Basis for developing samarium AMS for fuel cycle analysis

International Nuclear Information System (INIS)

Buchholz, Bruce A.; Biegalski, Steven R.; Whitney, Scott M.; Tumey, Scott J.; Jordan Weaver, C.

2010-01-01

Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of 146 Sm, 149 Sm, and 151 Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

4f and 5d magnetism in samarium

International Nuclear Information System (INIS)

Stunault, A.; Bernhoeft, N.; Vettier, C.; Dumesnil, K.; Dufour, C.

2001-01-01

We report on resonant magnetic X-ray scattering studies of a samarium epitaxial film at the samarium L 3 edge. We observe one quadrupolar resonance below the edge, reflecting the polarization of the 4f electrons, and two dipolar resonances above the edge, related to the polarization of the 5d band. We demonstrate, by following the thermal evolution of resonant magnetic intensities of both types, that the polarization of the 4f and 5d electrons present exactly the same temperature dependence, even very close to the ordering temperature, in agreement with the RKKY model for long-range magnetic order in rare earths

Studies on ultrasonic velocity and electrical conductivity of samarium soaps in non-aqueous medium

International Nuclear Information System (INIS)

Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

1990-01-01

The ultrasonic velocity of solutions of samarium soaps in non-aqueous medium has been measured at a constant temperature and the results have been used to evaluate the various acoustic parameters. The pre-micellar association and the formation of micelles in samarium soap solutions have been determined by conductometric measurements. The molar conductance at infinite dilution, degree of ionisation and ionisation constant have been evaluated. The results show that samarium soaps behave as weak electrolyte in dilute solutions. (Authors)

Diffusion of samarium into cobalt in the reduction-diffusion process

International Nuclear Information System (INIS)

Freitas Nogueira, P. de; Neto, F.B.; Landgraf, F.J.G.

1998-01-01

The presence of metallic cobalt in samarium-cobalt powders is a major cause for low magnetic properties in magnets. This paper intends to investigate the effect of time and temperature in the microstructure of powders produced by reduction-diffusion. This process, developed for the production of rare earth-transition metal alloys, consists on the reduction of the rare earth oxide with metallic calcium (or calcium hydride) and its subsequent diffusion into the cobalt particle. In the present work, a mixture of samarium oxide, cobalt powder and metallic calcium was heated to 1100 or 1200 C for 2 or 4 hours in a tubular furnace under one atmosphere of purified argon. The material thereof obtained, a sintered mass is disintegrated by aqueous crepitation. The powder was evaluated in terms of its chemical composition, its samarium yield and the intermetallic compounds present. The samarium, oxygen and calcium content of the powders produced were adequate for magnet production. However, despite the massive formation of the SmCo 5 compound after 2 hours at 1100 C, final homogeneity is attained only after 4 hours at 1200 C, with the presence of SmCo 5 and Sm 2 Co 7 and the absence of the Sm 5 Co 19 compound. Also, metallic cobalt and Sm 2 Co 17 were observed in the materials produced after 2 hours at 1100 or 1200 C. (orig.)

Nonlinear Faraday rotation in samarium vapor

International Nuclear Information System (INIS)

Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

1988-01-01

Experiments on nonlinear magnetic optical (Faraday) rotation on resonance transitions of atomic samarium are described. Measurements were carried out on transitions with different angular momenta of upper and lower states: 1→0, 0→1 and 1→1. Qualitative explanations of observed phenomena are given

Plasma sprayed samarium--cobalt permanent magnets

International Nuclear Information System (INIS)

Willson, M.C.; Janowiecki, R.J.

1975-01-01

Samarium--Co permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating Co--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--Co magnets, sprayed from Sm-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million G-Oe and coercive forces of approximately 6000 Oe. Bar magnet arrays were constructed by depositing magnets on ceramic substrates

Magnetoresistance of samarium in the 4.2-300 K range

International Nuclear Information System (INIS)

Trubitsyn, V.A.; Shalashov, V.F.

1980-01-01

Electric conductivity, transverse and longitudinal magnetoresistance of polycrystalline samarium with the purity of 99.9% in the 4.2-300 K temperature range and in magnetic fields up to 50 ke, are measured. The constituent of specific electric conductivity caused by spin disorder is 30.7 μOhmxcm, m*/m=2.6, the exchange parameter is G=3.1 eVxA 3 . Both transverse and longitudinal magnetoresistance are positive at 4.2 K; and the increase of temperature reveals a number of anomalies, evidently conditioned by the alteration of samarium magnetic structure

Conductometric investigations on samarium soaps

International Nuclear Information System (INIS)

Mehrotra, K.N.; Chauhan, Mithlesh; Shukla, R.K.

1989-01-01

The critical micelle concentration (CMC), degree of dissociation and dissociation constant of samarium soaps (valerate, caproate, caprylate and caprate) in a mixture of 60 per cent benzene and 40 per cent methanol were determined by using conductometric measurements. The soaps behaved as simple electrolyte in dilute solutions and the CMC was found to decrease with increasing chainlength of the fatty acid constituent of the soap. (author). 7 refs., 2 tabs

Optical isotope shifts for unstable samarium isotopes

International Nuclear Information System (INIS)

Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; Grant, I.S.; England, J.G.; Fawcett, M.J.

1984-01-01

Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144 Sm and 154 Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

The samarium Grignard reaction. In situ formation and reactions of primary and secondary alkylsamarium(III) reagents

Energy Technology Data Exchange (ETDEWEB)

Curran, D.P.; Totleben, M.J. [Univ. of Pittsburgh, PA (United States)

1992-07-15

This work shows that primary and secondary radicals are rapidly reduced in THF/HMPA to form primary- and secondary-alkylsamarium reagents. The primary- and secondary-radicals can be formed either by direct SmI{sup 2} reductions of primary- and secondary-halides or by a previous rapid radical cyclization. The samarium reagents have moderate stability in solution, and they react with a variety of typical electrophiles, including aldehydes and ketones. The work further shows that organosamarium intermediates can be involved in the traditional samarium Barbier reaction of aldehydes and ketones conducted in THF/HMPA. A new procedure called the {open_quotes}samarium Grignard{close_quotes} method is introduced, and it is suggested that this new procedure will have considerably more scope and generality than the samarium Barbier reaction. 37 refs., 4 tabs.

Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

Energy Technology Data Exchange (ETDEWEB)

Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

1992-08-24

When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

International Nuclear Information System (INIS)

Shaorong Liu; Jian Meng; Wenhua Liu

1992-01-01

When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

ppt level detection of samarium(III) with a coated graphite sensor based on an antibiotic.

Science.gov (United States)

Ganjali, Mohammad Reza; Rezapour, Morteza; Pourjavid, Mohammad Reza; Haghgoo, Soheila

2004-07-01

N-[2-[4-[[[(Cyclohexylamino)carbonyl]amino]sulfonyl]phenyl]ethyl]-5-methyl pyrazine carboxamide (glipizid) was explored as an electro-active material for preparing a polymeric membrane-based sensor selective to samarium ions. The membrane incorporated 30% poly(vinyl chloride) (PVC), 53% benzyl acetate (BA), 11% glipizid and 6% sodium tetraphenyl borate. When coated on the surface of a graphite electrode, it exhibits Nernstian responses in the concentration range of 1.0 x 10(-5) to 1.0 x 10(-10) M, with a detection limit of 8.0 x 10(-11)M samarium. The electrode shows high selectivity towards samarium over several cations (alkali, alkaline earth, transition and heavy metal ions), and specially lanthanide ions. The proposed sensor has a very short response time (pH range for at least ten weeks. It was used as an indicator electrode in potentiometric titration of Sm(III) ions with an EDTA solution, and for determination of samarium in binary and ternary mixtures.

Adsorption and the initial stages of samarium condensation on iridium coated by graphite monolayer

International Nuclear Information System (INIS)

Abdullaev, R.M.; Tontegode, A.Ya.; Yusifov, F.K.

1978-01-01

Adsorption and the initial stages of vacuum samarium condensation on iridium coated by graphite monolayer (valent-saturated neutral substrate) were studied by the thermodesorption mass-spectrometry and thermoemission methods, and were compared with samarium adsorption and condensation on iridium. Desorption heat of samarium atoms with thin coating of Ir-C, equal to E approximately 1.9 eV has been determined. For desorption with Ir E is approximately 6 eV. Such a great difference in desorption heats is connected with the reduction of covalent constituent of adsorption bond in a neutral substrate. Samarium on Ir-C is found to be condensated in two states: loosely bound and tightly bound which sharply differ in properties. The tightly bound state is characterized by abnormally low vapour pressure. Possible nature of this state is discussed. Double effect on the condensation of the substrate valent saturation is noted. On the one hand, the reduction of the particle bond with the substrate decreases their concentration on the surface, preventing condensation. On the other hand, the release of the valent eloctrons of adatous brings about strong lateral interaction between them, which in its turn, promotes condensation during eased migration on the neutral substrate

Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

Science.gov (United States)

Andreasen, Rasmus; Sharma, Mukul

2006-11-03

Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

Crystallization of Yttrium and Samarium Aluminosilicate Glasses

OpenAIRE

Lago, Diana Carolina; Prado, Miguel Oscar

2016-01-01

Aluminosilicate glasses containing samarium and yttrium (SmAS and YAS glasses) exhibit high glass transition temperatures, corrosion resistance, and glass stability on heating which make them useful for technological applications. Yttrium aluminosilicate glass microspheres are currently being used for internal selective radiotherapy of liver cancer. During the preparation process, crystallization needs to be totally or partially avoided depending on the final application. Thus knowing the cry...

Determination of 0.01–0.1% of samarium in 40–100 mg of lead chloride

NARCIS (Netherlands)

Agterdenbos, J.; Jütte, B.A.H.G.; Schuring, J.

1971-01-01

A method is described for the determination of 5–25 μg of samarium in about 40 mg of lead chloride, based on the removal of the lead by electrolysis and determination of the samarium by extraction with PAN and measurement of the extinction of the complex at 552 nm.

Synthesis and structure of unprecedented samarium complex with bulky bis-iminopyrrolyl ligand via intramolecular C=N bond activation

Energy Technology Data Exchange (ETDEWEB)

Das, Suman; Anga, Srinivas; Harinath, Adimulam; Panda, Tarun K. [Department of Chemistry, Indian Institute of Technology, Hyderabad (India); Pada Nayek, Hari [Department of Applied Chemistry, Indian Institute of Technology, (ISM) Dhanbad, Jharkhand (India)

2017-12-29

An unprecedentate samarium complex of the molecular composition [{κ"3-{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N}{κ"3-{(Ph_2CHN=CH)(Ph_2CHNCH)C_4H_2N}Sm}{sub 2}] (2), which was isolated by the reaction of a potassium salt of 2,5-bis{N-(diphenylmethyl)-iminomethyl}pyrrolyl ligand [K(THF){sub 2}{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N] (1) with anhydrous samarium diiodide in THF at 60 C through the in situ reduction of imine bond is presented. The homoleptic samarium complex [[κ{sup 3}-{(Ph_2CH)-N=CH}{sub 2}C{sub 4}H{sub 2}N]{sub 3}Sm] (3) can also be obtained from the reaction of compound 1 with anhydrous samarium triiodide (SmI{sub 3}) in THF at 60 C. The molecular structures of complexes 2 and 3 were established by single-crystal X-ray diffraction analysis. The molecular structure of complex 2 reveals the formation of a C-C bond in the 2,5-bis{N-(diphenylmethyl)iminomethyl}pyrrole ligand moiety (Ph{sub 2}Py{sup -}). However, complex 3 is a homoleptic samarium complex of three bis-iminopyrrolyl ligands. In complex 2, the samarium ion adopts an octahedral arrangement, whereas in complex 3, a distorted three face-centered trigonal prismatic mode of nine coordination is observed around the metal ion. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Effect of samarium in corrosion and microstructure of Al-5Zn-0.5Cu as low driving voltage sacrificial anode

Science.gov (United States)

Pratesa, Yudha; Ferdian, Deni; Ramadhan, Fajar Yusya; Maulana, Bramuda

2018-05-01

Sacrificial Anode Low voltage is the latest generation of the sacrificial anode that can prevent the occurrence of Hydrogen Cracking (HIC) due to overprotection. The Al-5n-0.5Cu alloy showed the potential to be developed as the new sacrificial anode. However, the main problem is copper made Al2Cu intermetallic in grain boundary. Samarium is added to modify the shape of the intermetallic to make it finer and make the corrosion uniform. Several characterizations were conducted to analyze the effect of Samarium. Scanning electron microscope (SEM) and Energy dispersive spectroscopy was used to analyzed the microstructure of the alloy. Metallography preparation was prepared for SEM analysis. Corrosion behavior was characterized by cyclic polarization in 3.5% NaCl solution. The results show samarium can change the shape of intermetallic and refine the grains. In addition, samarium makes better pitting resistance and exhibits a tendency for uniform corrosion. It is indicated by the loop reduction (ΔEpit-prot). Current density increased as an effect of samarium addition from 6x10-5 Ampere (Al-5Zn-0.5Cu) to 2.5x10-4 Ampere (Al-5Zn-0.5Cu-0.5Sm). Steel potential protection increased after addition of samarium which is an indication the possibility of Al-Zn-Cu-Sm to be used as low voltage sacrificial anode.

Ultrasonic and viscosimetric studies of samarium laurate in benzene-dimethylsulfoxide mixtures

International Nuclear Information System (INIS)

Mehrotra, K.N.; Anis, M.

1995-01-01

Ultrasonic and viscosity measurements of samarium laurate in benzene-DMSO mixtures of different compositions (7:3 and 1:1 V/V) have been used to determine the critical micelle concentration (CMC), soap-solvent interaction, and various acoustic parameters of the system. The values of critical micelle concentration increase with increasing amount of DMSO in the solvent mixtures. The viscosity results have been explained on the basis of equations proposed by Einstein, Vand. Moulik, and Jones-Dole. The values of CMC for samarium laurate obtained from the viscosity measurements are in agreement with the results obtained from ultrasonic measurements. The results show that the soap molecules do not aggregate appreciably below CMC there is a marked change in the aggregation behaviour at CMC. (author)

Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

Energy Technology Data Exchange (ETDEWEB)

Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

2004-07-01

In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

Inductively coupled plasma optical emission spectrometry analysis of lanthanum, samarium and gadolinium oxides for rare earths impurities

International Nuclear Information System (INIS)

Reino, L.C.P.; Lordello, A.R.

1990-09-01

An inductively coupled plasma optical emission spectrometry method is described for the determination of Sm, Eu, La, Gd, Dy, Pr, Ho, Nd, Tb and Y in purified oxides of lanthanum, samarium and gadolinium. The method enables a simple, precise and readily available determination. Dissolution of the samples is achieved with diluted hydrochloric acid (1:1). The solutions are diluted to volume for a concentration of 1mg/ml. The lowest determination limit is 0,01% for most elements and 0,05 or 0,1% for a few rare earths in samarium and gadolinium matrices. Lanthanum, Samarium and Gadolinium concentrates with purity grade of 99,9%, 99,6% and 99,8%, respectively, can be analysed by this procedure. (author)

Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

Directory of Open Access Journals (Sweden)

Amri Amin

2009-06-01

Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

Preparation and examination of properties of samarium-153-EDTMP complex

International Nuclear Information System (INIS)

Nowak, M.; Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W.; Licinska, I.

1995-01-01

Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of 153 Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, β - -decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of 153 Sm-EDTMP chelate were examined in a broad range of samarium concentration and 153 Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of 153 Sm-EDTMP chelate as compared with molecules of ''free''EDTMP. The results of biodistribution of 153 Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of 153 Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs

Expedient Method for Samarium(II) Iodide Preparation Utilizing a Flow Approach

Czech Academy of Sciences Publication Activity Database

Voltrová, Svatava; Šrogl, Jiří

2013-01-01

Roč. 24, č. 3 (2013), s. 394-396 ISSN 0936-5214 R&D Projects: GA MŠk LH12013 Institutional support: RVO:61388963 Keywords : flow * samarium * iodide * reduction Subject RIV: CC - Organic Chemistry Impact factor: 2.463, year: 2013

Optical properties of zinc–vanadium glasses doped with samarium ...

Indian Academy of Sciences (India)

Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

X-ray spectrum in the range (6-12) A emitted by laser-produced plasma of samarium

International Nuclear Information System (INIS)

Louzon, Einat; Henis, Zohar; Levi, Izhak; Hurvitz, Gilad; Ehrlich, Yosi; Fraenkel, Moshe; Maman, Shlomo; Mandelbaum, Pinchas

2009-01-01

A detailed analysis of the x-ray spectrum emitted by laser-produced plasma of samarium (6-12 A) is presented, using ab initio calculations with the HULLAC relativistic code and isoelectronic considerations. Resonance 3d-nf (n=4 to 7), 3p-4d, 3d-4p, and 3p-4s transitions in Ni samarium ions and in neighboring ionization states (from Mn to Zn ions) were identified. The experiment results show changes in the fine details of the plasma spectrum for different laser intensities.

Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

Energy Technology Data Exchange (ETDEWEB)

Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

2011-07-01

Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

International Nuclear Information System (INIS)

Mendes, B.M.; Mendes, T.M.; Campos, T.P.R.

2011-01-01

Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

Influence of pretreatment temperature cycling on the radiating defect formation in silicon doped by samarium

International Nuclear Information System (INIS)

Abdurakhmanov, K.P.; Nazyrov, D.E.

