopic Molecular (or Brownian) Dynamics, for simulating the system at the microscopic scale where reactants are in close proximity. The association and dissociation of particles are treated with rare event path sampling techniques. I will illustrate the efficiency of this method for patchy particle systems. Replacing the microscopic regime with a Markov State Model avoids the microscopic regime completely. The MSM is then pre-computed using advanced path-sampling techniques such as multistate transition interface sampling. I illustrate this approach on patchy particle systems that show multiple modes of binding. MD-GFRD is generic, and can be used to efficiently simulate reaction-diffusion systems at the particle level, including the orientational dynamics, opening up the possibility for large-scale simulations of e.g. protein signaling networks.
Xu, Cheng; Gao, Guanjun; Chen, Sai; Zhang, Jie; Luo, Ming; Hu, Rong; Yang, Qi
2016-11-14
We compare the performance of sub-symbol-rate sampling for polarization-division-multiplexed quadrature-phase-shift-keying (PDM-QPSK) signals in super-Nyquist wavelength division multiplexing (WDM) system by using quadrature duo-binary (QDB) and quadrature four-level poly-binary (4PB) shaping together with maximum likelihood sequence estimation (MLSE). PDM-16QAM is adopted in the simulation to be compared with PDM-QPSK. The numerical simulations show that, for a software defined communication system, the level number of quadrature poly-binary modulation should be adjusted to achieve the optimal performance according to channel spacing, required OSNR and sampling rate restrictions of optics. In the experiment, we demonstrate 3-channel 12-Gbaud PDM-QPSK transmission with 10-GHz channel spacing and only 8.4-GSa/s ADC sampling rate at lowest. By using QDB or 4PB shaping with 3tap-MLSE, the sampling rate can be reduced to the signal baud rate (1 samples per symbol) without penalty.
International Nuclear Information System (INIS)
Lowry, W.E.; Dunn, S.D.; Cremer, S.C.; Williams, C.
1994-01-01
The SEAMIST trademark inverting membrane deployment system has been used successfully at the Mixed Waste Landfill Integrated Demonstration (MWLID) for multipoint vapor sampling/pressure measurement/permeability measurement/sensor integration demonstrations and borehole lining. Several instruments were deployed inside the SEAMIST trademark lined boreholes to detect metals, radionuclides, moisture, and geologic variations. The liner protected the instruments from contamination, maintained support of the uncased borehole wall, and sealed the total borehole from air circulation. The current activities have included the installation of three multipoint vapor sampling systems and sensor integration systems in 100-foot-deep vertical boreholes. A long term pressure monitoring program has recorded barometric pressure effects at depth with relatively high spatial resolution. The SEAMIST trademark system has been integrated with a variety of hydrologic and chemical sensors for in-situ measurements, demonstrating its versatility as an instrument deployment system which allows easy emplacement and removal. Standard SEAMIST trademark vapor sampling systems were also integrated with state-of-the-art VOC analysis technologies (automated GC, UV laser fluorometer). The results and status of these demonstration tests are presented
Wang, Jiajia; Gu, Dongyu; Wang, Miao; Guo, Xinfeng; Li, Haoquan; Dong, Yue; Guo, Hong; Wang, Yi; Fan, Mengqi; Yang, Yi
2017-05-15
A rational liquid-liquid extraction approach was established to pre-treat samples for high-speed counter-current chromatography (HSCCC). n-Hexane-ethyl acetate-methanol-water (4:5:4:5, v/v) and (1:5:1:5, v/v) were selected as solvent systems for liquid-liquid extraction by systematically screening K of target compounds to remove low- and high-polarity impurities in the sample, respectively. After liquid-liquid extraction was performed, 1.4g of crude sample II was obtained from 18.5g of crude sample I which was extracted from the flowers of Robinia pseudoacacia L., and then separated with HSCCC by using a solvent system composed of n-hexane-ethyl acetate-methanol-water (1:2:1:2, v/v). As a result, 31mg of robinin and 37mg of kaempferol 7-O-α-l-rhamnopyranoside were isolated from 200mg of crude sample II in a single run of HSCCC. A scale-up separation was also performed, and 160mg of robinin with 95% purity and 188mg of kaempferol 7-O-α-l-rhamnopyranoside with 97% purity were produced from 1.2g of crude sample II. Copyright © 2017 Elsevier B.V. All rights reserved.
Automated MALDI Matrix Coating System for Multiple Tissue Samples for Imaging Mass Spectrometry
Mounfield, William P.; Garrett, Timothy J.
2012-03-01
Uniform matrix deposition on tissue samples for matrix-assisted laser desorption/ionization (MALDI) is key for reproducible analyte ion signals. Current methods often result in nonhomogenous matrix deposition, and take time and effort to produce acceptable ion signals. Here we describe a fully-automated method for matrix deposition using an enclosed spray chamber and spray nozzle for matrix solution delivery. A commercial air-atomizing spray nozzle was modified and combined with solenoid controlled valves and a Programmable Logic Controller (PLC) to control and deliver the matrix solution. A spray chamber was employed to contain the nozzle, sample, and atomized matrix solution stream, and to prevent any interference from outside conditions as well as allow complete control of the sample environment. A gravity cup was filled with MALDI matrix solutions, including DHB in chloroform/methanol (50:50) at concentrations up to 60 mg/mL. Various samples (including rat brain tissue sections) were prepared using two deposition methods (spray chamber, inkjet). A linear ion trap equipped with an intermediate-pressure MALDI source was used for analyses. Optical microscopic examination showed a uniform coating of matrix crystals across the sample. Overall, the mass spectral images gathered from tissues coated using the spray chamber system were of better quality and more reproducible than from tissue specimens prepared by the inkjet deposition method.
Energy Technology Data Exchange (ETDEWEB)
Staahlberg, P.; Oesch, P.; Leppaemaeki, E.; Moilanen, A.; Nieminen, M.; Korhonen, J. [VTT Energy, Espoo (Finland)
1996-12-01
The reliability of sampling methods used for measuring impurities contained in gasification gas were studied, and new methods were developed for sampling and sample analyses. The aim of the method development was to improve the representativeness of the samples and to speed up the analysis of gas composition. The study focused on tar, nitrogen and sulphur compounds contained in the gasification gas. In the study of the sampling reliability, the effects of probe and sampling line materials suitable for high temperatures and of the solids deposited in the sampling devices on gas samples drawn from the process were studied. Measurements were carried out in the temperature range of 250 - 850 deg C both in real conditions and in conditions simulating gasification gas. The durability of samples during storage was also studied. The other main aim of the study was to increase the amount of quick-measurable gas components by developing on-line analytical methods based on GC, FTIR and FI (flow injection) techniques for the measurements of nitrogen and sulphur compounds in gasification gas. As these methods are suitable only for the gases that do not contain condensing gas components disturbing the operation of analysers (heavy tar compounds, water), a sampling system operating in dilution principle was developed. The system operates at high pressures and temperatures and is suitable for gasification gases containing heavy tar compounds. The capabilities of analysing heavy tar compounds (mole weight >200 g mol) was improved by adding the amount of compounds identified and calibrated by model substances and by developing analytical methods based on the high-temperature-GC analysis and the thermogravimetric method. (author)
Integration of treatment wetlands as sustainable wastewater management systems for small communities
Energy Technology Data Exchange (ETDEWEB)
Dahab, M.F.; Surampalli, R.Y. [Univ. of Nebraski-Lincoln, Dept. of Civil Engineering, Lincoln, NE (United States)
2002-06-15
This paper discuses the applicability as well as the integration of the constructed wetlands technology within the environmental infrastructure in small communities. To that end, a case study involving the use of Constructed wetlands (CW) for waste management in the Nebraska plains is presented. CW systems have been shown to be effective treatment alternatives in resource-limited small communities; and hence, can contribute to improving the economic well-being and the sustainability of many small communities. The paper specifically discusses the performance of subsurface-flow constructed wetlands systems used as the wastewater treatment process for a small community in eastern Nebraska and outlines operational experience gained through five years of plant operation. The results show that effective and sufficient CW seasonal removals of TSS, VSS, CBOD{sub 5}, COD, and fecal coliform were achieved. Wastewater temperatures seemed to affect CBOD{sub 5} and COD removal rates. Nitrogen and phosphorus reductions were not as effective and varied seasonally, as well as with wastewater temperature. The addition of a sand filter, to aid in further nitrification and disinfection following CW treatment, markedly improved the performance of the wetlands system. After a few years of operation, the performance of the system was dampened by apparent clogging and subsequent eruption of wastewater at the head-end of the treatment cells. While clogging was partially caused by biomass build-up in the wetlands substrate, visual observations suggest that excessive vegetation and relaxed maintenance may also be responsible. (author)
Integration of treatment wetlands as sustainable wastewater management systems for small communities
International Nuclear Information System (INIS)
Dahab, M.F.; Surampalli, R.Y.
2002-01-01
This paper discuses the applicability as well as the integration of the constructed wetlands technology within the environmental infrastructure in small communities. To that end, a case study involving the use of Constructed wetlands (CW) for waste management in the Nebraska plains is presented. CW systems have been shown to be effective treatment alternatives in resource-limited small communities; and hence, can contribute to improving the economic well-being and the sustainability of many small communities. The paper specifically discusses the performance of subsurface-flow constructed wetlands systems used as the wastewater treatment process for a small community in eastern Nebraska and outlines operational experience gained through five years of plant operation. The results show that effective and sufficient CW seasonal removals of TSS, VSS, CBOD 5 , COD, and fecal coliform were achieved. Wastewater temperatures seemed to affect CBOD 5 and COD removal rates. Nitrogen and phosphorus reductions were not as effective and varied seasonally, as well as with wastewater temperature. The addition of a sand filter, to aid in further nitrification and disinfection following CW treatment, markedly improved the performance of the wetlands system. After a few years of operation, the performance of the system was dampened by apparent clogging and subsequent eruption of wastewater at the head-end of the treatment cells. While clogging was partially caused by biomass build-up in the wetlands substrate, visual observations suggest that excessive vegetation and relaxed maintenance may also be responsible. (author)
International Nuclear Information System (INIS)
Puckett, J.M.
1998-01-01
Environmental Sampling (ES) is a technology option that can have application in transparency in nuclear nonproliferation. The basic process is to take a sample from the environment, e.g., soil, water, vegetation, or dust and debris from a surface, and through very careful sample preparation and analysis, determine the types, elemental concentration, and isotopic composition of actinides in the sample. The sample is prepared and the analysis performed in a clean chemistry laboratory (CCL). This ES capability is part of the IAEA Strengthened Safeguards System. Such a Laboratory is planned to be built by JAERI at Tokai and will give Japan an intrinsic ES capability. This paper presents options for the use of ES as a transparency measure for nuclear nonproliferation
Automated cell counts on CSF samples: A multicenter performance evaluation of the GloCyte system.