2006-01-01

Full text: The raise of thermal and radiation stability as it is known, is one of actual problems of physics semiconductors. Recently it is established, that the rare-earth elements (REE) raise a stability of silicon to exterior action. In this connection the investigation of silicon doped REE by samarium and influence on its properties of heat treatments and radiation exposure is important. In sectional operation the outcomes of investigations of influence of samarium on thermal (600 degree C are reduced; 600 deg. + 900 deg. C; 900 deg. C; 900 deg. C + 600 deg. C; 1100 deg. C; 600 deg. C + 900 deg. C + 1100 deg. C; 900 deg. C + 600 deg. C + 1100 deg. C) thermal defect formation and radiation defect formation (exposure of γ-quanta 60 Co) both in beforehand wrought, and in thermally unfinished samples. After each cycle of heat treatments samples cool fast (throwing off in oil) or slowly (together with the furnace). Doping n-silicon REE by gadolinium and samarium was carried out during cultivation. The concentration of gadolinium and samarium in silicon, on sectional of a neutron-activation analysis was equaled 10 14 - 10 18 cm -3 . As control is model monocrystal silicon such as KEP-15/50. Para-meters of deep levels originating in control and doped REE samples, both past heat treatment or temperature cycling, and irradiated by the γ-quanta are defined by methods of a capacity spectroscopy: DLTS and IRC. The obtained outcomes have shown, that in irradiated with the γ-quanta 60 Co deep levels samples are formed with energies: E C -0,17 eV, E C -0,32 eV, EC-0,41 eV. Thus the parameters of deep levels vary depending on requirements of prestress heat treatment. For example heat treatment at 600 deg. C essentially increments a velocity of introduction of and centre (deep level of E C -0,17 eV), in comparison with a velocity of introduction of this level in samples with prestress heat treatment at 900 deg. C. In samples n-Si doped by samarium effectiveness of formation

Sorption of samarium in iron (II) and (III) phosphates in aqueous systems

International Nuclear Information System (INIS)

Diaz F, J.C.

2006-01-01

The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

Impact of educational strategies in positioning Samarium-153 EDTMP as a treatment for metastatic bone pain

International Nuclear Information System (INIS)

Seminario, C.; Morales, R.; Castro, M.; Cano, R.A.; Mendoza, G.

2005-01-01

To educate is a difficult task but its results make efforts worthwhile. Many patients in Peru suffer from intractable bone pain due to metastases. Since 1993 radionuclides were used to palliate bone pain due to metastases in Peru. First, with the help of the IAEA, Peru participated in a clinical trial using Phosphorus 32 and Strontium 89. Then, efforts were performed to produce Samarium 153 EDMTP locally, which was achieved in 1995. Nevertheless, years passed and Samarium use did not increase proportionally to the needs of people with cancer and bone pain, mainly the poor. Educational strategies have been proven useful for delivering solutions to many health problems in other diseases and also in cancer. Health education makes patients and their relatives assume responsible care of their problems. The purpose of this work was to increase Samarium EDTMP use as palliative treatment in patients with bone pain due to metastases, using educational strategies as means to change attitudes towards this health problem. In September 2003, a task group conducted studies in order to apply several methods to achieve the goal of increasing Samarium EDTMP use. Educational strategies employed were performed to provide verbal and written information to patients, physicians, medical students, residents, pain specialists, oncologists and neurologists, as well as general public. Verbal information included radio interviews, television spots and a phone number (in charge of two secretaries, prepared for answering and if not possible, a physician was in charge of attending patient consultation), e-mail and a web page for consultation. Written material was delivered to several newspapers, including clinical use of Samarium, possibilities of being elected for treatment, benefits and risks and a photography of the product. Politics of the institution producing Samarium changed, in order to achieve minimum cost of the product and it was delivered to all publics at the lowest cost for a year

Lanthanum (samarium) nitrate-4-aminoantipyrine nitrate-water systems

International Nuclear Information System (INIS)

Starikova, L.I.; Zhuravlev, E.F.

1985-01-01

Using the isothermal method of cross-sections at 50 deg C systems lanthanum nitrate-4-aminoantipyrine nitrate-water (1), samarium nitrate-4-aminoantipyrine nitrate-water (2), are studied. Isotherms of system 1 consist of two crystallization branches of initial salt components. In system 2 formation of congruently soluble compounds of the composition Sm(No) 3 ) 3 xC 11 H 13 ON 3 xHNO 3 is established. Analytical, X-ray phase and thermogravimetric analysis of the isolated binary salt are carried out

Collective effects in even-mass samarium isotopes by polarized-proton scattering

NARCIS (Netherlands)

Petit, R.M.A.L.; Hall, van P.J.; Klein, S.S.; Moonen, W.H.L.; Nijgh, G.J.; Overveld, van C.W.A.M.; Poppema, O.J.

1993-01-01

The even-mass samarium isotopes 148,...,152Sm have been investigated by polarized proton scattering at 20.4 MeV beam energy. The data have been analysed with an 'extended' optical model, where the intensities of the first maxima of the main inelastic channels are fitted in a coupled-channels

Synthesis of samarium, europium and ytterbium acetylenides

International Nuclear Information System (INIS)

Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

1995-01-01

Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

Sorption-desorption of samarium in Febex bentonite

International Nuclear Information System (INIS)

Ramirez-Guinart, O.; Rigol, A.; Vidal, M.; Fernandez-Poyatos, P.; Alba, M. D.

2012-01-01

Document available in extended abstract form only. The chemical and physical nature of the clay is a key issue in the design of engineered barriers. The FEBEX bentonite is one of the clays candidates to be used in engineered barriers in deep geology repositories (DGR). Here, its performance was tested with respect to the sorption-desorption of samarium, which is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in high level radioactive waste in the form of the radioactive isotope 151 Sm. FEBEX bentonite was used in this study. This is a di-octahedral smectite, with isomorphic substitutions in tetrahedral and octahedral sheets. Its theoretical cation exchange capacity value is 1500 meq kg -1 . Sorption isotherms were obtained for Sm in the range of initial concentrations of 0.01 and 9 meq l -1 . Tests were carried out in deionized water and in a medium simulating the composition of interstitial water. Sorption tests were performed equilibrating 30 ml of the Sm solution with 0.2 g of clay. After a contact time of 24 hours, supernatants were decanted off after centrifugation. The quantification of the concentration of Sm in the initial and final solutions allowed us to quantify the Sm equilibrium concentration (C eq ), the fraction sorbed in the FEBEX bentonite (C sorb ) and to derive the sorption K d data. Desorption tests were applied to determine the desorption K d and the percentage of Sm reversibly sorbed. Desorption tests were performed with the bentonite residue from the sorption step, under the same experimental conditions, but without Sm. Powder X-ray diffractograms were obtained from 3 to 70 deg. 2θ with a step of 0.05 deg. and a counting time of 3 s. The crystalline phases were identified using the computer program X'Pert HighScore. The morphology of the samples was analyzed by SEM at 20 kV. An EDX system was fitted to the SEM equipment to perform chemical analyses of the samples using a Si/Li detector

Laser spectroscopy of atomic samarium

International Nuclear Information System (INIS)

Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

1988-01-01

Samarium spectrum was studied with a purpose to find transitions to be used in experiments on parity nonconservation. Macaluso-Corbino effect - Faraday rotation near resonance was used for the search and study of spectral lines. We have identified previously unknown energy levels belonging to the 4f 5 6s 2 5 D term: 15914.55(3) cm -4 (J=1), 17864.29(3) cm -4 (J=2), 20195.76(3) cm -4 (J=3). M1-transitions to these levels from the levels of the ground 4f 5 6s 2 7 F term were observed. There are several peculiarities of these transitions which are due to the fact that they occut within an inner 4f 5 -shell, particularly, a very small presuure broadening by inert gases. 44 refs.; 17 figs.; 7 tabs

Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study

International Nuclear Information System (INIS)

Lucas H, J.

2016-01-01

In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

Removal of trivalent samarium from aqueous solutions by activated biochar derived from cactus fibres

Institute of Scientific and Technical Information of China (English)

Loukia Hadjittofi; Styliana Charalambous; Ioannis Pashalidis

2016-01-01

The efficiency of activated biochar fibres obtained fromOpuntia Ficus Indica regarding the sorption of trivalent samarium (Sm(III)) from aqueous solutions was investigated by batch experiments. The effect of various physicochemical parameters (e.g. pH, initial metal concentration, ionic strength, temperature and contact time) on the Sm(III) adsorption was studied and the surface species were characterized by FTIR spectroscopy prior to and after the lanthanide sorption. The experimental results showed that the acti-vated biochar fibres possessed extraordinary sorption capacity for Sm(III) in acidic solutions (qmax=90 g/kg, pH 3.0) and near neutral solutions (qmax=350 g/kg, pH 6.5). This was attributed to the formation of samarium complexes with the surface carboxylic moieties, available in high density on the lamellar structures of the bio-sorbent.

Pressure and irradiation effects on transport properties of samarium compounds with instable valence

International Nuclear Information System (INIS)

Morillo, J.

1981-01-01

Electron transport properties in samarium compounds with instable valence are studied in this thesis: from SmS in its integer valence phases at common pressure to SmB 6 compound IV at common pressure through SmSsub(1-x)Psub(x) (x 6 is presented [fr

Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

International Nuclear Information System (INIS)

Daidoji, Hidehiro; Tamura, Shohei

1982-01-01

The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

Science.gov (United States)

Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

2012-11-01

Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

Peculiarities of electronic, phonon and magnon subsystems of lanthanum and samarium tetraborides

Energy Technology Data Exchange (ETDEWEB)

Novikov, V.V., E-mail: vvnovikov@mail.ru; Mitroshenkov, N.V.; Matovnikov, A.V.

2015-10-15

Experimental research was carried out to study the temperature dependences of heat capacity C{sub p}(T = 2–300 K), lattice parameters a(T), and ≿(T), (5–300 K) of lanthanum and samarium tetraborides. A comparison with data obtained previously for LuB{sub 4} reveals the peculiar influence of lanthanide contraction and the rare-earths mass on the thermodynamic properties of rare earth tetraborides at low and high temperatures. Sharp anomalies were found in the heat capacity and thermal expansion for SmB{sub 4} at T{sub N} = 25.1 K, conditioned by the phase transition into antiferromagnetic state. The more poorly defined heat capacity anomaly around 7 K is referred to the quadrupole orbital fluctuation of the atomic magnetic moments for Sm{sup 3+} ions. The electronic, lattice, and magnetic contributions to the heat capacity and thermal expansion of samarium tetraboride were defined. Our approach makes it possible to adequately approximate the lattice components of heat capacity and thermal expansion by combining the Debye and Einstein contributions, which are based on the joint analysis of calorimetric and X-ray data. The influence of the frustration of the atomic magnetic moment system for Sm{sup 3+} ions on the thermodynamic characteristics of the samarium tetraboride magnetic phase transition was revealed. - Highlights: • The heat capacity and lattice parameters for LaB{sub 4} and SmB{sub 4} were determined at 2–300 K. • The anomalies of C{sub p}(T), a(T), c(T) for SmB{sub 4} due to the phase transition are revealed. • The lattice contributions to the thermal properties of LaB{sub 4} and SmB{sub 4} are analyzed.

Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

Directory of Open Access Journals (Sweden)

Maria Veronica Purwani

2017-05-01

Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

Australian manufacture of QuadrametTM (Samarium-153 EDTMP)

International Nuclear Information System (INIS)

Wood, N.R.; Whitwell, J.

1997-01-01

Quadramet T (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200μg/mL whereas the overseas formulation has a level of 20-46μg/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet TM provides a further option in the management of these difficult cases

Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

Energy Technology Data Exchange (ETDEWEB)

Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

2012-11-15

Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

Production of SmCo5 alloy by calciothermic reduction of samarium oxide

International Nuclear Information System (INIS)

Krishnan, T.S.; Gupta, C.K.

1988-01-01

Among the established permanent magnets, SmCo 5 magnet occupies the foremost position as it offers a unique combination of high energy product, coercivity and curie temperature. The SmCo 5 magnets are thus extensively used for high field applications. These are also best suited for use in environments where high demagnetizing field and high temperature are operative. Also, for applications where high performance and miniaturization are the over-riding considerations, the choice again falls on SmCo 5 magnets. The main deterrent to the widespread use of SmCo 5 magnet is its high cost. Both samarium and cobalt metals are high priced, and the magnets prepared from their directly melted alloy are thus naturally very expensive. An alternate process involving calcium reduction of their oxide intermediates has, therefore, been studied and the alloy prepared by this process has been evaluated and found satisfactory for magnet production. The process essentially involves compaction of the charge mix containing samarium oxide, cobalt oxide (or metal) and calcium metal and reduction of the charge compact at 1000-1300 degrees C in hydrogen atmosphere, followed by water and acid leaching, drying and classification

Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

CSIR Research Space (South Africa)

Mandiwana, V

2015-09-01

Full Text Available the biodistribution of poly(D,L-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([(sup153)Sm]Sm(sub2)O(sub3)) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear...

Synthesis of Samarium Cobalt Nanoblades

Energy Technology Data Exchange (ETDEWEB)

Darren M. Steele

2010-08-25

As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

Neutron Capture and Transmission Measurements and Resonance Parameter Analysis of Samarium

International Nuclear Information System (INIS)

Leinweber, G.; Burke, J.A.; Knox, H.D.; Drindak, N.J.; Mesh, D.W.; Haines, W.T.; Ballad, R.V.; Block, R.C.; Slovacek, R.E.; Werner, C.J.; Trbovich, M.J.; Barry, D.P.; Sato, T.

2001-01-01

The purpose of the present work is to accurately measure the neutron cross sections of samarium. The most significant isotope is 149 Sm, which has a large neutron absorption cross section at thermal energies and is a 235 U fission product with a 1% yield. Its cross sections are thus of concern to reactor neutronics. Neutron capture and transmission measurements were performed by the time-of-flight technique at the Rensselaer Polytechnic institute (RPI) LINAC facility using metallic and liquid Sm samples. The capture measurements were made at the 25 meter flight station with a multiplicity-type capture detector, and the transmission total cross-section measurements were performed at 15- and 25-meter flight stations with 6 Li glass scintillation detectors. Resonance parameters were determined by a combined analysis of six experiments (three capture and three transmission) using the multi-level R-matrix Bayesian code SAMMY version M2. The significant features of this work are as follows. Dilute samples of samarium nitrate in deuterated water (D 2 O) were prepared to measure the strong resonances at 0.1 and 8 eV without saturation. Disk-shaped spectroscopic quartz cells were obtained with parallel inner surfaces to provide a uniform thickness of solution. The diluent feature of the SAMMY program was used to analyze these data. The SAMMY program also includes multiple scattering corrections to capture yield data and resolution functions specific to the RPI facility. Resonance parameters for all stable isotopes of samarium were deduced for all resonances up to 30 eV. Thermal capture cross-section and capture resonance integral calculations were made using the resultant resonance parameters and were compared to results obtained using resonance parameters from ENDF/B-VI updated through release 3. Extending the definition of the capture resonance integral to include the strong 0.1 eV resonance in 149 Sm, present measurements agree within estimated uncertainties with En

Identification of the lines in the L emission spectrum of cerium and samarium

International Nuclear Information System (INIS)

Shrivastava, B.D.; Singh, D.

1992-01-01

The occurrence of a line at 2.1556 A in the L emission spectrum of cerium and two lines at 1.6679 and 1.8379 A in the L emission spectrum of samarium, reported many years ago, has remained a puzzle. These have now been identified as EXAFS minima occurring at the L absorption edges of the respective elements. (author)

Samarium-153-EDTMP in the metastatic bone pain treatment

International Nuclear Information System (INIS)

Lins Filho, M.L.M.; Santos, A.O.; Nappi, A.P.B.; Meirelles, M.B.; Arouca, P.T.; Ramos, C.D.; Etchebehere, E.C.S.C.; Teixeira, L.C.; Netto Junior, N.R.; D'Ancona Cal; Camargo, E.E.