Hod, E A; Brugnara, C; Pilichowska, M; Sandhaus, L M; Luu, H S; Forest, S K; Netterwald, J C; Reynafarje, G M; Kratz, A
2018-02-01
Automated cell counters have replaced manual enumeration of cells in blood and most body fluids. However, due to the unreliability of automated methods at very low cell counts, most laboratories continue to perform labor-intensive manual counts on many or all cerebrospinal fluid (CSF) samples. This multicenter clinical trial investigated if the GloCyte System (Advanced Instruments, Norwood, MA), a recently FDA-approved automated cell counter, which concentrates and enumerates red blood cells (RBCs) and total nucleated cells (TNCs), is sufficiently accurate and precise at very low cell counts to replace all manual CSF counts. The GloCyte System concentrates CSF and stains RBCs with fluorochrome-labeled antibodies and TNCs with nucleic acid dyes. RBCs and TNCs are then counted by digital image analysis. Residual adult and pediatric CSF samples obtained for clinical analysis at five different medical centers were used for the study. Cell counts were performed by the manual hemocytometer method and with the GloCyte System following the same protocol at all sites. The limits of the blank, detection, and quantitation, as well as precision and accuracy of the GloCyte, were determined. The GloCyte detected as few as 1 TNC/μL and 1 RBC/μL, and reliably counted as low as 3 TNCs/μL and 2 RBCs/μL. The total coefficient of variation was less than 20%. Comparison with cell counts obtained with a hemocytometer showed good correlation (>97%) between the GloCyte and the hemocytometer, including at very low cell counts. The GloCyte instrument is a precise, accurate, and stable system to obtain red cell and nucleated cell counts in CSF samples. It allows for the automated enumeration of even very low cell numbers, which is crucial for CSF analysis. These results suggest that GloCyte is an acceptable alternative to the manual method for all CSF samples, including those with normal cell counts. © 2017 John Wiley & Sons Ltd.
Billings, Andrew; Kaiser, Carl; Young, Craig M.; Hiebert, Laurel S.; Cole, Eli; Wagner, Jamie K. S.; Van Dover, Cindy Lee
2017-03-01
The current standard for large-volume (thousands of cubic meters) zooplankton sampling in the deep sea is the MOCNESS, a system of multiple opening-closing nets, typically lowered to within 50 m of the seabed and towed obliquely to the surface to obtain low-spatial-resolution samples that integrate across 10 s of meters of water depth. The SyPRID (Sentry Precision Robotic Impeller Driven) sampler is an innovative, deep-rated (6000 m) plankton sampler that partners with the Sentry Autonomous Underwater Vehicle (AUV) to obtain paired, large-volume plankton samples at specified depths and survey lines to within 1.5 m of the seabed and with simultaneous collection of sensor data. SyPRID uses a perforated Ultra-High-Molecular-Weight (UHMW) plastic tube to support a fine mesh net within an outer carbon composite tube (tube-within-a-tube design), with an axial flow pump located aft of the capture filter. The pump facilitates flow through the system and reduces or possibly eliminates the bow wave at the mouth opening. The cod end, a hollow truncated cone, is also made of UHMW plastic and includes a collection volume designed to provide an area where zooplankton can collect, out of the high flow region. SyPRID attaches as a saddle-pack to the Sentry vehicle. Sentry itself is configured with a flight control system that enables autonomous survey paths to low altitudes. In its verification deployment at the Blake Ridge Seep (2160 m) on the US Atlantic Margin, SyPRID was operated for 6 h at an altitude of 5 m. It recovered plankton samples, including delicate living larvae, from the near-bottom stratum that is seldom sampled by a typical MOCNESS tow. The prototype SyPRID and its next generations will enable studies of plankton or other particulate distributions associated with localized physico-chemical strata in the water column or above patchy habitats on the seafloor.
Energy Technology Data Exchange (ETDEWEB)
Rodríguez, Rogelio [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Borràs, Antoni [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Leal, Luz [Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Cerdà, Víctor [Department of Chemistry, University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Ferrer, Laura, E-mail: laura.ferrer@uib.es [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain)
2016-03-10
An automatic system based on multisyringe flow injection analysis (MSFIA) and lab-on-valve (LOV) flow techniques for separation and pre-concentration of {sup 226}Ra from drinking and natural water samples has been developed. The analytical protocol combines two different procedures: the Ra adsorption on MnO{sub 2} and the BaSO{sub 4} co-precipitation, achieving more selectivity especially in water samples with low radium levels. Radium is adsorbed on MnO{sub 2} deposited on macroporous of bead cellulose. Then, it is eluted with hydroxylamine to transform insoluble MnO{sub 2} to soluble Mn(II) thus freeing Ra, which is then coprecipitated with BaSO{sub 4}. The {sup 226}Ra can be directly detected in off-line mode using a low background proportional counter (LBPC) or through a liquid scintillation counter (LSC), after performing an on-line coprecipitate dissolution. Thus, the versatility of the proposed system allows the selection of the radiometric detection technique depending on the detector availability or the required response efficiency (sample number vs. response time and limit of detection). The MSFIA-LOV system improves the precision (1.7% RSD), and the extraction frequency (up to 3 h{sup −1}). Besides, it has been satisfactorily applied to different types of water matrices (tap, mineral, well and sea water). The {sup 226}Ra minimum detectable activities (LSC: 0.004 Bq L{sup −1}; LBPC: 0.02 Bq L{sup −1}) attained by this system allow to reach the guidance values proposed by the relevant international agencies e.g. WHO, EPA and EC. - Highlights: • Automatic, rapid and selective method for {sup 226}Ra extraction/pre-concentration from water. • MSFIA-LOV system performs a sample clean-up prior to {sup 226}Ra radiometric detection. • {sup 226}Ra sample preparation allows using two radiometric detectors (LBPC and LSC). • Environmental levels of {sup 226}Ra are easily quantified. • High sensitivity and selectivity are achieved, reaching the
Meng, Su; Chen, Jie; Sun, Jian
2017-10-01
This paper investigates the problem of observer-based output feedback control for networked control systems with non-uniform sampling and time-varying transmission delay. The sampling intervals are assumed to vary within a given interval. The transmission delay belongs to a known interval. A discrete-time model is first established, which contains time-varying delay and norm-bounded uncertainties coming from non-uniform sampling intervals. It is then converted to an interconnection of two subsystems in which the forward channel is delay-free. The scaled small gain theorem is used to derive the stability condition for the closed-loop system. Moreover, the observer-based output feedback controller design method is proposed by utilising a modified cone complementary linearisation algorithm. Finally, numerical examples illustrate the validity and superiority of the proposed method.
Lifescience Database Archive (English)
Full Text Available avtlllelhlhvmhfvtq*lhvqmdllmevklfhlhlfqtvnskvqvhliaqql i*kv*watgntks*nlylqlliyiqvv**edlc*vlvf*sdsyw*svh*vss*...nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnkk kckytinslsy*cnhnktsrkffkeqnki Frame B: ---hic
Evaluation of the Purge Water Management System (PWMS) monitor well sampling technology at SRS
International Nuclear Information System (INIS)
Hiergesell, R.A.; Cardoso-Neto, J.E.; Williams, D.W.
1997-01-01
Due to the complex issues surrounding Investigation Derived Waste (IDW) at SRS, the Environmental Restoration Division has been exploring new technologies to deal with the purge water generated during monitoring well sampling. Standard procedures for sampling generates copious amounts of purge water that must be managed as hazardous waste, when containing hazardous and/or radiological contaminants exceeding certain threshold levels. SRS has obtained Regulator approval to field test an innovative surface release prevention mechanism to manage purge water. This mechanism is referred to as the Purge Water Management System (PWMS) and consists of a collapsible bladder situated within a rigid metal tank
Credit in Acceptance Sampling on Attributes
Klaassen, Chris A.J.
2000-01-01
Credit is introduced in acceptance sampling on attributes and a Credit Based Acceptance sampling system is developed that is very easy to apply in practice.The credit of a producer is defined as the total number of items accepted since the last rejection.In our sampling system the sample size for a
Jo, Su Yeon; Lee, Ju Mi; Kim, Hye Lim; Sin, Kyeong Hwa; Lee, Hyeon Ji; Chang, Chulhun Ludgerus; Kim, Hyung-Hoi
2016-01-01
Background ABO blood typing in pre-transfusion testing is a major component of the high workload in blood banks that therefore requires automation. We often experienced discrepant results from an automated system, especially weak serum reactions. We evaluated the discrepant results by the reference manual method to confirm ABO blood typing. Methods In total, 13,113 blood samples were tested with the AutoVue system; all samples were run in parallel with the reference manual method according to...
DEFF Research Database (Denmark)
Fratini, Gerardo; Ibrom, Andreas; Arriga, Nicola
2012-01-01
It has been formerly recognised that increasing relative humidity in the sampling line of closed-path eddy-covariance systems leads to increasing attenuation of water vapour turbulent fluctuations, resulting in strong latent heat flux losses. This occurrence has been analyzed for very long (50 m...... from eddy-covariance systems featuring short (4 m) and very short (1 m) sampling lines running at the same clover field and show that relative humidity effects persist also for these setups, and should not be neglected. Starting from the work of Ibrom and co-workers, we propose a mixed method...... and correction method proposed here is deemed applicable to closed-path systems featuring a broad range of sampling lines, and indeed applicable also to passive gases as a special case. The methods described in this paper are incorporated, as processing options, in the free and open-source eddy...
Papini, Paolo; Faustini, Annunziata; Manganello, Rosa; Borzacchi, Giancarlo; Spera, Domenico; Perucci, Carlo A
2005-01-01
To determine the frequency of sampling in small water distribution systems (distribution. We carried out two sampling programs to monitor the water distribution system in a town in Central Italy between July and September 1992; the Poisson distribution assumption implied 4 water samples, the assumption of negative binomial distribution implied 21 samples. Coliform organisms were used as indicators of water safety. The network consisted of two pipe rings and two wells fed by the same water source. The number of summer customers varied considerably from 3,000 to 20,000. The mean density was 2.33 coliforms/100 ml (sd= 5.29) for 21 samples and 3 coliforms/100 ml (sd= 6) for four samples. However the hypothesis of homogeneity was rejected (p-value samples (beta= 0.24) than with 21 (beta= 0.05). For this small network, determining the samples' size according to heterogeneity hypothesis strengthens the statement that water is drinkable compared with homogeneity assumption.
21 CFR 864.3260 - OTC test sample collection systems for drugs of abuse testing.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false OTC test sample collection systems for drugs of abuse testing. 864.3260 Section 864.3260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Pathology...
Novel Sample-handling Approach for XRD Analysis with Minimal Sample Preparation
Sarrazin, P.; Chipera, S.; Bish, D.; Blake, D.; Feldman, S.; Vaniman, D.; Bryson, C.
2004-01-01
Sample preparation and sample handling are among the most critical operations associated with X-ray diffraction (XRD) analysis. These operations require attention in a laboratory environment, but they become a major constraint in the deployment of XRD instruments for robotic planetary exploration. We are developing a novel sample handling system that dramatically relaxes the constraints on sample preparation by allowing characterization of coarse-grained material that would normally be impossible to analyze with conventional powder-XRD techniques.
Enhanced reduction of excess sludge and nutrient removal in a pilot-scale A2O-MBR-TAD system.