1997-01-01

Full text: Bone metastasis is the most reason of pain in prostate and mammary cancer patients. The Samarium-153-EDTMP has been showed as an alternative to the treatment of the metastasis bone pain. With the objective to evaluate the use of the Sm-153-EDTMP as a systemic therapy for the metastasis bone pain, 30 patients (19 male, 11 female, average age of 64,5 years) were studied. 19 patients with prostate cancer and 11 with mammary cancer. All the patients presented previous bone scintiscanning with multiple metastasis; interruption of the chemotherapy or radiotherapy for two or more weeks and leukocyte count higher than 2,000 leukocytes/mm 3 and platelets higher than 80,000/mm 3 . The patients were classified previously to the radioisotope therapy, as far the intensity of the pain in a scale from 0 to 10 is concerned. All the patients received 37 MBq/kg (1m Ci/kg) of weight of Sm-153-EDTMP by venous via. The evaluation 6 weeks after the therapy showed complete or partial pain relief in 22 patients (73,3%). Complete or partial pain relief has been obtained in 91,0% (10 in 11) of the patients with mammary cancer and in 62,2% (12 in 19) of the patients with prostate cancer. Transitory leukopenia (lower than 2,000 leukocytes/mm 3 ) and platelet count (lower than 80,000/mm 3 ) occurred in 33,3% of the patients. 8 patients (26,7%) did not responded to the therapy. The therapy with Samarium-153-EDTMP is a simple, safe and efficient method in the treatment of the bone pain caused by metastasis

Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

Science.gov (United States)

Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

2018-03-01

The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

Thermomechanical behavior of Fe-Mn-Si-Cr-Ni shape memory alloys modified with samarium

International Nuclear Information System (INIS)

Shakoor, R.A.; Khalid, F. Ahmad

2009-01-01

The deformation and training behavior of Fe-14Mn-3Si-10Cr-5Ni (wt.%) shape memory alloys containing samarium addition has been studied in the iron-based shape memory alloys. It is noticed that thermomechanical treatment (training) has significant influence on proof stress, critical stress and shape memory behavior of the alloys. The improvement in shape memory behavior can be attributed to the decrease in the proof stress and critical stress which facilitates the formation of ε (hcp martensite). It is also observed that alloy 2 containing samarium undergoes less softening as compared to alloy 1 with training which inhibits the formation of α (bcc martensite) and thus enhances the shape memory behavior. The excessive thermomechanical treatment with increase in the training cycle has led to the formation of α (bcc martensite) along with ε (hcp martensite) in the alloy 1 which appeared to have decline in the shape memory effect. This has been demonstrated by the examination of microstructure and identification of α (bcc martensite) martensite in the alloy 1 as compared to alloy 2

Effective visible light-active nitrogen and samarium co-doped BiVO4 for the degradation of organic pollutants

International Nuclear Information System (INIS)

Wang, Min; Niu, Chao; Liu, Jun; Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan

2015-01-01

Nitrogen and samarium co-doped BiVO 4 (N–xSm–BiVO 4 ) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO 4 particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO 4 extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO 4 exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO 4 under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO 4 were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO 4 has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping

Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

International Nuclear Information System (INIS)

Castrillejo, Y.; Fernandez, P.; Medina, J.; Hernandez, P.; Barrado, E.

2011-01-01

This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) ↔ Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al 3 Sm and Al 2 Sm.

Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

Energy Technology Data Exchange (ETDEWEB)

Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

2011-10-01

This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

Resonances of coherent population trapping in samarium vapours

International Nuclear Information System (INIS)

Kolachevsky, Nikolai N; Akimov, A V; Kiselev, N A; Papchenko, A A; Sorokin, Vadim N; Kanorskii, S I

2001-01-01

Resonances of coherent population trapping were detected in atomic vapours of the rare-earth element samarium. The coherent population trapping was produced by two external-cavity diode lasers (672 and 686 nm) in a Λ-system formed by the three levels of 154 Sm: the 4f 6 6s 2 ( 7 F 0 ) ground state, the first fine-structure 4f 6 6s 2 ( 7 F 1 ) sublevel of the ground state and the 4f 6 ( 7 F)6s6p( 3 P o ) 9 F o 1 upper level. The dependence of the spectral shapes and resonance contrasts on the polarisation of the laser beams and the direction of the applied magnetic field was studied. The obtained results were analysed. (nonlinear optical phenomena)

The systems lanthanum (cerium, samarium) nitrate-tetramethyl-ammonium nitrate-water

International Nuclear Information System (INIS)

Zhuravlev, E.F.; Khisaeva, D.A.; Semenova, Eh.B.

1984-01-01

The method of cross sections at 25 and 50 deg C has been applied to study solubility in the systems lanthanum nitrate-tetramethyl ammonium nitrate-water (1), cesium (3) nitrate-tetramethyl ammonium nitrate-water (2) and samarium nitrate-tetramethyl ammonium nitrate-water (3). Crystallization fields of congruently dissolving compounds with 1:3 ratio of salt components (in system 1) and 1:2 ratio (in systems 2 and 3) are found in the systems. New solid phases are separated preparatively and subjected to chemical, differential thermal and IR spectroscopic analyses. Compositions of formed compounds are compared with the compositions known for nitrates of other representatives of light lanthanides

13 CFR 134.402 - Appeal petition.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...

22 CFR 134.25 - Settlement.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...

6 CFR 13.4 - Investigation.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...

13 CFR 134.310 - Discovery.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...

The systems cerium(3) (samarium) nitrate-quinoline nitrate-water

International Nuclear Information System (INIS)

Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

1982-01-01

Using the method of cross sections at 25 and 50 deg C the solubility in the systems cerium (3) nitrate-quinoline nitrate-water and samarium nitrate-quinoline nitrate-water has been studied. It is established that in the systems during chemical interaction of components congruently melting compounds of the composition: Ce(NO 3 ) 2 x2[C 9 H 7 NxHNO 3 ]x6H 2 O and Sm(NO 3 ) 3 x2[C 9 H 7 NxHNO 3 ]x2H 2 O are formed. New solid phases are separated preparatively and are subjected to chemical, differential thermal and IR spectroscopic analyses. The investigation results are compared with similar ones for nitrates of other representatives of lanthanide group

13 CFR 134.213 - Discovery.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...

Body composition analysis by DEXA by using dynamically changing samarium filtration

DEFF Research Database (Denmark)

Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

1997-01-01

Dual-energy X-ray absorptiometry (DEXA) has a high accuracy for body composition analysis but is influenced by beam hardening and other error sources in the extremes of measurement. To compensate for beam hardening, the Norland XR-36 introduces a dynamically changing samarium filtration system......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

13 CFR 134.217 - Settlement.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...

24 CFR 13.4 - Reports.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...

Effective visible light-active nitrogen and samarium co-doped BiVO{sub 4} for the degradation of organic pollutants

Energy Technology Data Exchange (ETDEWEB)

Wang, Min; Niu, Chao [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China); Liu, Jun, E-mail: minwang62@msn.com [Shenyang Military General Hospital, Shenyang 110016 (China); Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China)

2015-11-05

Nitrogen and samarium co-doped BiVO{sub 4} (N–xSm–BiVO{sub 4}) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO{sub 4} particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO{sub 4} extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO{sub 4} exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO{sub 4} under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO{sub 4} were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO{sub 4} has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping.

Ferrites Ni0,5Zn0,5Fe2O4 doped with samarium: structural analysis, morphological and electromagnetic

International Nuclear Information System (INIS)

Costa, A.C.F.M.; Diniz, A.P.; Viana, K.M.S.; Cornejo, D.R.; Kiminami, R.H.G.A.

2010-01-01

This paper proposes to investigate the sintering at 1200 deg C/2h of Ni 0.5 Zn 0.5 Fe 2-x Sm x O 4 ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

Performance comparison of a refrigerator system using R134a and hydrocarbon refrigerant (HCR134a) with different expansion devices

Science.gov (United States)

Aziz, A.; Izzudin; Mainil, A. K.

2017-09-01

The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.

Dicty_cDB: CHI134 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

19 CFR 134.34 - Certain repacked articles.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...

Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

International Nuclear Information System (INIS)

Ishii, H.; Satoh, K.

1982-01-01

Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

19 CFR 134.53 - Examination packages.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...

13 CFR 134.203 - The petition.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...

New reduced variant in gadolinium and samarium monoxide thin films

Energy Technology Data Exchange (ETDEWEB)

Bist, B M.S.; Kumar, J; Srivastava, O N [Banaras Hindu Univ. (India). Dept. of Physics

1977-01-01

A new reduced phase has been observed in the thin films of gadolinium and samarium monoxides. This phase results on imparting an annealing treatment to the monoxides and is formed as a result of the creation and ordering of vacancies in the oxygen sublattice. The new phase has been analysed to possess a rhombohedral unit cell with lattice parameters a/sub R/ = a/sub 0/ square root of (3/2) and c/sub R/ = a/sub 0/ square root of 3 (based on hexagonal axes, a/sub 0/ being the lattice parameter of the fundamental zinc blende type unit cell of the monoxide). Based on the proposed structure, the new phase can be assigned the solid state chemical formula RO/sub x/ where R = Gd, Sm and x = 0.66.

Enhanced electron-lattice coupling under uniaxial stress in layered double hydroxides intercalated with samarium complexes

International Nuclear Information System (INIS)

Park, Ta-Ryeong

2004-01-01

We have applied uniaxial stress to samarium complexes by intercalating them into the gallery of a layered material and by using a diamond-anvil cell at 28 K. Although uniaxial stress reduces symmetry and removes degeneracy, the overall number of photoluminescence (PL) peaks evidently decreased with the application of uniaxial stress. This contradictory observation is explained by an increased electron-lattice coupling strength under uniaxial stress. This behavior is also confirmed by time-resolved PL data.

Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a

Science.gov (United States)

Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul

2012-06-01

An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.

Behavior of cesium-134 in the tea tree

International Nuclear Information System (INIS)

Xu Yinliang; Chen Kaixuan; Chen Chuangqun

1996-01-01

The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%

Phase Composition of Samarium Niobate and Tantalate Thin Films Prepared by Sol-Gel Method

Science.gov (United States)

Bruncková, H.; Medvecký, Ľ.; Múdra, E.; Kovalčiková, A.; Ďurišin, J.; Šebek, M.; Girman, V.

2017-12-01

Samarium niobate SmNbO4 (SNO) and tantalate SmTaO4 (STO) thin films ( 100 nm) were prepared by sol-gel/spin-coating process on alumina substrates with PZT interlayer and annealing at 1000°C. The precursors of films were synthesized using Nb or Ta tartrate complexes. The improvement of the crystallinity of monoclinic M'-SmTaO4 phase via heating was observed through the coexistence of small amounts of tetragonal T-SmTa7O19 phase in STO precursor at 1000°C. The XRD results of SNO and STO films confirmed monoclinic M-SmNbO4 and M'-SmTaO4 phases, respectively, with traces of orthorhombic O-SmNbO4 (in SNO). In STO film, the single monoclinic M'-SmTaO4 phase was revealed. The surface morphology and topography of thin films were investigated by SEM and AFM analysis. STO film was smoother with roughness 3.2 nm in comparison with SNO (6.3 nm). In the microstructure of SNO film, small spherical ( 50 nm) and larger cuboidal particles ( 100 nm) of the SmNbO4 phase were observed. In STO, compact clusters composed of fine spherical SmTaO4 particles ( 20-50 nm) were found. Effect of samarium can contribute to the formation different polymorphs of these films for the application to environmental electrolytic thin film devices.

Behaviour of 134Cs in the aquatic ecosystems

International Nuclear Information System (INIS)

Xu Yinliang; Chen Chuanqun

1992-07-01

The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function

Evaluation of samarium-153 and holmium-166-EDTMP in the normal baboon model

Energy Technology Data Exchange (ETDEWEB)

Louw, W.K.A.; Dormehl, I.C.; Rensburg, A.J. van; Hugo, N.; Alberts, A.S.; Forsyth, O.E.; Beverley, G.; Sweetlove, M.A.; Marais, J.; Loetter, M.G.; Aswegen, A. van

1996-11-01

Bone-seeking radiopharmaceuticals such as ethylenediaminetetramethylene phosphonate (EDTMP) complexes of samarium-153 and holmium-166 are receiving considerable attention for therapeutic treatment of bone metastases. In this study, using the baboon experimental model, multicompartmental analysis revealed that with regard to pharmacokinetics, biodistribution, and skeletal localisation, {sup 166}Ho-EDTMP was significantly inferior to {sup 153}Sm-EDTMP and {sup 99m}Tc-MDP. A more suitable {sup 166}Ho-bone-seeking agent should thus be sought for closer similarity to {sup 153}Sm-EDTMP to exploit fully the therapeutic potential of its shorter half-life and more energetic beta radiation.

Performance analysis of samarium cobalt P.M. synchronous motor fed from PWM inverters

International Nuclear Information System (INIS)

Rahman, M.A.; Choudhury, M.A.

1985-01-01

This paper presents an analysis and performance of samarium cobalt permanent magnet (P.M.) synchronous motors fed from two types of voltage source pulse width modulated (PWM) inverters. The analysis and test results on the steady state performance of a P.M. motor fed from PWM inverters are presented. PWM inverters are used in variable voltage variable frequency applications to avoid a double conversion process of ordinary inverters. In drives, they are used for voltage and speed regulation of motors. Use of modulation technique in inverters also allow to eliminate or minimize selected harmonics from the inverter output voltage

JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

International Nuclear Information System (INIS)

Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

2010-01-01

Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues

International Nuclear Information System (INIS)

Garcia G, N.

2006-01-01

Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH PCN ) and density of surface sites (D s ). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

29 CFR 2570.134 - Consequences of default.

Science.gov (United States)

2010-07-01

... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...

49 CFR 195.134 - CPM leak detection.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...

Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

DEFF Research Database (Denmark)

Pauly, N; Yubero, F; Espinós, J P

2017-01-01

Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 ke...

13 CFR 134.409 - Decision on appeal.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...

Magnetic behavior study of samarium nitride using density functional theory

Science.gov (United States)

Som, Narayan N.; Mankad, Venu H.; Dabhi, Shweta D.; Patel, Anjali; Jha, Prafulla K.

2018-02-01

In this work, the state-of-art density functional theory is employed to study the structural, electronic and magnetic properties of samarium nitride (SmN). We have performed calculation for both ferromagnetic and antiferromagnetic states in rock-salt phase. The calculated results of optimized lattice parameter and magnetic moment agree well with the available experimental and theoretical values. From energy band diagram and electronic density of states, we observe a half-metallic behaviour in FM phase of rock salt SmN in while metallicity in AFM I and AFM III phases. We present and discuss our current understanding of the possible half-metallicity together with the magnetic ordering in SmN. The calculated phonon dispersion curves shows dynamical stability of the considered structures. The phonon density of states and Eliashberg functional have also been analysed to understand the superconductivity in SmN.

Myelotoxicity of Samarium Sm153 lexidronam in patients with painful bony metastases

International Nuclear Information System (INIS)

Ben Ghachem, T.; Mhiri, A.; Slim, I.; Bahloul, A.; Yeddes, I.; Elbez, I.; Meddeb, I.; Ben Slimene, M.F.

2015-01-01

Full text of publication follows. Introduction: the management of bone pain includes analgesia, radiation, hormones, radiofrequency (RF) ablation, chemotherapy, and surgery. Bone pain palliation therapy with radiopharmaceuticals is a cost-effective systemic therapy to relieve pain from skeletal metastases with a consequent decrease in morbidity and an improvement in quality of life. The aim of our study is to evaluate the effect of myelotoxicity of samarium lexidronam (Sm 153 ) in patients with painful bony metastasis. Methods: we reviewed 116 patients aged from 14 to 87 years old, 91 males (78%) and 25 females (22%), having received 1 to 4 treatments of Sm 153 (37 MBq/kg) for painful bony metastases from different primitive tumors: 67 cases of prostate cancer (57.7%), 22 cases of breast cancer (18.9%), 10 cases of pulmonary cancer (8.6%) and others in 14.6% of cases. Clinical follow-up was available for 159 treatments, consisting on blood count each week over at least two months, in order to evaluate myelotoxicity according to WHO classification. Results: no patients had grade 4 toxicity after its cures. A grade 2-3 myelotoxicity was observed after 52 treatments (34%) during the second week and after 50 treatments (32.6%) during the fourth week with a satisfactory reversibility. At 10 weeks of treatment, myelotoxicity was reclassified from 0 to 2 for 139 cures (90,8%). Moreover, we found that prior treatment with radiotherapy or chemotherapy did not affect the rates of myelotoxicity. Conclusion: multiple treatments with samarium Sm 153 lexidronam had no significant effect on myelotoxicity. Patients with bone predominant metastatic disease may survive for extended periods of time and may safely be treated with multiple modalities of therapy. (authors)

19 CFR 134.14 - Articles usually combined.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...

Preparation and biological behaviour of samarium-153-hydroxyapatite particles for radiation synovectomy

International Nuclear Information System (INIS)

Agrueelles, M.G.; Luppi Berlanga, I.S.; Torres, E.A.; Rutty Sola, G.A.; Rimoldi, G.

1998-01-01

The preparation and labelling procedures of 153 Sm-hydroxyapatite ( 153 Sm-HA) are described in this paper. Hydroxyapatite (HA) was prepared and studied as a radiosynovectomy agent. HA particles were prepared from the reaction of calcium nitrate and ammonia phosphate at high pH Samarium-153 labelling was done in two steps with citric acid. A serie of experimental conditions, such as specific activity, citric acid mass, radioactive solution volume, in-vitro stability, have been carried out. Radiolabelling efficiency was greater than 95%. In vitro studies showed high stability (≥99%). Animal studies showed a good retention in the synovium, with a very low extra-articular leakage over 6 days after administration. (author)

12 CFR 13.4 - Recommendations to customers.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...

Fabrication of a PVC membrane samarium(III) sensor based on N,N′,N″-tris(4-pyridyl)trimesic amide as a selectophore

International Nuclear Information System (INIS)

Zamani, Hassan Ali; Naghavi-Reyabbi, Fatemeh; Faridbod, Farnoush; Mohammadhosseini, Majid; Ganjali, Mohammad Reza; Tadjarodi, Azadeh; Rad, Maryam

2013-01-01

A new ion-selective electrode for Sm 3+ ion is described based on the incorporation of N,N′,N″-tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 ± 0.5 mV decade −1 over a wide concentration range of 1.0 × 10 −2 and 1 × 10 −6 mol L −1 , with a lower detection limit of 4.7 × 10 −7 mol L −1 and satisfactor applicable pH range of 3.6–9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm 3+ over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm 3+ . Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: ► A new Sm 3+ -PVC membrane sensor is introduced for determination of Sm 3+ ions in the solutions. ► N,N′,N″-tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. ► Detection limit of the sensor is 4.7 × 10 −7 mol L −1 with a short response time of less than 10 s.