Ventura, J S; Seo, S; Chung, I; Yeom, I; Kim, H; Oh, Y; Jahng, D
2011-01-01
In this study, a pilot scale anaerobic-anoxic-oxic (A2O) process with submerged membrane (MBR) in the oxic tank was coupled with thermophilic aerobic digestion (TAD) reactor and was operated for longer than 600 days to treat real domestic wastewater. Regardless of the varying conditions of the system, the A2O-MBR-TAD process removed MLSS, TCOD, BOD, TN, TP, and E. coli about 99%, 96%, 96%, 70%, 83%, and 99%, respectively. The additional TP removal of the system was due to the precipitating agent directly added in the oxic reactor, without which TP removal was about 56%. In the TAD reactor, receiving MLSS from the oxic tank (MBR), about 25% of TSS and VSS were solubilized during 2 days of retention. The effluent of the TAD reactor was recycled into the anoxic tank of A2O-MBR to provide organic carbon for denitrification and cryptic growth. By controlling the flowrate of wasting stream from the MBR, sludge production decreased to almost zero. From these results, it was concluded that the A2O-MBR-TAD process could be a reliable option for excellent effluent quality and near zero-sludge production.
Energy Technology Data Exchange (ETDEWEB)
Ricketts, K., E-mail: k.ricketts@ucl.ac.uk [Division of Surgery and Interventional Sciences, University College London, Royal Free Campus, Rowland Hill Street, London NW3 2PF (United Kingdom); Guazzoni, C.; Castoldi, A. [Dipartimento di Elettronica, Informazione e Bioingegneria Politecnico di Milano and INFN, Sezione di Milano P.za Leonardo da Vinci, 32-20133 Milano (Italy); Royle, G. [Department of Medical Physics and Bioengineering, University College London, Malet Place Engineering Building, Gower Street, London WC1E 6BT (United Kingdom)
2016-04-21
Gold nanoparticles can be targeted to biomarkers to give functional information on a range of tumour characteristics. X-ray fluorescence (XRF) techniques offer potential quantitative measurement of the distribution of such heavy metal nanoparticles. Biologists are developing 3D tissue engineered cellular models on the centimetre scale to optimise targeting techniques of nanoparticles to a range of tumour characteristics. Here we present a high energy bench-top K-X-ray fluorescence system designed for sensitivity to bulk measurement of gold nanoparticle concentration for intended use in such thick biological samples. Previous work has demonstrated use of a L-XRF system in measuring gold concentrations but being a low energy technique it is restricted to thin samples or superficial tumours. The presented system comprised a high purity germanium detector and filtered tungsten X-ray source, capable of quantitative measurement of gold nanoparticle concentration of thicker samples. The developed system achieved a measured detection limit of between 0.2 and 0.6 mgAu/ml, meeting specifications of biologists and being approximately one order of magnitude better than the detection limit of alternative K-XRF nanoparticle detection techniques. The scatter-corrected K-XRF signal of gold was linear with GNP concentrations down to the detection limit, thus demonstrating potential in GNP concentration quantification. The K-XRF system demonstrated between 5 and 9 times less sensitivity than a previous L-XRF bench-top system, due to a fundamental limitation of lower photoelectric interaction probabilities at higher K-edge energies. Importantly, the K-XRF technique is however less affected by overlying thickness, and so offers future potential in interrogating thick biological samples.
Loge, G.
1994-09-01
Using hardware and materials supplied by LANL, a prototype quadrupole mass spectrometer system designed for portable field analysis of isotopic composition of solid uranium samples was assembled and tested. The system contained the capability for fluorine volatilization of solid uranium samples with gas introduction, which was successfully tested and demonstrated using 100 mg samples of U3O8. Determination of precision and accuracy for measuring isotopic composition was performed using isotopic standards. Use with soil samples containing uranium were also attempted. Silicates in the soil forming SiF4 were found to be a kinetic bottleneck to the formation of UF6. This could be avoided by performing some sort of chemical separation as a pre-treatment step, which was demonstrated using nitric acid.
Quantifying Configuration-Sampling Error in Langevin Simulations of Complex Molecular Systems
Directory of Open Access Journals (Sweden)
Josh Fass
2018-04-01
Full Text Available While Langevin integrators are popular in the study of equilibrium properties of complex systems, it is challenging to estimate the timestep-induced discretization error: the degree to which the sampled phase-space or configuration-space probability density departs from the desired target density due to the use of a finite integration timestep. Sivak et al., introduced a convenient approach to approximating a natural measure of error between the sampled density and the target equilibrium density, the Kullback-Leibler (KL divergence, in phase space, but did not specifically address the issue of configuration-space properties, which are much more commonly of interest in molecular simulations. Here, we introduce a variant of this near-equilibrium estimator capable of measuring the error in the configuration-space marginal density, validating it against a complex but exact nested Monte Carlo estimator to show that it reproduces the KL divergence with high fidelity. To illustrate its utility, we employ this new near-equilibrium estimator to assess a claim that a recently proposed Langevin integrator introduces extremely small configuration-space density errors up to the stability limit at no extra computational expense. Finally, we show how this approach to quantifying sampling bias can be applied to a wide variety of stochastic integrators by following a straightforward procedure to compute the appropriate shadow work, and describe how it can be extended to quantify the error in arbitrary marginal or conditional distributions of interest.
Rorschach Comprehensive System data for a sample of 141 adult nonpatients from Denmark.
Ivanouw, Jan
2007-01-01
A sample (n = 141) of Danish nonpatients 25-50 years of age, never hospitalized with a psychiatric diagnosis and currently employed, was demographically representative of two geographical areas of Copenhagen with different social strain. The sample, as well as 45 persons not currently employed, was tested with the Rorschach (Exner, 1995), MMPI-2 (Butcher, Dahlstrom, Graham, Tellegen, & Kaemmer, 1989), Word Association Test (Ivanouw, 1999b), WAIS Comprehension subtest (Hess, 1974), and SCL-90-R (Olsen, Mortenson, & Bech, 2006). Half of the persons contacted volunteered for the study. There was no difference in rate of volunteering between a standard no-feedback condition and a feedback condition; the latter, however, tended to attract more psychologically resourceful persons. The employed persons tended to appear healthier than the not employed. Response style of the subjects, quality of the Rorschach protocols, reliability of scoring, and the effect of the data being grouped on geographical area and examiner were examined. Form level, color, texture, cooperative movement, and EA were lower than in the Comprehensive System (CS; n = 450) sample, but higher than in nine international nonpatient Rorschach studies. Unique for the Danish sample was a low number of animal movement answers. The Rorschach data showed women to be healthier than men. Differences in Rorschach variables based on educational level were small.
Liu, Junwei; Deng, Zhifen; Zhu, Zuoyi; Wang, Yong; Wang, Guoqing; Sun, Yu-An; Zhu, Yan
2017-12-15
A two-dimensional ion chromatography system was developed for the determination of γ-hydroxybutyrate (GHB) in human urine samples. Ion exclusion chromatography was used in the first dimensional separation for elimination of urine matrices and detection of GHB above 10mgL -1 , ion exchange chromatography was used in the second dimensional separation via column-switching technique for detection of GHB above 0.08mgL -1 . Under the optimized chromatographic conditions, the ion exclusion and ion exchange chromatography separation system exhibited satisfactory repeatability (RSDchromatography system was convenient and practical for the determination of GHB in human urine samples. Copyright © 2017 Elsevier B.V. All rights reserved.
Quantitative portable gamma spectroscopy sample analysis for non-standard sample geometries
International Nuclear Information System (INIS)
Enghauser, M.W.; Ebara, S.B.
1997-01-01
Utilizing a portable spectroscopy system, a quantitative method for analysis of samples containing a mixture of fission and activation products in nonstandard geometries was developed. The method can be used with various sample and shielding configurations where analysis on a laboratory based gamma spectroscopy system is impractical. The portable gamma spectroscopy method involves calibration of the detector and modeling of the sample and shielding to identify and quantify the radionuclides present in the sample. The method utilizes the intrinsic efficiency of the detector and the unattenuated gamma fluence rate at the detector surface per unit activity from the sample to calculate the nuclide activity and Minimum Detectable Activity (MDA). For a complex geometry, a computer code written for shielding applications (MICROSHIELD) is utilized to determine the unattenuated gamma fluence rate per unit activity at the detector surface. Lastly, the method is only applicable to nuclides which emit gamma rays and cannot be used for pure beta emitters. In addition, if sample self absorption and shielding is significant, the attenuation will result in high MDA's for nuclides which solely emit low energy gamma rays. The following presents the analysis technique and presents verification results demonstrating the accuracy of the method
International Nuclear Information System (INIS)
Campolina, Daniel de Almeida Magalhães
2015-01-01
There is an uncertainty for all the components that comprise the model of a nuclear system. Assessing the impact of uncertainties in the simulation of fissionable material systems is essential for a realistic calculation that has been replacing conservative model calculations as the computational power increases. The propagation of uncertainty in a simulation using a Monte Carlo code by sampling the input parameters is recent because of the huge computational effort required. By analyzing the propagated uncertainty to the effective neutron multiplication factor (k eff ), the effects of the sample size, computational uncertainty and efficiency of a random number generator to represent the distributions that characterize physical uncertainty in a light water reactor was investigated. A program entitled GB s ample was implemented to enable the application of the random sampling method, which requires an automated process and robust statistical tools. The program was based on the black box model and the MCNPX code was used in and parallel processing for the calculation of particle transport. The uncertainties considered were taken from a benchmark experiment in which the effects in k eff due to physical uncertainties is done through a conservative method. In this work a script called GB s ample was implemented to automate the sampling based method, use multiprocessing and assure the necessary robustness. It has been found the possibility of improving the efficiency of the random sampling method by selecting distributions obtained from a random number generator in order to obtain a better representation of uncertainty figures. After the convergence of the method is achieved, in order to reduce the variance of the uncertainty propagated without increase in computational time, it was found the best number o components to be sampled. It was also observed that if the sampling method is used to calculate the effect on k eff due to physical uncertainties reported by
Kim, Taehong; O'Neal, Dennis L; Ortiz, Carlos
2006-09-01
Air duct systems in nuclear facilities must be monitored with continuous sampling in case of an accidental release of airborne radionuclides. The purpose of this work is to identify the air sampling locations where the velocity and contaminant concentrations fall below the 20% coefficient of variation required by the American National Standards Institute/Health Physics Society N13.1-1999. Experiments of velocity and tracer gas concentration were conducted on a generic "T" mixing system which included combinations of three sub ducts, one main duct, and air velocities from 0.5 to 2 m s (100 to 400 fpm). The experimental results suggest that turbulent mixing provides the accepted velocity coefficients of variation after 6 hydraulic diameters downstream of the T-junction. About 95% of the cases achieved coefficients of variation below 10% by 6 hydraulic diameters. However, above a velocity ratio (velocity in the sub duct/velocity in the main duct) of 2, velocity profiles were uniform in a shorter distance downstream of the T-junction as the velocity ratio went up. For the tracer gas concentration, the distance needed for the coefficients of variation to drop 20% decreased with increasing velocity ratio due to the sub duct airflow momentum. The results may apply to other duct systems with similar geometries and, ultimately, be a basis for selecting a proper sampling location under the requirements of single point representative sampling.
miniPixD : a compact sample analysis system which combines X-ray imaging and diffraction
International Nuclear Information System (INIS)
Moss, Robert; Crews, Chiaki; Speller, Robert; Wilson, Matthew
2017-01-01
This paper introduces miniPixD : a new, compact system that utilises transmission X-ray imaging and X-ray diffraction (XRD) to locate and identify materials of interest within an otherwise opaque volume. The system and the embodied techniques have utility in security screening, medical diagnostics, non-destructive testing (NDT) and quality assurance (QA). This paper outlines the design of the system including discussion on the choice of components and presents some data from relevant samples which are compared to other energy dispersive and angular dispersive XRD techniques.