Optical and physical properties of samarium doped lithium diborate glasses

Science.gov (United States)

Hanumantharaju, N.; Sardarpasha, K. R.; Gowda, V. C. Veeranna

2018-05-01

Sm3+ doped lithium di-borate glasses with composition 30Li2O-60B2O3-(10-x) PbO, (where 0 molar volume with samarium ion content indicates the openness of the glass structure. The gradual increase in average separation of boron-boron atoms with VmB clearly indicates deterioration of borate glass network, which in turn leads to decrease in the oxygen packing density. The replacements of Sm2O3 for PbO depolymerise the chain structure and that would increase the concentration of non-bridging oxygens. The marginal increase of optical band gap energy after 1.0 mol.% of Sm2O3 is explained by considering the structural modification in lead-borate. The influence of Sm3+ ion on physical and optical properties in lithium-lead-borate glasses is investigated and the results were discussed in view of the structure of borate glass network.

Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

Energy Technology Data Exchange (ETDEWEB)

Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

1995-12-31

Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

Potentiometric study of samarium oxides formation from its chloride in a molten eutectic mixture of sodium and cesium chlorides

International Nuclear Information System (INIS)

Smolenskij, V.V.; Bove, A.L.; Del'mukhamedov, R.D.; Borodina, N.P.; Gavrilov, A.G.

1997-01-01

Interaction of trivalent samarium cations with oxide-ions in NaCl-2CsCl melt at 973 K has been studied by potentiometric method using electrochemical cell with two platinum-oxygen electrodes with a solid electrolyte membrane. The mechanism of the interaction and composition of the reaction products, depending on the medium oxyacidity, have been considered. Certain thermodynamic characteristics of the process have been calculated

The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs

International Nuclear Information System (INIS)

Poppy Intan Tjahaja; Putu Sukmabuana

2008-01-01

One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)

Structural phase transition and electronic properties in samarium chalcogenides

Energy Technology Data Exchange (ETDEWEB)

Panwar, Y. S., E-mail: yspanwar2011@gmail.com [Department of Physics, Govt. New Science College Dewas-455001 (India); Aynyas, Mahendra [Department of Physics, C.S.A. Govt. P.G. College, Sehore, 466001 (India); Pataiya, J.; Sanyal, Sankar P. [Department of Physics, Barkatullah University, Bhopal, 462026 (India)

2016-05-06

The electronic structure and high pressure properties of samarium monochalcogenides SmS, SmSe and SmTe have been reported by using tight binding linear muffin-tin-orbital (TB-LMTO) method within the local density approximation (LDA). The total energy as a function of volume is evaluated. It is found that these monochalcogenides are stable in NaCl-type structure under ambient pressure. We predict a structural phase transition from NaCl-type (B{sub 1}-phase) structure to CsCl-type (B{sub 2}-type) structure for these compounds. Phase transition pressures were found to be 1.7, 4.4 and 6.6 GPa, for SmS, SmSe and SmTe respectively. Apart from this, the lattice parameter (a{sub 0}), bulk modulus (B{sub 0}), band structure (BS) and density of states (DOS) are calculated. From energy band diagram we observed that these compounds exhibit metallic character. The calculated values of equilibrium lattice parameter and phase transition pressure are in general good agreement with available data.

29 CFR 1915.134 - Abrasive wheels.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...

Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

Energy Technology Data Exchange (ETDEWEB)

Diaz F, J C

2006-07-01

The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

Separation of lanthanum from samarium on solid aluminum electrode in LiCl-KCl eutectic melts

International Nuclear Information System (INIS)

De-Bin Ji; Mi-Lin Zhang; Xing Li; Xiao-Yan Jing; Wei Han; Yong-De Yan; Yun Xue; Zhi-Jian Zhang; Harbin Engineering University, Harbin

2015-01-01

This paper presents an electrochemical study on the separation of lanthanum from samarium on aluminum electrode at 773 K. The results from different electrochemical methods showed that Sm(III) and La(III) formed Al-Sm and Al-La intermetallic compounds on an aluminum electrode at electrode potential around -1.67 and -1.46 V, respectively. The electrochemical separation of lanthanum was carried out in LiCl-KCl-LaCl 3 -SmCl 3 melts on solid aluminum electrodes at 773 K by potentiostatic electrolysis at -1.45 V for 40 h and the separation efficiency was 99.1 %. (author)

Structural and luminescence properties of samarium doped lead alumino borate glasses

Science.gov (United States)

Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

2017-11-01

The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

Europium and samarium doped calcium sulfide thin films grown by PLD

International Nuclear Information System (INIS)

Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

2007-01-01

Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

Measurement limits to 134Cs concentration in soil

International Nuclear Information System (INIS)

Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.

2011-01-01

We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.

13 CFR 134.404 - Decision by Administrative Law Judge.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...

The absorption and distribution of Cesium-134 in rice-soil system

International Nuclear Information System (INIS)

Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming

1991-01-01

Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice

The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS)

International Nuclear Information System (INIS)

Kaempfer, Tino

2009-01-01

The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [de

13 CFR 134.209 - Requirement of signature.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...

13 CFR 134.702 - Who may appeal?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

Samarium (III Selective Membrane Sensor Based on Tin (IV Boratophosphate

Directory of Open Access Journals (Sweden)

Ashok S. K. Kumar

2004-08-01

Full Text Available Abstract: A number of Sm (III selective membranes of varying compositions using tin (IV boratophosphate as electroactive material were prepared. Polyvinyl chloride, polystyrene and epoxy resin were used as binding materials. Membrane having composition of 40% exchanger and 60% epoxy resin exhibited best performance. This membrane worked well over a wide concentration range of 1x10-5M to 1x10-1 M of samarium ions with a Super-Nernstian slope of 40 mV/decade. It has a fast response time of less than 10 seconds and can be used for at least six months without any considerable divergence in potentials. The proposed sensor revealed good selectivities with respect to alkali, alkaline earth, some transition and rare earth metal ions and can be used in the pH range of 4.0-10.0. It was used as an indicator electrode in the potentiometric titration of Sm (III ions against EDTA. Effect of internal solution was studied and the electrode was successfully used in non-aqueous media, too.

9 CFR 3.134-3.135 - [Reserved

Science.gov (United States)

2010-01-01

... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

22 CFR 134.30 - Payment of award.

Science.gov (United States)

2010-04-01

... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...

Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

International Nuclear Information System (INIS)

Dantas, E.S.K.

1990-01-01

A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

Kinetic and spectroscopic characterization of the E134A- and E134D-altered dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase from Haemophilus influenzae.

Science.gov (United States)

Davis, Ryan; Bienvenue, David; Swierczek, Sabina I; Gilner, Danuta M; Rajagopal, Lakshman; Bennett, Brian; Holz, Richard C

2006-03-01

Glutamate-134 (E134) is proposed to act as the general acid/base during the hydrolysis reaction catalyzed by the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase (DapE) from Haemophilus influenzae. To date, no direct evidence has been reported for the role of E134 during catalytic turnover by DapE. In order to elucidate the catalytic role of E134, altered DapE enzymes were prepared in which E134 was substituted with an alanine and an aspartate residue. The Michaelis constant (K (m)) does not change upon substitution with aspartate but the rate of the reaction changes drastically in the following order: glutamate (100% activity), aspartate (0.09%), and alanine (0%). Examination of the pH dependence of the kinetic constants k (cat) and K (m) for E134D-DapE revealed ionizations at pH 6.4, 7.4, and approximately 9.7. Isothermal titration calorimetry experiments revealed a significant weakening in metal K (d) values of E134D-DapE. D134 and A134 perturb the second divalent metal binding site significantly more than the first, but both altered enzymes can still bind two divalent metal ions. Structural perturbations of the dinuclear active site of DapE were also examined for two E134-substituted forms, namely E134D-DapE and E134A-DapE, by UV-vis and electron paramagnetic resonance (EPR) spectroscopy. UV-vis spectroscopy of Co(II)-substituted E134D-DapE and E134A-DapE did not reveal any significant changes in the electronic absorption spectra, suggesting that both Co(II) ions in E134D-DapE and E134A-DapE reside in distorted trigonal bipyramidal coordination geometries. EPR spectra of [Co_(E134D-DapE)] and [Co_(E1341A-DapE] are similar to those observed for [CoCo(DapE)] and somewhat similar to the spectrum of [Co(H(2)O)(6)](2+) which typically exhibit E/D values of approximately 0.1. Computer simulation returned an axial g-tensor with g ((x,y))=2.24 and E/D=0.07; g ( z ) was only poorly determined, but was estimated as 2.5-2.6. Upon the addition of a second Co

Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

Energy Technology Data Exchange (ETDEWEB)

Lucas H, J.

2016-07-01

In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

Transient Increased Calcium and Calcitriol Requirements After Discontinuation of Human Synthetic Parathyroid Hormone 1-34 (hPTH 1-34) Replacement Therapy in Hypoparathyroidism.

Science.gov (United States)

Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T

2015-11-01

Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry

Fabrication of a PVC membrane samarium(III) sensor based on N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide as a selectophore

Energy Technology Data Exchange (ETDEWEB)

Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Naghavi-Reyabbi, Fatemeh [Resident of General Surgery, Endoscopic and Minimaly Invasive Surgery Research Center, Ghaem Hospital, Faculty of Medicine, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Tadjarodi, Azadeh; Rad, Maryam [Department of Chemistry, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

2013-03-01

A new ion-selective electrode for Sm{sup 3+} ion is described based on the incorporation of N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 {+-} 0.5 mV decade{sup -1} over a wide concentration range of 1.0 Multiplication-Sign 10{sup -2} and 1 Multiplication-Sign 10{sup -6} mol L{sup -1}, with a lower detection limit of 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} and satisfactor applicable pH range of 3.6-9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm{sup 3+} over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm{sup 3+}. Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: Black-Right-Pointing-Pointer A new Sm{sup 3+}-PVC membrane sensor is introduced for determination of Sm{sup 3+} ions in the solutions. Black-Right-Pointing-Pointer N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. Black-Right-Pointing-Pointer Detection limit of the sensor is 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} with a short response time of less than 10 s.

The R-134a energy efficiency problem

International Nuclear Information System (INIS)

Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.

1990-01-01

This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12

41 CFR 105-53.134 - Office of Administration.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...

Direct and indirect contamination of tree crops with Cs-134

International Nuclear Information System (INIS)

Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.

1996-01-01

A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)

42 CFR 84.134 - Respirator containers; minimum requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

Energy Technology Data Exchange (ETDEWEB)

Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

1981-07-01

This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

Memory effect of calcined layered samarium hydroxy chlorides in aqueous solution

International Nuclear Information System (INIS)

Lee, Byung Il; Byeon, Song Ho

2015-01-01

The decomposition and recovery behavior of layered samarium hydroxychloride (Sm 2 (OH) 5 Cl·nH 2 O, LSmH) has been closely studied in various conditions. Although the heat treatment of LSmH at 700 °C completely collapsed typical layered structure, the calcined LSmH (c-LSmH) recovered its layered characteristics and consequently its ability to intercalate anions into the interlayer space when it was rehydroxylated and rehydrated in aqueous solutions containing organic and inorganic anions. This phenomenon is similar to the memory effect observed in classical layered double hydroxides (LDHs), where LDHs calcined to a mixture of metal oxides can recover their layered structures in aqueous solutions. In contrast, the recovery reaction of c-LSmH in water without any counter anions was unsuccessful and instead resulted in the formation of Sm(OH) 3 . Such a difference was interpreted on the basis of the salt effect on Sm 2 (OH) 5 Cl·nH 2 O–Sm(OH) 3 phase equilibria in water

134Cs emission probabilities determination by gamma spectrometry

Science.gov (United States)

de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.

2018-03-01

The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).

40 CFR 86.134-96 - Running loss test.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...

Investigation of R-134a as a modeling fluid for supercritical water

International Nuclear Information System (INIS)

Jouvin, J.C.; Pioro, I.

2014-01-01

The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)

MicroRNA-134 regulates poliovirus replication by IRES targeting

OpenAIRE

Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.

2017-01-01

Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...

40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...

Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells

Institute of Scientific and Technical Information of China (English)

ZhuShou－Peng; XiaFen; 等

1997-01-01

Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.

The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

Czech Academy of Sciences Publication Activity Database

Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

2016-01-01

Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

Cross sections for d-{sup 3}H neutron interactions with samarium isotopes

Energy Technology Data Exchange (ETDEWEB)

Luo, Junhua; He, Long [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Wu, Chunlei; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

2016-11-01

The cross sections for (n,x) reactions on samarium isotopes were measured at (d-T) neutron energies of 13.5 and 14.8 MeV with the activation technique. Samples were activated along with Nb and Al monitor foils to determine the incident neutron flux. Theoretical calculations of excitation functions were performed using the nuclear model codes TALYS-1.6 and EMPIRE-3.2 Malta with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were discussed and compared with experimental data found in the literature. At neutron energies 13.5 and 14.8 MeV, the cross sections of the {sup 149}Sm(n,p){sup 149}Pm reaction are reported for the first time. The cross sections of the {sup 150}Sm(n,p){sup 150}Pm, {sup 144}Sm(n,p){sup 144}Pm, {sup 152}Sm(n,α){sup 149}Nd and {sup 144}Sm(n,α){sup 141}Nd reactions at different neutron energies reported in the present work can be added as new data in the nuclear databases.

Charge and transition densities of samarium isotopes in the interacting Boson model

International Nuclear Information System (INIS)

Moinester, M.A.; Alster, J.; Dieperink, A.E.L.

1982-01-01

The interacting boson approximation (IBA) model has been used to interpret the ground-state charge distributions and lowest 2 + transition charge densities of the even samarium isotopes for A = 144-154. Phenomenological boson transition densities associated with the nucleons comprising the s-and d-bosons of the IBA were determined via a least squares fit analysis of charge and transition densities in the Sm isotopes. The application of these boson trasition densities to higher excited 0 + and 2 + states of Sm, and to 0 + and 2 + transitions in neighboring nuclei, such as Nd and Gd, is described. IBA predictions for the transition densities of the three lowest 2 + levels of 154 Gd are given and compared to theoretical transition densities based on Hartree-Fock calculations. The deduced quadrupole boson transition densities are in fair agreement with densities derived previously from 150 Nd data. It is also shown how certain moments of the best fit boson transition densities can simply and sucessfully describe rms radii, isomer shifts, B(E2) strengths, and transition radii for the Sm isotopes. (orig.)

134Cs in heather seed plants grown with and without mycorrhiza

International Nuclear Information System (INIS)

Strandberg, M.; Johansson, M.

1988-01-01

Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

Thermodynamics of coproportionation reactions of homogeneous samarium (3) and yttrium (3) nitrates solvates with neutral organic phosphorus compounds

International Nuclear Information System (INIS)

Pyartman, A.K.

1995-01-01

Reaction heats of homogeneous samarium (3) and yttrium (3) nitrate solvates coproportionation with neutral organophosphoric compounds (tri-n.-butylphosphate, diisooctylmethylphosphonate, diisoamylmethylphosphonate) at T=298.15 K in hexane have been measured by thermochemical method. It has been ascertained that enthalpies of coproportionation reactions practically do not depend on the nature, concentration of rare earth metal (3) nitrate solvates in hexane, nature of neutral organophosphoric compound and constitute 1.1±-.2 kJ/mol. The Gibbs free energy of coproportionation reactions is -5.43 kJ/mol, while entropy of the reactions in 14.5±0.7 J/mol·K. 8 refs., 1 tab

19 CFR 134.43 - Methods of marking specific articles.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...

13 CFR 134.713 - When is the record closed?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...

19 CFR 134.54 - Articles released from Customs custody.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...

miR-134: A Human Cancer Suppressor?

Directory of Open Access Journals (Sweden)

Jing-Yu Pan

2017-03-01

Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.

{sup 134}Cs emission probabilities determination by gamma spectrometry

Energy Technology Data Exchange (ETDEWEB)

Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

2017-07-01

The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)

Construction of 1,3,4-Oxadiazole and 1,3,4-Thiadiazole Library with a High Level of Skeletal Diversity Based on Branching Diversity-Oriented Synthesis on Solid-Phase Supports.

Science.gov (United States)

Ha, Ji-Eun; Yang, Seung-Ju; Gong, Young-Dae

2018-02-12

An efficient solid-phase synthetic route for the construction of 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries based on branching diversity-oriented synthesis (DOS) has been developed in this study. The core skeleton resins, 1,3,4-oxadiazole and 1,3,4-thiadiazole, were obtained through desulfurative and dehydrative cyclizations of thiosemicarbazide resin, respectively. Various functional groups have been introduced to the core skeleton resins, such as aryl, amine, amide, urea, thiourea, and an amino acid. Most of the libraries were purified by simple trituration without extraction or column chromatography after cleavage of the products from the solid-supported resin. As a result, we obtained high yields of pure 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives (total numbers = 128). Finally, we confirmed the drug-like properties of our library by calculation of physicochemical properties, displays of the skeletal diversities of the library in 3D-space, and occupation of a broad range of areas by their functional groups.

24 CFR 17.134 - Procedures for salary offset: when deductions may begin.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...

Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)

Science.gov (United States)

Demore, W. B.

1993-01-01

Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.

13 CFR 134.405 - Jurisdiction.

Science.gov (United States)

2010-01-01

... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...

Efficacy and toxicity of Samarium-153-EDTMP locally produced in the treatment of painful skeletal metastases

International Nuclear Information System (INIS)

Olea, E.; Quintana, J.C.; Nagel, J.; Arenas, L.; Tomicic, M.; Gil, M.C.; Araya, G.