Kolla, Nathan J; Dunlop, Katharine; Downar, Jonathan; Links, Paul; Bagby, R Michael; Wilson, Alan A; Houle, Sylvain; Rasquinha, Fawn; Simpson, Alexander I; Meyer, Jeffrey H
2016-04-01
Impulsivity is a core feature of antisocial personality disorder (ASPD) associated with abnormal brain function and neurochemical alterations. The ventral striatum (VS) is a key region of the neural circuitry mediating impulsive behavior, and low monoamine oxidase-A (MAO-A) level in the VS has shown a specific relationship to the impulsivity of ASPD. Because it is currently unknown whether phenotypic MAO-A markers can influence brain function in ASPD, we investigated VS MAO-A level and the functional connectivity (FC) of two seed regions, superior and inferior VS (VSs, VSi). Nineteen impulsive ASPD males underwent [(11)C] harmine positron emission tomography scanning to measure VS MAO-A VT, an index of MAO-A density, and resting-state functional magnetic resonance imaging that assessed the FC of bilateral seed regions in the VSi and VSs. Subjects also completed self-report impulsivity measures. Results revealed functional coupling of the VSs with bilateral dorsomedial prefrontal cortex (DMPFC) that was correlated with VS MAO-A VT (r=0.47, p=0.04), and functional coupling of the VSi with right hippocampus that was anti-correlated with VS MAO-A VT (r=-0.55, p=0.01). Additionally, VSs-DMPFC FC was negatively correlated with NEO Personality Inventory-Revised impulsivity (r=-0.49, p=0.03), as was VSi-hippocampus FC with Barratt Impulsiveness Scale-11 motor impulsiveness (r=-0.50, p=0.03). These preliminary results highlight an association of VS MAO-A level with the FC of striatal regions linked to impulsive behavior in ASPD and suggest that phenotype-based brain markers of ASPD have relevance to understanding brain function. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.
Valley–spin Seebeck effect in heavy group-IV monolayers
International Nuclear Information System (INIS)
Zhai, Xuechao; Wang, Shengdong; Zhang, Yan
2017-01-01
Akin to electron spin, the valley has become another highly valued degree of freedom in modern electronics, specifically after tremendous studies on monolayers of group-IV materials, i.e. graphene, silicene, germanene and stanene. Except for graphene, the other heavy group-IV monolayers have observable intrinsic spin–orbit interactions due to their buckled structures. Distinct from the usual electric or optical control of valley and spin, we here employ a temperature difference to drive electron motion in ferromagnetic heavy group-IV monolayers via designing a caloritronic device locally modulated by an interlayer electric (E z ) field. A unique valley–spin Seebeck (VSS) effect is discovered, with the current contributed only by one (the other) valley and one (the other) spin moving along one (the opposite) direction. This effect is suggested to be detected below the critical temperature about 18 K for silicene, 200 K for germanene and 400 K for stanene, arising from the characteristic valley–spin nondegenerate band structures tuned by the E z field, but cannot be driven in graphene without spin–orbit interaction. Above the critical temperature, the VSS effect is broken by overlarge temperature broadening. Besides the temperature, it is also found that the E z field can drive a transition between the VSS effect and the normal spin Seebeck effect. Further calculations indicate that the VSS effect is robust against many realistic perturbations. Our research represents a conceptually but substantially major step towards the study of the Seebeck effect. These findings provide a platform for encoding information simultaneously by the valley and spin quantum numbers of electrons in future thermal-logic circuits and energy-saving devices. (paper)
Ye, Min; Nagar, Swati; Korzekwa, Ken
2016-04-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data were often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding and the blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate the model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for the terminal elimination half-life (t1/2 , 100% of drugs), peak plasma concentration (Cmax , 100%), area under the plasma concentration-time curve (AUC0-t , 95.4%), clearance (CLh , 95.4%), mean residence time (MRT, 95.4%) and steady state volume (Vss , 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Energy Technology Data Exchange (ETDEWEB)
Bryan, Charles R.; Enos, David
2016-10-01
In July, 2016, the Electric Power Research Institute and industry partners performed a field test at the Maine Yankee Nuclear Site, located near Wiscasset, Maine. The primary goal of the field test was to evaluate the use of robots in surveying the surface of an in-service interim storage canister within an overpack; however, as part of the demonstration, dust and soluble salt samples were collected from horizontal surfaces within the interim storage system. The storage system is a vertical system made by NAC International, consisting of a steel-lined concrete overpack containing a 304 stainless steel (SS) welded storage canister. The canister did not contain spent fuel but rather greater-than-class-C waste, which did not generate significant heat, limiting airflow through the storage system. The surfaces that were sampled for deposits included the top of the shield plug, the side of the canister, and a shelf at the bottom of the overpack, just below the level of the pillar on which the canister sits. The samples were sent to Sandia National Laboratories for analysis. This report summarizes the results of those analyses. Because the primary goal of the field test was to evaluate the use of robots in surveying the surface of the canister within the overpack, collection of dust samples was carried out in a qualitative fashion, using paper filters and sponges as the sampling media. The sampling focused mostly on determining the composition of soluble salts present in the dust. It was anticipated that a wet substrate would more effectively extract soluble salts from the surface that was sampled, so both the sponges and the filter paper were wetted prior to being applied to the surface of the metal. Sampling was accomplished by simply pressing the damp substrate against the metal surface for two minutes, and then removing it. It is unlikely that the sampling method quantitatively collected dust or salts from the metal surface; however, both substrates did extract a
Directory of Open Access Journals (Sweden)
José Tavares de Sousa
2013-01-01
Full Text Available This work applied a Compact System consisting of a Reactor Up flow Sludge Blanket (UASB in conjunction with s Submerged Anaerobic Filter containing polyurethane cubes as support media, followed by a Solar Photolytic R eactor. The compact anaerobic system produced a clarified effluent with low concentration of organic matter, especially dissolved (20 mg .VSS/L, and free of helminthes eggs. These low concentrations of suspended solids facilitated photolytic disinfection process producing a good quality final effluent, of which 90% of the samples were thoroughly disinfected, while the other fraction showed concentration of Thermotolerant Coliform (TTC at or below 100 CFU/100 mL and high concentrations of nutrients (48 mg . NH 4 + -N/L and 6,4mg PO 4 -3 - P/L enabling the use of irrigation for productive purposes. Another advantages of the compact anaerobic treatment consisted of low sludge production, and relatively simple operation without energy consumption. These advantages results in a significant reduction in operational costs of sewage treatment, and, indeed, an outlet for developing countries in tropical climate.