2001-01-01

Samarium-153 emits medium-energy beta particles an a gamma photon with a physical half-life of 46,3 hours. When chelated to ethylenediaminetetramethylenephosphonic acid (EDTMP), it is remarkably stable in vitro and in vivo. In this study we administered randomly 0,5 and 1,0 mCi/Kg body weight (two groups), to 30 patients with painful metastatic bone cancer. Slight and spontaneously reversible myelotoxicity was observed. A bigger leukocyte and platelet suppression was obtained with 1,0 mCi/kg than 0,5 mCi/Kg dose. Pain palliation was obtained in 66% of the treated patients. Our preliminary results indicate that 153 Sm-EDTMP is a promising radiotherapeutic agent for palliative treatment of metastatic bone cancer pain where a reactor is available and at a very affordable cost. (author)

Determination of the nuclear electric charge distribution of samarium isotopes 144, 148, 150, 152, 154 by the muonic atom method

International Nuclear Information System (INIS)

Barreau, Pierre.

1977-01-01

The theory of the nucleus-negative muon system in the case of electrical interactions is discussed. The interactions of muons with the samarium isotopes 152, 154, 144, 148, 150 are investigated. After a description of the experimental device, from muon beam production to data acquisition (detection of the gamma spectra), the results are analyzed and the nuclear charge distribution parameters determined: for each isotope the absolute value of c (half-density radius) and t (skin thickness); for 152 Sm and 154 Sm the parameter β 2 (quadrupolar defomation). Nuclear polarization was accounted for throughout the analysis [fr

13 CFR 134.407 - Evidence beyond the record and discovery.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...

Pharmacokinetics of labelled compounds with technetium-99m and samarium-153

International Nuclear Information System (INIS)

Borda O, L.B.; Torres L, M.N.

1997-01-01

The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa

13 CFR 134.218 - Judges.

Science.gov (United States)

2010-01-01

... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...

Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

KAUST Repository

Yao, Yingbang

2012-06-01

Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

32 CFR 13.4 - Duties and responsibilities of the defense.

Science.gov (United States)

2010-07-01

... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...

27 CFR 17.134 - Determination of unfitness for beverage purposes.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...

Composition shift in liquid-recirculation refrigerating systems: an experimental investigation for the pure fluid R134a and the mixture R32/134a

Energy Technology Data Exchange (ETDEWEB)

Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT

1999-09-01

The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.

13 CFR 134.708 - What is the standard of review?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

13 CFR 134.715 - Can a Judge reconsider his decision?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...

{sup 134}Cs in heather seed plants grown with and without mycorrhiza

Energy Technology Data Exchange (ETDEWEB)

Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)

1988-08-01

Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

International Nuclear Information System (INIS)

Zhu Cong; Guo Jiangfeng

2008-01-01

Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

Activity standardization of 134Cs and 137Cs

International Nuclear Information System (INIS)

Sochorová, Jana; Auerbach, Pavel

2014-01-01

The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed

Plant uptake of 134Cs in relation to soil properties and time

International Nuclear Information System (INIS)

Massas, I.; Skarlou, V.; Haidouti, C.

2002-01-01

134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants

Studies on the structural, optical and dielectric properties of samarium coordinated with salicylic acid single crystal

Science.gov (United States)

Singh, Harjinder; Slathia, Goldy; Gupta, Rashmi; Bamzai, K. K.

2018-04-01

Samarium coordinated with salicylic acid was successfully grown as a single crystal by low temperature solution technique using mixed solvent of methanol and water in equal ratio. Structural characterization was carried out by single crystal X-ray diffraction analysis and it crystallizes in centrosymmetric space group P121/c1. FTIR and UV-Vis-NIR spectroscopy confirmed the compound formation and help to determine the mode of binding of the ligand to the rare earth-metal ion. Dielectric constant and dielectric loss have been measured over the frequency range 100 Hz - 30MHz. The decrease in dielectric constant with increases in frequency is due to the transition from interfacial polarization to dipolar polarization. The small value of dielectric constant at higher frequency ensures that the crystal is good candidate for NLO devices. Dielectric loss represents the resistive nature of the material.

Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.

Science.gov (United States)

Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al

2015-03-25

Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.

42 CFR 410.134 - Provider qualifications.

Science.gov (United States)

2010-10-01

... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...

Detonation nanodiamond introduced into samarium doped ceria electrolyte improving performance of solid oxide fuel cell

Science.gov (United States)

Pei, Kai; Li, Hongdong; Zou, Guangtian; Yu, Richeng; Zhao, Haofei; Shen, Xi; Wang, Liying; Song, Yanpeng; Qiu, Dongchao

2017-02-01

A novel electrolyte materials of introducing detonation nanodiamond (DNDs) into samarium doped ceria (SDC) is reported here. 1%wt. DNDs doping SDC (named SDC/ND) can enlarge the electrotyle grain size and change the valence of partial ceria. DNDs provide the widen channel to accelerate the mobility of oxygen ions in electrolyte. Larger grain size means that oxygen ions move easier in electrolyte, it can also reduce the alternating current (AC) impedance spectra of internal grains. The lower valence of partial Ce provides more oxygen vacancies to enhance mobility rate of oxygen ions. Hence all of them enhance the transportation of oxygen ions in SDC/ND electrolyte and the OCV. Ultimately the power density of SOFC can reach 762 mw cm-2 at 800 °C (twice higher than pure SDC, which is 319 mw cm-2 at 800 °C), and it remains high power density in the intermediate temperature (600-800 °C). It is relatively high for the electrolyte supported (300 μm) cells.

Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

International Nuclear Information System (INIS)

Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

2008-01-01

A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

19 CFR 122.134 - When airline does not have in-bond liquor storeroom.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...

Characterization of luminescent samarium doped HfO2 coatings synthesized by spray pyrolysis technique

International Nuclear Information System (INIS)

Chacon-Roa, C; Guzman-Mendoza, J; Aguilar-Frutis, M; Garcia-Hipolito, M; Alvarez-Fragoso, O; Falcony, C

2008-01-01

Trivalent samarium (Sm 3+ ) doped hafnium oxide (HfO 2 ) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO 2 monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO 2 : SmCl 3 films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm 3+ ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed

The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters

International Nuclear Information System (INIS)

Szentkuti, L.; Breitrueck, H.; Giese, W.

1976-01-01

he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)

The theoretical basis and clinical methodology for stereotactic interstitial brain tumor irradiation using iododeoxyuridine as a radiation sensitizer and samarium-145 as a brachytherapy source

International Nuclear Information System (INIS)

Goodman, J.H.; Gahbauer, R.A.; Kanellitsas, C.; Clendenon, N.R.; Laster, B.H.; Fairchild, R.G.

1989-01-01

High grade astrocytomas have proven resistant to all conventional therapy. A technique to produce radiation enhancement during interstitial brain tumor irradiation by using a radiation sensitizer (IdUrd) and by stimulation of Auger electron cascades through absorption of low energy photons in iodine (Photon activation) is described. Clinical studies using IdUrd, 192 Ir as a brachytherapy source, and external radiation have produced promising results. Substituting samarium-145 for 192 Ir in this protocol is expected to produce enhanced results. 15 refs

Enhancement of the fluorescence of the samarium (III) complex by gadolinium (III)

International Nuclear Information System (INIS)

Yun-Xiang, C.; Zhang-Hua, L.

1988-01-01

The increase in sensitivity and selectivity of reactions in which colored species are formed by the addition of different metal ions is an area of research that has recently been developed. This phenomenon, which is sometimes called cocolaration effect, has been explained by the formation of mixed metal complex. The authors found an analogous phenomenon of reactions forming fluorescent complexes. The complexes of Sm(III)-thenoyltrifluoroacetone (TTA)-phenanthroline (Phen)-Triton-X-100 (TX-100) and Gd(III) (or La(III), Lu(III) and Y(III))-TTA-Phen-TX-100 had practically no fluorescence separately. Instead, a fluorescence-enhancement phenomenon caused by adding Gd or La, Lu and Y ions to the system was observed for the first time. The intensity of the enhanced fluorescence of Sm(III) complex was increased in the following order: La< Y< Lu< Gd. By analogy with cocoloration effect, the authors call this new fluorescence-enhancement phenomenon the co-fluorescence effect. The object of this work was to study the enhancement effect of Gd(III) on the fluorescence of the Sm(III)-TTA-Phen-TX-100 system. The recommended fluorimetric method has been applied to the determination of trace amounts of samarium in ytterbium oxide with satisfactory results. A general reaction mechanism for the system studied was proposed

10 CFR 60.134 - Design of seals for shafts and boreholes.

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...

13 CFR 134.712 - What are the limitations on new evidence?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

13 CFR 134.709 - When will a Judge dismiss an appeal?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

13 CFR 134.706 - What are the service and filing requirements?

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...

Antagomirs Targeting MicroRNA-134 Increase Limk1 Levels After Experimental Seizures in Vitro and in Vivo

Directory of Open Access Journals (Sweden)

Jiahang Sun

2017-09-01

Full Text Available Background: MiR-134 is enriched in dendrites of hippocampal neurons and plays crucial roles in the progress of epilepsy. The present study aims to investigate the effects of antagomirs targeting miroRNA-134 (Ant-134 on limk1 expression and the binding of miR-134 and limk1 in experimental seizure. Methods: Status epilepticus (SE rat model was established by lithium chloride-pilocarpine injection and was treated with Ant-134 by intracerebroventricular injection. Low Mg2+-exposed primary neurons were used as an in vitro model of SE. The expression of miR-134 was determined using real-time PCR. Protein expressions of limk1 and cofilin were determined by Western blotting. Luciferase reporter assay was used to examine the binding between miR-134 and limk1 3’-untranslated region. Results: The expression of miR-134 was markedly enhanced in hippocampus of the SE rats and low Mg2+-exposed neurons. Ant-134 increased the expression of limk1 and reduced the expression of cofilin in the SE hippocampus and Low Mg2+-exposed neurons. In addition, luciferase reporter assay confirmed that miR-134 bound limk1 3’-UTR. MiR-134 overexpression inhibited limk1 mRNA and protein expressions in neurons. Conclusion: Blockage of miR-134 upregulates limk1 expression and downregulated cofilin expression in hippocampus of the SE rats. This mechanism may contribute to the neuroprotective effects of Ant-134.

Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system

International Nuclear Information System (INIS)

Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari

2012-01-01

Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.

Sulfur Bridged Multidentate Ligands Based on (Bipyridyl-(Bi-1,3,4-Thiadiazolyl Conjugates

Directory of Open Access Journals (Sweden)

M. Teresa Clasadonte

2003-03-01

Full Text Available The synthesis of a series of mixed (bipyridyl/(bi1,3,4-thiadiazolyl ligands, derived from the condensation of 2-mercapto-5-methylthio-1,3,4-thiadiazole or 5-mercapto-5'-methylthio-2,2'-bi-1,3,4-thiadiazole with 2,6-bis(chloromethylpyridine or 6,6’-bis(chloromethyl-2,2’-bipyridine (compounds L1–L4, and of 2,5-dimercapto-1,3,4-thiadiazole or 5,5'-dimercapto-2,2'-di-1,3,4-thiadiazole with picolyl chloride hydrochloride or 6-chloromethyl-6'-methyl-2,2'-bipyridine (compounds L5–L8 in the presence of triethylamine is described. All new compounds have been characterized by FAB (+ spectrometry and NMR spectroscopy. 13C-NMR spectra are crucial to firmly establish the thiol structure of the title ligands.

Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134.

Science.gov (United States)

Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Chang, Yao-Wen; Nakamura, Takuro; Yanaka, Miyuki; Kato, Yukinari

2018-07-01

The epidermal growth factor receptor (EGFR) is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb), which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7%) to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375-394 amino acids of EGFR) neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377- RGDSFTHTPP -386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...

Transfer factors of 134Cs for olive and orange trees grown on different soils

International Nuclear Information System (INIS)

Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.

1999-01-01

Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

Adsorbate shape selectivity: Separation of the HF/134a azeotrope over carbogenic molecular sieve

Energy Technology Data Exchange (ETDEWEB)

Hong, A.; Mariwala, R.K.; Kane, M.S.; Foley, H.C. [Univ. of Delaware, Nework, DE (United States)

1995-03-01

Experimental evidence is provided for adsorptive shape selectivity in the separation of the azeotrope between HF and 1,1,1,2-tetrafluoroethane (134a) over pyrolyzed poly(furfuryl alcohol)-derived carbogenic molecular sieve (PPFA-CMS). The separation can be accomplished over coconut charcoal or Carbosieve G on the basis of the differences in the extent of equilibrium adsorption of HF and 134a. On these adsorbents 134a is more strongly bound than HF, thus it elutes much more slowly from the bed. The heat of adsorption for 134a in the vicinity of 200 C on Carbosieve G is {approximately}8.8 kcal/mol. In contrast, when the same azeotropic mixture is separated over PPFA-CMS prepared at 500 C, 134a is not adsorbed. As a result 134a elutes from the bed first, followed by HF. The reversal is brought about by the narrower pore size and pore size distribution of the PPFA-CMS versus that for Carbosieve G. Thus the separation over PPFA-CMS is an example of adsorbate shape selectivity and represents a limiting case of kinetic separation.

Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.

Science.gov (United States)

Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin

2017-01-01

The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

[Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].

Science.gov (United States)

Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei

2017-05-01

Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.

Results after therapy of pain from bone metastases with Samarium-153 in our centers in Lima, Peru

International Nuclear Information System (INIS)

Alvarado, N.; Eskenazi, S.; Valle, M.P.; Montoya, J.; Castro, M.; Montiel, L.; Velarde, V.; Jauregui, I.; Cueto, C.

2004-01-01

Full text: 105 patients with bone metastases from prostate and breast cancer; between 42 and 78 years age (median 61 years) were evaluated. Patients had intense pain that could not be managed with combinations of analgesic and anti tumoral drugs. All patients received 1.2 mCi/kg of Samarium-153 intravenously as treatment for pain due to bony metastases. The isotope obtained from atomic reactor placed in Lima - Peru, was provided by Peruvian Nuclear Energy Institute (IPEN). One week before therapy, all the patients had a bone scan study with Tc99m-MDP that showed the presence of multiple bone metastases with high blastic activity. Haematology and biochemical parameter checked were: Creatinine ( 150,000 mm3), Leukocytes (> 5,000 mm3), Red cells (>3,500,000 mm3). No problems were encountered during intravenous administration of the radioisotope. The side effects after treatment were: Primary effects: 16 cases of nausea, 2 of vomiting, 3 of headache, 28 had increment of pain, 6 had flushing. 50 patients did not have the primary symptoms. Secondary effects: 3 Patients showed drop in leukocyte count between 2nd and 3rd week of therapy. Red cells showed 10-15% decrease between 6th to 8th week. Platelets showed a decrease of about 15% with one peak between 1st and 2nd week post Samarium therapy. Data was analysed using an analogue visual scale of the pain with values from 0 - 10 (0-no pain; 10-maximum pain) and in the same way using the E.C.O.G. scale (Eastern Cooperative Oncology Group) in relationship with the Karnofsky index in order to establish functional recovery for each patient. The decrease of pain was seen between 4th-7th days (average 8 days). A second dose was given after 60 days in 12 patients and a third dose in 3 cases.11 patients died due to different causes between 30 - 60 days post treatment. The analgesic dose came down significantly in 80% of patients. We conclude that palliative therapy of metastatic bone pain in Peru is possible with radionuclides. It

Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134

Directory of Open Access Journals (Sweden)

Mika K. Kaneko

2018-07-01

Full Text Available The epidermal growth factor receptor (EGFR is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb, which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7% to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375–394 amino acids of EGFR neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377-RGDSFTHTPP−386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.

Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

International Nuclear Information System (INIS)

Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.

1993-08-01

The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)

13 CFR 134.711 - Will the Judge permit discovery and oral hearings?

Science.gov (United States)

2010-01-01

... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...

13 CFR 134.705 - What are the requirements for an appeal petition?

Science.gov (United States)

2010-01-01

... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

On the effects of pressure and irradiation on the transport properties of samarium compounds with unstable valence

International Nuclear Information System (INIS)

Morillo, J.

1983-06-01

We present the first extensive study of electronic transport properties of ''quasi-stoichiometric'' SmS as a function of pressure P, temperature T, magnetic field B and defect concentration C. SmS which is a semiconductor, undergoes with increasing P a first order transition towards an homogeneous intermediate valence state. In the semiconducting phase (s.c.), the energie epsilon(f) necessary to delocalize a 4f electron increases greatly with T and is about 250meV at 300K. The phase diagram for the first order electronic transition Sm 2 + →Smsup(2+epsilon) with P has been determined for T 6 has been investigated by resistivity measurements under irradiation at 21K. The threshold energy Ed for displacement of Sm in SmS has been determined: Ed(Sm) = 20 +- 2 eV, and the observed effects of irradiation have been associated to samarium displacements (vacancies and interstitials) [fr

Effect of Zinc Oxide Doping on Electroluminescence and Electrical Behavior of Metalloporphyrins-Doped Samarium Complex

Science.gov (United States)

Janghouri, Mohammad; Amini, Mostafa M.

2018-02-01

Samarium complex [(Sm(III)] as a new host material was used for preparation of red organic light-emitting diodes (OLEDs). Devices with configurations of indium-doped tin oxide (ITO)/poly(3,4-ethylenedioxythiophene):(poly(styrenesulfonate) (PEDOT:PSS (50 nm)/polyvinyl carbazole (PVK):[zinc oxide (ZnO)] (50 nm)/[(Sm(III)]:[zinc(II) 2,3-tetrakis(dihydroxyphenyl)-porphyrin and Pt(II) 2,3-dimethoxyporphyrin] (60 nm)/2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) (15 nm)/Al (150 nm) have been fabricated and investigated. An electroplex occurring at the (PVK/Sm: Pt(II) 2,3-dimethoxyporphyrin) interface has been suggested when ZnO nanoparticles were doped in PVK. OLED studies have revealed that the photophysical characteristics and electrical behavior of devices with ZnO nanoparticles are much better than those of devices with pure PVK. The efficiency of devices based on [(Sm(III)] was superior than that of known aluminum tris(8-hydroxyquinoline) (Alq3) and also our earlier reports on red OLEDs under the same conditions.

Solar Hydrogen Production via a Samarium Oxide-Based Thermochemical Water Splitting Cycle

Directory of Open Access Journals (Sweden)

Rahul Bhosale

2016-04-01

Full Text Available The computational thermodynamic analysis of a samarium oxide-based two-step solar thermochemical water splitting cycle is reported. The analysis is performed using HSC chemistry software and databases. The first (solar-based step drives the thermal reduction of Sm2O3 into Sm and O2. The second (non-solar step corresponds to the production of H2 via a water splitting reaction and the oxidation of Sm to Sm2O3. The equilibrium thermodynamic compositions related to the thermal reduction and water splitting steps are determined. The effect of oxygen partial pressure in the inert flushing gas on the thermal reduction temperature (TH is examined. An analysis based on the second law of thermodynamics is performed to determine the cycle efficiency (ηcycle and solar-to-fuel energy conversion efficiency (ηsolar−to−fuel attainable with and without heat recuperation. The results indicate that ηcycle and ηsolar−to−fuel both increase with decreasing TH, due to the reduction in oxygen partial pressure in the inert flushing gas. Furthermore, the recuperation of heat for the operation of the cycle significantly improves the solar reactor efficiency. For instance, in the case where TH = 2280 K, ηcycle = 24.4% and ηsolar−to−fuel = 29.5% (without heat recuperation, while ηcycle = 31.3% and ηsolar−to−fuel = 37.8% (with 40% heat recuperation.

Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

Directory of Open Access Journals (Sweden)

Arthur Villarim Neto

2009-02-01

Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

Heat transfer performance during condensation of R-134a inside helicoidal tubes

International Nuclear Information System (INIS)

Al-Hajeri, M.H.; Koluib, A.M.; Mosaad, M.; Al-Kulaib, S.

2007-01-01

This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m 2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant

'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta

Energy Technology Data Exchange (ETDEWEB)

Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)

1988-07-01

Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)

Determination of Cs-134 and Cs-137 rain water samples

International Nuclear Information System (INIS)

Lima, M.F.; Mazzilli, B.

1988-01-01

In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt

Causes of seasonal variations of Cs-134/137 activity concentrations in surface air; Ursachen der jahreszeitlichen Schwankungen der Aktivitaetskonzentrationen von Cs-134/137 in der bodennahen Luft

Energy Technology Data Exchange (ETDEWEB)

Hoetzl, H. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Winkler, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz

1993-12-31

In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called `Stagnationsindex`. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [Deutsch] Zur Klaerung der an verschiedenen Orten Europas in den Wintermonaten beobachteten Maxima der Cs-134/137-Aktivitaetskonzentrationen in der bodennahen Luft wurde von Oktober 1991 bis November 1992 ein Messgrogramm mit relativ kurzen Zeitintervallen fuer die Aerosolsammlung (48-72 Stunden) durchgefuehrt. Gleichzeitig wurden lokale meteorologische Parameter miterfasst. Die statistische Auswertung der Messergebnisse lieferte eine hochsignifikante positive Korrelation zwischen der Aktivitaetskonzentration von Cs-137 und dem sog. Stagnationsindex. Auf Grund dieses Zusammenhangs lassen sich die saisonalen Schwankungen der Cs-134/137-Luftkonzentrationen mit dem haeufigen Auftreten von austauscharmen Wetterlagen in den Herbst- und Wintermonaten erklaeren. (orig.)

Resolution of the uncertainties in the radiative forcing of HFC-134a

International Nuclear Information System (INIS)

Forster, Piers M. de F; Burkholder, J.B.; Clerbaux, C.; Coheur, P.F.; Dutta, M.; Gohar, L.K.; Hurley, M.D.; Myhre, G.; Portmann, R.W.; Shine, K.P.; Wallington, T.J.; Wuebbles, D.

2005-01-01

HFC-134a (CF 3 CH 2 F) is the most rapidly growing hydrofluorocarbon in terms of atmospheric abundance. It is currently used in a large number of household refrigerators and air-conditioning systems and its concentration in the atmosphere is forecast to increase substantially over the next 50-100 years. Previous estimates of its radiative forcing per unit concentration have differed significantly ∼25%. This paper uses a two-step approach to resolve this discrepancy. In the first step six independent absorption cross section datasets are analysed. We find that, for the integrated cross section in the spectral bands that contribute most to the radiative forcing, the differences between the various datasets are typically smaller than 5% and that the dependence on pressure and temperature is not significant. A 'recommended' HFC-134a infrared absorption spectrum was obtained based on the average band intensities of the strongest bands. In the second step, the 'recommended' HFC-134a spectrum was used in six different radiative transfer models to calculate the HFC-134a radiative forcing efficiency. The clear-sky instantaneous radiative forcing, using a single global and annual mean profile, differed by 8%, between the 6 models, and the latitudinally-resolved adjusted cloudy sky radiative forcing estimates differed by a similar amount. We calculate that the radiative forcing efficiency of HFC-134a is 0.16+/-0.02Wm -2 ppbv -1

Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

Energy Technology Data Exchange (ETDEWEB)

Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D

1993-08-01

The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)

Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age

International Nuclear Information System (INIS)

Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.

2004-01-01

In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)

13 CFR 134.714 - When must the Judge issue his or her decision?

Science.gov (United States)

2010-01-01

... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

Neutron Inelastic Scattering on 134Xe at En = 5 - 8 MeV

Science.gov (United States)

Kidd, Mary; Tornow, Werner; Finch, Sean; Krishichayan, Fnu; Bhike, Megha

2017-09-01

Neutrinoless double-beta decay (0 νββ) studies are both the best way to determine the Majorana nature of the neutrino and determine its effective mass. The two main experiments searching for 0 νββ -decay of 136Xe (Q value = 2457.8 keV) are Kamland-Zen and EXO-200. Though both experiments have enriched 136Xe targets, these targets still contain significant quantities of 134Xe. Recently, a new nuclear level was discovered in 134Xe that decays to the ground state emitting a 2485.7 keV gamma ray. The γ-ray production cross section for this branch was found to be on the order of 10 mb for incident neutron energies of 2.5-4.5 MeV. Here, we have extended the investigation of this level to higher incident neutron energies, and further explore the potential neutron-induced backgrounds on both 134Xe and 136Xe for extended neutron energies. We will report our preliminary results for neutron inelastic scattering on 134Xe in applications to 0 νββ decay searches. NSF PHY-1614348, DE-FG02-97ER41033.

Performance and energy saving analysis of a refrigerator using hydrocarbon mixture (HC-R134a) as working fluid

Science.gov (United States)

Mohtar, M. N.; Nasution, H.; Aziz, A. A.

2015-12-01

The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a

43 CFR 13.4 - Terms of permit.

Science.gov (United States)

2010-10-01

... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...

Adsorption of *sp134*Cs onto two different types of roof materials

International Nuclear Information System (INIS)

Quenild, C.; Tveten, U.

1983-01-01

The report relates to a subproject under a Nordic project called ''Large reactor accidents - consequences and mitigating actions''. Natural decontamination of two types of roof material, typical of Norwegian and Swedish buildings, was examined. The roofs were contaminated with *sp134*Cs. After two days with 7 mm precipitation, the remaining activity on the tar-paper roof was 97% and on the steel roof 29%. After 8 months the remaining activity was 61% on the tar-paper roof and 22% on the steel roof. In spring *sp134*Cs was spread upon an 8 cm thick layer of fresh snow on an additional tar-paper roof. After 3 montsh and 191 mm precipitation the remaining activity was 59%. All results are based upon *sp134*Cs in collected run-off water.(Auth.)

Development and evaluation of copper-67 and samarium-153 labeled conjugates for tumor radioimmunotherapy

International Nuclear Information System (INIS)

Srivastava, S.C.; Mausner, L.F.; Mease, R.C.; Meinken, G.E.; Joshi, V.; Kolsky, K.; Sweet, M.; Steplewski, Z.

1995-01-01

The potential of utilizing receptor-specific agents such as monoclonal antibodies (MAb), and MAb-derived smaller molecules, as carriers of radionuclides for the selective destruction of tumors has stimulated much research activity. The success of such applications depends on many factors, especially the tumor binding properties of the antibody reagent, the efficiency of labeling and in-vivo stability of the radioconjugate and, on the careful choice of the radionuclide best suited to treat the tumor under consideration. The radiolabeled antibody technique for radioimmunotherapy (RIT), however, has experienced many limitations, and its success has not matched the expectations that were raised more than a decade ago. The problems that have been identified include: (i) degradation of antibody immunoreactivity resulting from chemical manipulations required for labeling; (ii) lack of suitable radioisotopes and methods for stable attachment of the radiolabel; (iii) in-vivo instability of the radioimmunoconjugates; (iv) excessive accumulation of activity in non-target locations; and (v) lack of radioimmunoconjugate accessibility to cells internal to a tumor mass. A careful choice of the radionuclide(s) best suited to treat the tumor under consideration is one of the most important requirements for successful radioimmunotherapy. This study evaluates copper 67 and samarium 153 for tumor radioimmunotherapy

Implementation of R134a Thermophysical Properties for MARS Application

Energy Technology Data Exchange (ETDEWEB)

Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

2016-05-15

MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.

Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)

International Nuclear Information System (INIS)

Norfaizal Mohamed; Nita Salina Abu Bakar; Zal Uyun Wan Mahmood; Nur Hidaya Dmuliany Mohd Sidek; Zaharudin Ahmad

2010-01-01

Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)

All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

Energy Technology Data Exchange (ETDEWEB)

Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)

2014-12-15

We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.

40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.

Science.gov (United States)

2010-07-01

... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...

Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole

International Nuclear Information System (INIS)

Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.

2015-01-01

Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.

Separation of 134Cs and 137Cs from 125I solution for medical applications

International Nuclear Information System (INIS)

Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy

2015-01-01

While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.

Experimental study of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator

International Nuclear Information System (INIS)

Wongwises, Somchai; Chimres, Nares

2005-01-01

This work presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). A refrigerator designed to work with HFC-134a with a gross capacity of 239 l is used in the experiment. The consumed energy, compressor power and refrigerant temperature and pressure at the inlet and outlet of the compressor are recorded and analysed as well as the distributions of temperature at various positions in the refrigerator. The refrigerant mixtures used are divided into three groups: the mixture of three hydrocarbons, the mixture of two hydrocarbons and the mixture of two hydrocarbons and HFC-134a. The experiments are conducted with the refrigerants under the same no load condition at a surrounding temperature of 25 deg. C. The results show that propane/butane 60%/40% is the most appropriate alternative refrigerant to HFC-134a

Morphine Preconditioning Downregulates MicroRNA-134 Expression Against Oxygen-Glucose Deprivation Injuries in Cultured Neurons of Mice.

Science.gov (United States)

Meng, Fanjun; Li, Yan; Chi, Wenying; Li, Junfa

2016-07-01

Brain protection by narcotics such as morphine is clinically relevant due to the extensive use of narcotics in the perioperative period. Morphine preconditioning induces neuroprotection in neurons, but it remains uncertain whether microRNA-134 (miR-134) is involved in morphine preconditioning against oxygen-glucose deprivation-induced injuries in primary cortical neurons of mice. The present study examined this issue. After cortical neurons of mice were cultured in vitro for 6 days, the neurons were transfected by respective virus vector, such as lentiviral vector (LV)-miR-control-GFP, LV-pre-miR-134-GFP, LV-pre-miR-134-inhibitor-GFP for 24 hours; after being normally cultured for 3 days again, morphine preconditioning was performed by incubating the transfected primary neurons with morphine (3 μM) for 1 hour, and then neuronal cells were exposed to oxygen-glucose deprivation (OGD) for 1 hour and oxygen-glucose recovery for 12 hours. The neuronal cells survival rate and the amount of apoptotic neurons were determined by MTT assay or TUNEL staining at designated time; and the expression levels of miR-134 were detected using real-time reverse transcription polymerase chain reaction at the same time. The neuronal cell survival rate was significantly higher, and the amount of apoptotic neurons was significantly decreased in neurons preconditioned with morphine before OGD than that of OGD alone. The neuroprotection induced by morphine preconditioning was partially blocked by upregulating miR-134 expression, and was enhanced by downregulating miR-134 expression. The expression of miR-134 was significantly decreased in morphine-preconditioned neurons alone without transfection. By downregulating miR-134 expression, morphine preconditioning protects primary cortical neurons of mice against injuries induced by OGD.

Synthesis of novel 2,5-disubstituted-1,3,4-selenadiazoles from fatty acid hydrazides

Directory of Open Access Journals (Sweden)

Himani Varshney

2018-01-01

Full Text Available A series of novel unsaturated hydroxy and non-hydroxy fatty acid residue substituted 1,3,4-selenadiazoles were described here. These derivatives were synthesized from the reaction of fatty acid hydrazide 1(a–d with acetyl chloride in the presence of anhydrous sodium carbonate in tetrahydrofuran and water at 0 °C, to form N′-acetyl undec-10-enoic hydrazide 2a, N′-acetyl-(9Z-octadec-9-enoic hydrazide 2b, N′-acetyl-(9Z, 12R-12-hydroxy-9-enoic hydrazide 2c, and N′-acetyl-(9R, 12Z-9-hydroxy-12-enoic hydrazide 2d. Then these hydrazines (dicarbonyl compound on reaction with Woollin’s reagent (WR in toluene led to the corresponding 2-(dec-9′-enyl-5-methyl-1,3,4-selenadiazole 3a, 2-[(8′Z-heptadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3b, 2-[(8′Z, 11′R-11′-hydroxy-octadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3c, and 2-[(8′R, 11′Z-8′-hydroxy-octadec-11′-enyl]-5-methyl-1,3,4-selenadiazole 3d, respectively. These synthesized compounds were characterized on the basis of IR, 1H NMR, 13C NMR, mass spectra and elemental analysis results.

Study of samarium modified lead zirconate titanate and nickel zinc ferrite composite system

Energy Technology Data Exchange (ETDEWEB)

Rani, Rekha [Department of Physics, SD PG College, Panipat 132103 (India); School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Juneja, J.K., E-mail: jk_juneja@yahoo.com [Department of Physics, Hindu College, Sonepat 131001 (India); Singh, Sangeeta [Department of Physics, GVM Girls College, Sonepat 131001 (India); Raina, K.K. [School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Prakash, Chandra [Solid State Physics Laboratory, Timarpur, Delhi 110054 (India)

2015-03-15

In the present work, composites of samarium substituted lead zirconate titanate and nickel zinc ferrite with compositional formula 0.95Pb{sub 1−3x/2} Sm{sub x}Zr{sub 0.65}Ti{sub 0.35}O{sub 3}–0.05Ni{sub 0.8}Zn{sub 0.2}Fe{sub 2}O{sub 4} (x=0, 0.01, 0.02 and 0.03) were prepared by the conventional solid state route. X-ray diffraction analysis was carried out to confirm the coexistence of individual phases. Microstructural study was done by using scanning electron microscope. Dielectric constant and loss were studied as a function of temperature and frequency. To study ferroelectric and magnetic properties of the composite samples, corresponding P–E and M–H hysteresis loops were recorded. Change in magnetic properties of electrically poled composite sample (x=0.02) was studied to confirm the magnetoelectric (ME) coupling. ME coefficient (dE/dH) of the samples (x=0 and 0.02) was measured as a function of DC magnetic field. - Highlights: • We are reporting the effect of Sm substitution on PZT–NiZn ferrite composites. • Observation of both P–E and M–H loops confirms ferroelectric and magnetic ordering. • With Sm substitution, significant improvement in properties was observed. • Increase in magnetization for electrically poled sample is evidence of ME coupling. • Electric polarization is generated by applying magnetic field.

Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

Energy Technology Data Exchange (ETDEWEB)

Garcia G, N

2006-07-01

Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

Dynamics of cesium-134 and biomass in treated and untreated turkey oak leaf-litter bags

International Nuclear Information System (INIS)

Croom, J.M.; Ragsdale, H.L.