Irradiation chamber and sample changer for biological samples
International Nuclear Information System (INIS)
Kraft, G.; Daues, H.W.; Fischer, B.; Kopf, U.; Liebold, H.P.; Quis, D.; Stelzer, H.; Kiefer, J.; Schoepfer, F.; Schneider, E.
1980-01-01
This paper describes an irradiaton system with which living cells of different origin are irradiated with heavy ion beams (18 <- Z <- 92) at energies up to 10 MeV/amu. The system consists of a beam monitor connected to the vacuum system of the accelerator and the irradiation chamber, containing the biological samples under atmospheric pressure. The requirements and aims of the set up are discussed. The first results with saccharomyces cerevisiae and Chinese Hamster tissue cells are presented. (orig.)
Sample Preprocessing For Atomic Spectrometry
International Nuclear Information System (INIS)
Kim, Sun Tae
2004-08-01
This book gives descriptions of atomic spectrometry, which deals with atomic absorption spectrometry such as Maxwell-Boltzmann equation and Beer-Lambert law, atomic absorption spectrometry for solvent extraction, HGAAS, ETASS, and CVAAS and inductively coupled plasma emission spectrometer, such as basic principle, generative principle of plasma and device and equipment, and interferences, and inductively coupled plasma mass spectrometry like device, pros and cons of ICP/MS, sample analysis, reagent, water, acid, flux, materials of experiments, sample and sampling and disassembling of sample and pollution and loss in open system and closed system.
Directory of Open Access Journals (Sweden)
Ning-Cong Xiao
2013-12-01
Full Text Available In this paper the combinations of maximum entropy method and Bayesian inference for reliability assessment of deteriorating system is proposed. Due to various uncertainties, less data and incomplete information, system parameters usually cannot be determined precisely. These uncertainty parameters can be modeled by fuzzy sets theory and the Bayesian inference which have been proved to be useful for deteriorating systems under small sample sizes. The maximum entropy approach can be used to calculate the maximum entropy density function of uncertainty parameters more accurately for it does not need any additional information and assumptions. Finally, two optimization models are presented which can be used to determine the lower and upper bounds of systems probability of failure under vague environment conditions. Two numerical examples are investigated to demonstrate the proposed method.
Analytical Chemistry Division's sample transaction system
International Nuclear Information System (INIS)
Stanton, J.S.; Tilson, P.A.
1980-10-01
The Analytical Chemistry Division uses the DECsystem-10 computer for a wide range of tasks: sample management, timekeeping, quality assurance, and data calculation. This document describes the features and operating characteristics of many of the computer programs used by the Division. The descriptions are divided into chapters which cover all of the information about one aspect of the Analytical Chemistry Division's computer processing
Using sampled-data feedback control and linear feedback synchronization in a new hyperchaotic system
International Nuclear Information System (INIS)
Zhao Junchan; Lu Junan
2008-01-01
This paper investigates control and synchronization of a new hyperchaotic system which was proposed by [Chen A, Lu J-A, Lue J, Yu S. Generating hyperchaotic Lue attractor via state feedback control. Physica A 2006;364:103-10]. Firstly, we give different sampled-data feedback control schemes with the variation of system parameter d. Specifically, we only use one controller to drive the system to the origin when d element of (-0.35, 0), and use two controllers if d element of [0, 1.3]. Next, we combine PC method with linear feedback approach to realize synchronization, and derive similar conclusions with varying d. Numerical simulations are also given to validate the proposed approaches
Directory of Open Access Journals (Sweden)
S. Alonso-Quesada
2010-01-01
Full Text Available This paper presents a strategy for designing a robust discrete-time adaptive controller for stabilizing linear time-invariant (LTI continuous-time dynamic systems. Such systems may be unstable and noninversely stable in the worst case. A reduced-order model is considered to design the adaptive controller. The control design is based on the discretization of the system with the use of a multirate sampling device with fast-sampled control signal. A suitable on-line adaptation of the multirate gains guarantees the stability of the inverse of the discretized estimated model, which is used to parameterize the adaptive controller. A dead zone is included in the parameters estimation algorithm for robustness purposes under the presence of unmodeled dynamics in the controlled dynamic system. The adaptive controller guarantees the boundedness of the system measured signal for all time. Some examples illustrate the efficacy of this control strategy.