1978-01-01

Litter bags were prepared from leaves harvested in late fall from turkey oak trees (Quercus laevis) tagged with 134 Cs. Untreated bags and bags treated by soaking in 1000 ppM HgCl 2 were placed in the field on Dec. 7, 1974. Five bags of each treatment were retrieved at 7-, 14-, and 30-day intervals as the experiment progressed. Treated bags remained free of visible fungal hyphae growth for 12 weeks. Untreated bags had lost more weight but less 134 Cs than treated bags after 14 and 56 days, respectively. After 9 months, untreated bags had lost 33% weight and 90% 134 Cs. Although 134 Cs is rapidly leached from litter (ecological half-life approximately equal to 12 weeks), some is retained by fungal hyphae on leaf-litter surfaces. This mechanism of mineral retention in the litter layer could represent adaptation at the ecosystem level for nutrient conservation

Neutron-induced Backgrounds in 134Xe for Large-Scale Neutrinoless Double-Beta Decay Experiments

Science.gov (United States)

Moriguchi, Nina; Kidd, Mary; Tornow, Werner

2016-09-01

136Xe is used in large neutrinoless double-beta (0 νββ) decay experiments, such as KamLAND- Zen and EXO 200. Though highly purified, 136Xe still contains a significant amount of 134Xe. Recently, a new nuclear energy level was found in 134Xe. If 134Xe decays from this proposed excited state, it will emit a 2485.7 keV gamma ray. Because this energy lies near the region of interest of 136Xe νββ decay experiments (Q value 2457.8 keV), it could make a significant contribution to the background. A purified gaseous sample of 134Xe will be irradiated with neutrons of an incident energy of 4.0 MeV at Triangle Universities Nuclear Laboratory and monitored with high-purity germanium detectors. The spectra obtained from these detectors will be analyzed for the presence of the 2581 keV gamma ray. We will report on the status of this experiment. Future plans include expanding this measurement to higher initial neutron energies. Tennesse Tech University CISE Grant program.

13 CFR 134.618 - How are awards paid?

Science.gov (United States)

2010-01-01

... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...

Development of two-stage compression heat pump for hot water supply in commercial use. Research of compatibility with alternative refrigerant, HFC-134a; Gyomuyo nidan asshukushiki kyuto heat pump no kaihatsu. Daitai reibai HFC-134a no tekiyosei kensho

Energy Technology Data Exchange (ETDEWEB)

Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)

1996-03-01

Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.

Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

Energy Technology Data Exchange (ETDEWEB)

Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

2010-07-01

This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

Assessment of propane/commercial butane mixtures as possible alternatives to R134a in domestic refrigerators

International Nuclear Information System (INIS)

Fatouh, M.; El Kafafy, M.

2006-01-01

The possibility of using hydrocarbon mixtures as working fluids to replace R134a in domestic refrigerators has been evaluated through a simulation analysis in the present work. The performance characteristics of domestic refrigerators were predicted over a wide range of evaporation temperatures (-35 to -10 o C) and condensation temperatures (40-60 deg. C) for various working fluids such as R134a, propane, commercial butane and propane/iso-butane/n-butane mixtures with various propane mass fractions. The performance characteristics of the considered domestic refrigerator were identified by the coefficient of performance (COP), volumetric cooling capacity, cooling capacity, condenser capacity, input power to compressor, discharge temperature, pressure ratio and refrigerant mass flow rate. The results showed that pure propane could not be used as a drop in replacement for R134a in domestic refrigerators because of its high operating pressures and low COP. Commercial butane yields many desirable characteristics but requires a compressor change. The coefficient of performance of the domestic refrigerator using a ternary hydrocarbon mixture with propane mass fractions from 0.5 to 0.7 is higher than that of R134a. Comparison among the considered working fluids confirmed that the average refrigerant mass flow rate of the propoane/commercial butane mixture is 50% lower than that of R134a. Also, the results indicated that R134a and the propoane/commercial butane mixture with 60% propane mass concentration have approximately the same values of saturation pressure, compressor discharge temperature, condenser heat load, input power, cooling capacity and volumetric cooling capacity. However, the pressure ratio of the hydrocarbon mixture with 60% propane is lower than that of R134a by about 11.1%. Finally, the reported results confirmed that the propane/iso-butane/n-butane mixture with 60% propane is the best drop in replacement for R134a in domestic refrigerators under normal

An experimental evaluation of the greenhouse effect in the substitution of R134a with CO2

International Nuclear Information System (INIS)

Aprea, C.; Greco, A.; Maiorino, A.

2012-01-01

This paper addresses the problem of R314a substitution with a natural refrigerant fluid. Attention is devoted to the evaluation of the environmental impact, in terms of greenhouse effect. R134a and R744 (CO 2 ) are compared to one another. The hydrofluorocarbon R134a has a large direct warming impact (GWP), whereas the R744 contribution is negligible. The greenhouse effect is determined by the experimental evaluation of the TEWI index (Total Equivalent Warming Impact) that takes into account both direct and indirect contributions to global warming. This paper compares a commercial R134a refrigeration plant and a prototype R744 system working in a trans-critical cycle. The experimental results clearly show that the latter has a larger TEWI than the system operating with R134a. The indirect contribution to global warming provided by R744 is always greater than that of R134a. This contribution prevails in most cases. Only few operating conditions corresponding to a refrigerating plant working as a classical split system benefits, in terms of greenhouse effect, of the substitution of R134a with R744. -- Highlights: ► A comparison between a classical vapour compression plant and a trans-critical cycle. ► Evaluation of the greenhouse effect in R134a substitution with R744. ► Evaluation of direct and indirect contribution to global warming. ► Minimization of the global warming impact of a R744 transcritical cycle.

Concentration of 134Cs and 137Cs in Malaysian palm products

International Nuclear Information System (INIS)

Yii Mei Wo; Nor Aza Hassan; Narizan Sanusi

2008-08-01

Until today, countries importing food products from Malaysia, in region such as Indian Continental, Middle East, Central Europe and Central America still require the products to be tested for the radioactive contamination particularly for 134 Cs and 137 Cs. Information extracted from 3371 analytical results observed on isotopic concentration for 134 Cs and 137 Cs in the exported Malaysia origins palm products between years 2002 until 2007 had been summarized and reported in this work. Data shown that the concentration level of the concerned radio nuclides are below the minimum detectable activity and also well below maximum permissible limits adopted by Malaysian Government and also the international bodies. (Author)

Recombinant human parathyroid hormone related protein 1-34 and 1-84 and their roles in osteoporosis treatment.

Directory of Open Access Journals (Sweden)

Hua Wang

Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.

Determination of curie content and 134/137cesium ratios by gamma spectroscopy of high burnup plutonium-aluminum fuel assemblies

International Nuclear Information System (INIS)

Haggard, D.L.; Tanner, J.E.

1997-06-01

Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure 134/137 Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. 134/137 Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from 134 Cs and the 662 keV peak from 137 Cs/ 137m Ba. Assembly No. 2 134/137 Cs ratio measured on 4-15-92 was 0.19. The measured 134/137 Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of 134 Cs and 137 Cs. The measured 134/137 Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of 134 Cs and 8620--11646 curies of 137 Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies 134 Cs and 8973 curies 137 Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured 134 Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured 137 Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material

Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

International Nuclear Information System (INIS)

Essman, Stephanie C.; Lewis, Michael R.; Fox, Derek B.

2008-01-01

Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ( 153 Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic 153 Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of 153 Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of 153 Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of 153 Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P 153 Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted

Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece

International Nuclear Information System (INIS)

Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.

1994-01-01

The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)

Soil to plant transfer of 134Cs for olive and orange trees after four years' experimentation

International Nuclear Information System (INIS)

Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.

1998-01-01

The transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) were calculated within a long-term glass-house pot experiment which was started in 1994. The effect of the soil characteristics on 134 Cs uptake was also studied using two soils with different physical and chemical properties. Both evergreen trees exhibited a similar behavior in the two soils, showing that a higher or lower uptake is not crop specific. The capacity of the trees for 134 Cs absorption through the roots seems to be significantly influenced by the soil type. The transfer factors were very low in the calcareous heavy soil and much higher in the acid light soil (up to 10 times for olives and 40 for the edible part of oranges). The difference in the TFs is higher between the two soils than between the two tree species. 134 Cs concentration kept increasing in the orange trees up to the 4th year of growth, while it seems to reach an equilibrium, with no further increase, in the olive trees. Although the behavior of the two tree species is similar, the difference in the final processed product is extreme. A significant amount of 134 Cs was observed in olives grown in the light-acid soil whereas no transfer to the olive oil was detected. On the other hand, the edible part of the oranges showed the highest 134 Cs of nearly all the plant parts

Mobility of superficially applied caesium-134 and strontium-85 in apple branches under precipitation-free conditions

International Nuclear Information System (INIS)

Bengtsson, G.B.

1992-01-01

The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)

Uptake of radiocesium by three plants grown in 134Cs contaminated soil under pot experiment condition

International Nuclear Information System (INIS)

Zheng Jiemin; Li Hongyan; Niu Tianxin; Chen Ziyuan; Tang Shirong

2009-01-01

Pot experiment was conducted to investigate the accumulation dynamics of 134 Cs in shoots of Rumex acetosa, Rumex hastatus and Helianthus annuus grown in 134 Cs contaminated soil under greenhouse condition. Results showed that shoot biomass of H. annuus was significantly higher than that of R. acetosa and R. hastatus; among 3 plant species, 13 '4Cs specific activity in shoots was the highest in H. annuus after treatment for 50 days, however after treatment for 70 days, that in R. acetosa was the highest. Bioaccumulation ratio reached 1.5, 1.4 and 1.3 in R. acetosa, R. hastatus and H. annuus at the end of experiment, respectively, and the former two plants kept with trend of continuously increasing during the experiment period. Three plants were tolerant to 134 Cs contaminated slil and capable to translocate 134 Cs from soil to plants. Among them, H. annuus removed greatest 134 Cs amount in the above ground part, and R. acetosa, R. hastatus showed higher tranclocation factor of Cs than H. annuus. Three plants are promising for phytoremediation of soil contaminated with radiocesium, and also could be used for phytoremediation of radiocesium and heavy metals complex contamination, potentially. (authors)

10 CFR 63.134 - Monitoring and testing waste packages.

Science.gov (United States)

2010-01-01

....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...

Calibration of the SH134-20 Standard Gain Horn

DEFF Research Database (Denmark)

Pivnenko, Sergey; Breinbjerg, Olav

This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...

Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions

Science.gov (United States)

Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.

2014-01-01

HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438

STS-134 Re-Rendezvous Design History

Science.gov (United States)

Stuit, Timothy D.

2011-01-01

In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.

R134a Flow Boiling Analysis with Modified Thermodynamic Property File of MARS Code

Energy Technology Data Exchange (ETDEWEB)

Son, Gyumin; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

2016-10-15

Previous study showed application of RELAP5 code to solar energy facility with molten salt (60% NaNO3 and 40% KNO3) as working fluid. Based on external experimental correlations, thermodynamic properties of molten salt were evaluated as a function of pressure and temperature and those equations were used to generate tpf. To validate external tpf, experimental values were compared with RELAP5 analysis. In nuclear field, utilization of other fluid is also important since many thermal-hydraulic experiments used various fluids such as FC-72, R123, and R134a. Theses refrigerants have been used to simulate the high pressure environment of nuclear power plants due to their low boiling point, and density ratio between vapor and liquid. Thus, this study aims for tpf generation of R134a and verification by analyzing real case. R134a is selected as a fluid to be implemented and analyzed because it is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. R134a property file were generated with fitted equation using temperature and pressure as variables, originated from external data source. For validation, flow boiling experiment case were made into simplified input. Analysis with tpfr134a showed that application of Gnielinksi correlation could enhance single phase flow accuracy. Large error of HTC from two phase analysis requires parameter study. Future work aims for more specified experimental case comparison and correlation enhancement for two phase analysis.

Bent Shaped 1,3,4-Oxadiazole/Thiadiazole heterocyclic rings ...

Indian Academy of Sciences (India)

Two series of bent shaped 1,3,4-oxadiazole/thiadiazole heterocyclic ring containing liquid crystalline (LC) compounds were synthesized and characterized by FT-IR, 1H, 13C-NMR and ESI-Mass spectro-scopic techniques. Liquid crystal properties were investigated by polarized optical microscopy and differential scanning ...

MicroRNA-134 regulates lung cancer cell H69 growth and apoptosis by targeting WWOX gene and suppressing the ERK1/2 signaling pathway

International Nuclear Information System (INIS)

Chen, Tianjun; Gao, Fei; Feng, Sifang; Yang, Tian; Chen, Mingwei

2015-01-01

MicroRNAs have been shown to act as crucial modulators during carcinogenesis. Recent studies have implied that miR-134 expression associated with epithelial-to-mesenchymal transition phenotype and invasive potential of NSCLC cells. Our study investigated the pathogenic implications of miR-134 in small cell lung cancer (SCLC). Overexpression or inhibition MiR-134 expression by miR-134 mimics or miR-134 inhibitors (anti-miR-134) in SCLC cell lines was detected using qRT-PCR. Lactate dehydrogenase (LDH) assay, MTT assays and flow cytometry were performed in order to clarify the growth and apoptosis of SCLC cells which had been transfected with miR-134 mimics or anti-miR-134. WWOX expression in H69 cells was detected by qRT-PCR and western blot, respectively. The results showed that overexpression miR-134 was significantly promoting SCLC cells growth and inhibit its apoptosis. In addition, reduced miR-134 expression was significantly correlated with cell growth inhibition and apoptosis promotion. Furthermore, transfection of miR-134 mimics into the SCLC cells markedly down-regulated the level of WWOX, whereas, anti-miR-134 up-regulated WWOX expression. We also found that overexpression WWOX attenuate miR-134 induced H69 cells growth, and promote cell apoptosis. Moreover, miR-134 promoted cell proliferation and inhibit apoptosis via the activation of ERK1/2 pathway. These findings suggest that miR-134 may be an ideal diagnostic and prognostic marker, and may be attributed to the molecular therapy of SCLC. - Highlights: • MiR-134 play roles in small cell lung cancer cell growth and apoptosis. • MiR-134 negative regulated the level of WWOX in H69 cells. • WWOX overexpression attenuate miR-134 induced H69 cells growth. • MiR-134 promotes cell growth via the activation of ERK1/2 pathway

EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER

OpenAIRE

Bhatkar, V. W.

2018-01-01

An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...

MicroRNA hsa-miR-134 is a circulating biomarker for mesial temporal lobe epilepsy.

Directory of Open Access Journals (Sweden)

Simoni H Avansini

Full Text Available Epilepsy is misdiagnosed in up to 25% of patients, leading to serious and long-lasting consequences. Recently, circulating microRNAs have emerged as potential biomarkers in a number of clinical scenarios. The purpose of this study was to identify and to validate circulating microRNAs that could be used as biomarkers in the diagnosis of epilepsy. Quantitative real-time PCR was used to measure plasma levels of three candidate microRNAs in two phases of study: an initial discovery phase with 14 patients with mesial temporal lobe epilepsy (MTLE, 13 with focal cortical dysplasia (FCD and 16 controls; and a validation cohort constituted of an independent cohort of 65 patients with MTLE and 83 controls. We found hsa-miR-134 downregulated in patients with MTLE (p = 0.018 but not in patients with FCD, when compared to controls. Furthermore, hsa-miR-134 expression could be used to discriminate MTLE patients with an area under the curve (AUC of 0.75. To further assess the robustness of hsa-miR-134 as a biomarker for MTLE, we studied an independent cohort of 65 patients with MTLE, 27 of whom MTLE patients were responsive to pharmacotherapy, and 38 patients were pharmacoresistant and 83 controls. We confirmed that hsa-miR-134 was significantly downregulated in the plasma of patients with MTLE when compared with controls (p < 0.001. In addition, hsa-miR-134 identified patients with MTLE regardless of their response to pharmacotherapy or the presence of MRI signs of hippocampal sclerosis. We revealed that decreased expression of hsa-miR-134 could be a potential non-invasive biomarker to support the diagnosis of patients with MTLE.

Environmentally benign synthesis of sydnone containing 1,3,4 ...

Indian Academy of Sciences (India)

TECS

lop benign synthetic methods for sydnone deriva- tives,. 9 we report here a new series of sydnone containing 1,3,4-thiadiazines by microwave irradia- tion under solvent-free conditions. 2. Experimental. 2.1 General remarks. Melting points were determined by open capillary method and are uncorrected. All compounds were.

Observation of near infrared and enhanced visible emissions from electroluminescent devices with organo samarium(III) complex

Energy Technology Data Exchange (ETDEWEB)

Chu, B [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, W L [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Hong, Z R [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Zang, F X [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wei, H Z [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wang, D Y [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, M T [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Lee, C S [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China); Lee, S T [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China)

2006-11-07

Samarium (dibenzoylmethanato){sub 3} bathophenanthroline (Sm(DBM){sub 3} bath) was employed as an emitting and electron transport layer in organic light emitting diodes (OLEDs), and narrow electroluminescent (EL) emissions of a Sm{sup 3+} ion were observed in the visible and near infrared (NIR) region, differing from those of the same devices with Eu{sup 3+}- or Tb{sup 3+}-complex EL devices with the same structure. The EL emissions of the Sm{sup 3+}-devices originate from transitions from {sup 4}G{sub 5/2} to the lower respective levels of Sm{sup 3+} ions. A maximum luminance of 490 cd m{sup -2} at 15 V and an EL efficiency of 0.6% at 0.17 mA cm{sup -2} were obtained in the visible region, and the improved efficiency should be attributed to introducing a transitional layer between the N,N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-diphenyl-4,4'-diamine (TPD) film and the Sm(DBM){sub 3} bath film and the avoidance of interfacial exciplex emission in devices. Sharp emissions of Sm{sup 3+} ions in the NIR region were also observed under a lower threshold value less than 4.5 V.

Accumulation, distribution and excretion of 134Cs and 65Zn by the green mussels (Perna Viridis)

International Nuclear Information System (INIS)

Chen Shunhua; Zhong Chuangguang; Yan Yuanyi; Zhao Xiaokui; Peng Yefang; Shi Qiong

1997-10-01

Two important radionuclides 134 Cs and 65 Zn were applied to study the accumulation, distribution and excretion of radioactive nuclides in organs and tissues of green mussel Perna Viridis. the results showed that the uptake rate of 134 Cs by green mussels was very low and the concentration factor (CF) for 134 Cs in the byssus approximated to 1. This CF value was lower than that of other tissues and organs of mussels, but its excretion rate was much higher than that of soft tissues. It was also found that the byssus of mussels had a special ability to accumulate 65 Zn. Concentration factor (CF) for 65 Zn in the byssus could reach as high as 900, which was much higher than that of any other tissues. However, its excretion rate was lower than that of other tissues and organs. The uptake rate of 65 Zn by soft tissues was markedly higher than that of 134 Cs. The mussels could also highly concentrate the low level 65 Zn even if specific activity of 65 Zn was very low in the environmental seawater. Results of radioactive trace experiments showed that the absorption of 134 Cs and 65 Zn by Perna Viridis was selective

A simple method for the deconvolution of 134 Cs/137 Cs peaks in gamma-ray scintillation spectrometry

International Nuclear Information System (INIS)

Darko, E.O.; Osae, E.K.; Schandorf, C.

1998-01-01

A simple method for the deconvolution of 134 Cs / 137 Cs peaks in a given mixture of 134 Cs and 137 Cs using Nal(TI) gamma-ray scintillation spectrometry is described. In this method the 795 keV energy of 134 Cs is used as a reference peak to calculate the activity of the 137 Cs directly from the measured peaks. Certified reference materials were measured using the method and compared with a high resolution gamma-ray spectrometry measurements. The results showed good agreement with the certified values. The method is very simple and does not need any complicated mathematics and computer programme to de- convolute the overlapping 604.7 keV and 661.6 keV peaks of 134 Cs and 137 Cs respectively. (author). 14 refs.; 1 tab., 2 figs

Determination of curie content and {sup 134/137}cesium ratios by gamma spectroscopy of high burnup plutonium-aluminum fuel assemblies

Energy Technology Data Exchange (ETDEWEB)

Haggard, D.L.; Tanner, J.E.

1997-06-01

Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure {sup 134/137}Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. {sup 134/137}Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from {sup 134}Cs and the 662 keV peak from {sup 137}Cs/{sup 137m}Ba. Assembly No. 2 {sup 134/137}Cs ratio measured on 4-15-92 was 0.19. The measured {sup 134/137}Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of {sup 134}Cs and {sup 137}Cs. The measured {sup 134/137}Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of {sup 134}Cs and 8620--11646 curies of {sup 137}Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies {sup 134}Cs and 8973 curies {sup 137}Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured {sup 134}Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured {sup 137}Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material.

Synthesis and characterization of samarium-doped ZnS nanoparticles: A novel visible light responsive photocatalyst

Energy Technology Data Exchange (ETDEWEB)

Hanifehpour, Younes, E-mail: y_hanifehpour@yu.ac.kr [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of); Soltani, Behzad; Amani-Ghadim, Ali Reza; Hedayati, Behnam [Department of Chemistry, Faculty of Basic Sciences, Azarbaijan Shahid Madani University, Tabriz (Iran, Islamic Republic of); Khomami, Bamin [Department of Chemical and Biomolecular Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Joo, Sang Woo, E-mail: swjoo1@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of)

2016-04-15

Highlights: • Sm-doped ZnS Nanomaterials were synthesized by hydrothermal method. • The as-prepared compounds were characterized by XRD, TEM, XPS, SEM and UV techniques. • The photocatalytic effect of compounds was determined by Reactive Red 43 degradation. • The degradation of RRed 43 followed the Langmuir–Hinshelwood kinetic model. - Abstract: We prepared pure and samarium-doped ZnS (Sm{sub x}Zn{sub 1−x}S{sub 1+0.5x}) nanoparticles via hydrothermal process at 160 °C for 24 h. XRD analysis shows that the particles were well crystallized and corresponds to a cubic sphalerite phase. SEM and TEM images indicate that the sizes of the particles were in the range of 20–60 nm. The photocatalytic activity of Sm-doped ZnS nanoparticles was evaluated by monitoring the decolorization of Reactive Red 43 in aqueous solution under visible light irradiation. The color removal efficiency of Sm{sub 0.04}Zn{sub 0.96}S and pure ZnS was 95.1% and 28.7% after 120 min of treatment, respectively. Among the different amounts of dopant agent used, 4% Sm-doped ZnS nanoparticles indicated the highest decolorization. We found that the presence of inorganic ions such as Cl{sup −}, CO{sub 3}{sup 2−} and other radical scavengers such as buthanol and isopropyl alcohol reduced the decolorization efficiency.

The effect of the soil pH on 134Cs transfer factors for soybean and sunflower plants; 134Cs fate in the extracted seed-oil

International Nuclear Information System (INIS)

Massas, I.; Skarlou, C.; Anoussis, J.; Haidouti, C.; Arapis, G.

1999-01-01

The effect of soil pH on 134 Cs TFs as well as the fate of 134 Cs in the extracted oil was studied in a greenhouse experiment with soybean and sunflower plants. A soil with pH 4.2 was used as a basis and its pH value has increased to 5.7, 6.5 and 7.6 (by the addition of different amounts of Ca(OH) 2 ). The lowest TF value was observed in the calcareous soil (pH 7.6), while the highest in the lowest pH (4.2) for the vegetative part and in the pH 6.5 for the edible part for both studied plants. TFs were practically the same for soya plants grown on the three lowest soil pH and reduced significantly only at pH 7.6 for either pods or other plant material. However, the lowest/highest TF was ∼ 4 for pods and ∼ 6 for the other plant material. For the sunflower plants while TFs for other plant material reduced from lowest to highest soil pH by only a factor of 2, for the seeds TFs remained rather constant. The difference in TF between the two studied species in each soil pH was in some cases higher than the difference due to pH effect. When an oil fraction (∼ 20 %) was extracted from seeds of both plants, no 134 Cs was detected. Refs. 4 (author)

Shrimp hemocyte homeostasis-associated protein (PmHHAP) interacts with WSSV134 to control apoptosis in white spot syndrome virus infection.

Science.gov (United States)

Apitanyasai, Kantamas; Amparyup, Piti; Charoensapsri, Walaiporn; Sangsuriya, Pakkakul; Tassanakajon, Anchalee

2018-05-01

Hemocyte homeostasis-associated protein (PmHHAP) was first identified as a viral-responsive gene, due to a high upregulation in transcription following white spot syndrome virus (WSSV) infection. Functional studies using RNA interference have suggested that PmHHAP is involved in hemocyte homeostasis by controlling apoptosis during WSSV infection. In this study, the role of PmHHAP in host-viral interactions was further investigated. Yeast two-hybrid assay and co-immunoprecipitation revealed that PmHHAP binds to an anti-apoptosis protein, WSSV134. The viral protein WSSV134 is a late protein of WSSV, expressed 24 h post infection (hpi). Gene silencing of WSSV134 in WSSV-infected shrimp resulted in a reduction of the expression level of the viral replication marker genes VP28, wsv477, and ie-1, which suggests that WSSV134 is likely involved in viral propagation. However, co-silencing of PmHHAP and WSSV134 counteracted the effects on WSSV infection, which implies the importance of the host-pathogen interaction between PmHHAP and WSSV134 in WSSV infection. In addition, caspase 3/7 activity was noticeably induced in the PmHHAP and WSSV134 co-silenced shrimp upon WSSV infection. Moreover, PmHHAP and WSSV134 inhibited caspase-induced activation of PmCasp in vitro in a non-competitive manner. Taken together, these results suggest that PmHHAP and WSSV134 play a role in the host-pathogen interaction and work concordantly to control apoptosis in WSSV infection. Copyright © 2018 Elsevier Ltd. All rights reserved.

Component-wise exergy and energy analysis of vapor compression refrigeration system using mixture of R134a and LPG as refrigerant

Science.gov (United States)

Gill, Jatinder; Singh, Jagdev

2017-11-01

In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.

Component-wise exergy and energy analysis of vapor compression refrigeration system using mixture of R134a and LPG as refrigerant

Science.gov (United States)

Gill, Jatinder; Singh, Jagdev

2018-05-01

In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.

Development of certified matrix reference materials for quality assurance of screening 134Cs and 137Cs in food

International Nuclear Information System (INIS)

Ishizu, H.; Yamada, T.

2013-01-01

A certified reference material using activated alumina powder certified for activity of 134 Cs and 137 Cs was developed. The results of the verification and the certification are described. The certified reference material can be used for quality assurance of screening activity measurements of 134 Cs and 137 Cs in food/foodstuffs. Commercially available equipments were experimentally tested using the CRM and another CRM including 40 K. The results of these tests are also shown. - Highlights: • CRM of 134 Cs and 137 Cs using activated alumina was developed. • CRM including 134 Cs, 137 Cs and 40 K was also developed. • Results of experimental performance test of commercial inspection equipments using CRMs were shown

17 CFR 1.34 - Monthly record, “point balance”.

Science.gov (United States)

2010-04-01

... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Recordkeeping § 1.34 Monthly record, “point balance”. (a) Each... statement commonly known as a “point balance,” which accrues or brings to the official closing price, or... contracts long and short in the customers' accounts are in balance with those in the carrying futures...

19 CFR 134.35 - Articles substantially changed by manufacture.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134... substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the United States in manufacture which results in an article having a name, character, or use differing from...

Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

International Nuclear Information System (INIS)

Caires, A.C.F.

1985-01-01

A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

[Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].

Science.gov (United States)

Betschart; Hässig; Spiess

2014-03-01

This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).

12 CFR 204.134 - Linked time deposits and transaction accounts.

Science.gov (United States)

2010-01-01

... RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.134...) establishes general reserve requirements on transaction accounts and nonpersonal time deposits. Under section... other than to allow the payment of higher interest through the avoidance of reserve requirements. As the...

Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

Energy Technology Data Exchange (ETDEWEB)

Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

2017-04-30

Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

13 CFR 134.704 - What are the effects of the appeal on the procurement at issue?

Science.gov (United States)

2010-01-01

... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the effects of the appeal on the procurement at issue? 134.704 Section 134.704 Business Credit and Assistance SMALL BUSINESS...

13 CFR 134.707 - When does the D/GC transmit the protest file and to whom?

Science.gov (United States)

2010-01-01

... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When does the D/GC transmit the protest file and to whom? 134.707 Section 134.707 Business Credit and Assistance SMALL BUSINESS...

Study of unstable valences of cadmium and samarium by pulse radiolysis. Influence of complexation by some synthetical ionophores

International Nuclear Information System (INIS)

Lerat-Parizot, O.

1992-01-01

Instable valences of cations in solution are evidenced by pulse radiolysis, in spite of a lifetime often lower than a milli-second they participate to electron transfer reactions, owing to their redox potential. In this work are studied Cd + and Sm 2+ obtained respectively by reduction of Cd 2+ and Sm 3+ by a solvated electron. The reactivity of Cd + in a cryptand and in a coronand is studied; it is a powerful reducing agent (redox potential -2V) going back to the stable valence by electron transfer to an acceptor. Transfer kinetics is studied by reduction of organic molecules, effect of solvents and ligands is also examined. For samarium the reduction kinetics by hydrated electrons is increased when the ion is in a cryptand in agreement with electrochemical observations, showing that the valence 2+ is stabilized in respect to the valence 3+ for lanthanides. The difference of behaviour between Cd + and Sm 2+ is probably due to the fact that for Cd the transferred electron comes from the external layer and for Sm it is a f electron protected by the 5s and 5p orbitals

Intermittent Administration of Parathyroid Hormone [1-34] Prevents Particle-Induced Periprosthetic Osteolysis in a Rat Model.

Directory of Open Access Journals (Sweden)

Fanggang Bi

Full Text Available We examined whether intermittent administration of parathyroid hormone [1-34] (PTH[1-34]; 60 μg/kg/day can prevent the negative effects of titanium (Ti particles on implant fixation and periprosthetic osteolysis in a rat model. Eighteen adult male rats (12 weeks old, bones still growing received intramedullary Ti implants in their bilateral femurs; 6 rats from the blank group received vehicle injections, and 12 rats from the control group and PTH treatment group received Ti particle injections at the time of operation and intra-articular injections 2 and 4 weeks postoperatively. Six of the rats that received Ti particles from the PTH group also received PTH[1-34] treatment. Six weeks postoperatively, all specimens were collected for assessment by X-ray, micro-CT, biomechanical, scanning electron microscopy (SEM, and dynamic histomorphometry. A lower BMD, BV/TV, Tb.N, maximal fixation strength, and mineral apposition rate were observed in the control group compared to the blank group, demonstrating that a periprosthetic osteolysis model had been successfully established. Administration of PTH[1-34] significantly increased the bone mineral density of the distal femur, BV/TV, Tb.N, Tb.Th, Tb.Sp, Con.D, SMI, and maximal fixation strength in the PTH group compared to that in the control group. SEM revealed higher bone-implant contact, thicker lamellar bone, and larger trabecular bone area in the PTH group than in the control group. A higher mineral apposition rate was observed in the PTH group compared to both the blank and control groups. These findings imply that intermittent administration of PTH[1-34] prevents periprosthetic osteolysis by promoting bone formation. The effects of PTH[1-34] were evaluated at a suprapharmacological dosage to the human equivalent in rats; therefore, additional studies are required to demonstrate its therapeutic potential in periprosthetic osteolysis.

Predicting heat transfer in long, R-134a filled thermosyphons

NARCIS (Netherlands)

Grooten, M.H.M.; Geld, van der C.W.M.

2008-01-01

When traditional air-to-air cooling is too voluminous, heat exchangers with long thermosyphons offer a good alternative. Experiments with a single thermosyphon with a large length-to-diameter ratio (188) and filled with R-134a are presented and analyzed. Saturation temperatures, filling ratios, and

Uptake and loss of Cesium - 134 by the snail Biomphalaria glabrata (Say, 1818)

International Nuclear Information System (INIS)

Kikuchi, O.K.; Mastro, N.L. del.

1988-07-01

The uptake and loss of Cs-134 produced in IEA-R1 reactor of IPEN was observed in fresh water adult snails. Two activites were employed: 3.700 and 18.500 Bq/1. A monochannel analyses was used for radiactivity couting and the number of egg-laying and embryo were registered. Maximum uptake occured approximately at 8 th day and the biological half-life was about 6 days. Although the egg-laying and embryo number were diminished with Cs-134 presence, it is not possible to affirm that result due to the small number of animals used. (author) [pt

R-134a (1,1,1,2-Tetrafluoroethane) Inhalation Induced Reactive Airways Dysfunction Syndrome.

Science.gov (United States)

Doshi, Viral; Kham, Nang; Kulkarni, Shreedhar; Kapitan, Kent; Henkle, Joseph; White, Peter

2016-01-01

R-134a (1,1,1,2-tetrafluoroethane) is widely used as a refrigerant and as an aerosol propellant. Inhalation of R-134a can lead to asphyxia, transient confusion, and cardiac arrhythmias. We report a case of reactive airways dysfunction syndrome secondary to R-134a inhalation. A 60-year-old nonsmoking man without a history of lung disease was exposed to an air conditioner refrigerant spill while performing repairs beneath a school bus. Afterward, he experienced worsening shortness of breath with minimal exertion, a productive cough, and wheezing. He was also hypoxic. He was admitted to the hospital for further evaluation. Spirometry showed airflow obstruction with an FEV1 1.97 L (45% predicted). His respiratory status improved with bronchodilators and oral steroids. A repeat spirometry 2 weeks later showed improvement with an FEV1 2.5 L (60% predicted). Six months after the incident, his symptoms had improved, but he was still having shortness of breath on exertion and occasional cough.

Physical properties of 134 soils in six northeastern states

Science.gov (United States)

A. R. Eschner; B. O. Jones; R. C. Moyle

1957-01-01

From June 1954 to July 1955 the Vicksburg Infiltration Project collected and analyzed samples from 134 sites in six Northeastern States; the samples included 79 soil series and 114 soil types. This work was done to supply the U. S. Army with information needed for specialized research on military traffic ability. The basic data are herein presented because of their...

28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.

Science.gov (United States)

2010-07-01

... SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General... Special Nuclear Materials Rewards Act, the Attorney General shall: (a) Refer such submission for review to... whether that alien and members of his immediate family may receive immigrant visas and be admitted to the...

Soil to plant transfer of 134Cs for olive and orange trees: preliminary results

International Nuclear Information System (INIS)

Skarlou, V.; Nobeli, C.; Anoussis, J.; Papanicolaou, E.; Haidouti, C.

1995-01-01

The objective of this research programme was to calculate values of transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) in a long term glasshouse pot experiment, started in 1994. Radiocaesium contamination in the different tree parts as well as the importance of the storage or cycling of 134 Cs will also be examined. The experiment was conducted in large pots filled with a calcareous, heavy soil (115 kg/pot) where olive and orange trees, two years after grafting were transplanted. The soil was added to the pot in layers ca. 2 cm thick on the top of which the radioactive solution was added in small drops. Caesium-134 as CsCl (0.5 mCi) was added to each pot. The soil in the pots was watered to field capacity and left to stand for eight weeks for the 134 Cs to reach equilibrium. Plant samples were taken at fruit maturity, eight months after transplanting. It is noticed that the length of experimentation is rather short for tree crops and the data should be considered as preliminary ones with indicative tendencies. Under these conditions plant contamination was generally very low in both plant species studied. The concentration ratios (CR) of 134 Cs for the studied crops did not differ much and they ranged from 0.0007 to 0.002 for olive trees and from 0.0006 to 0.001 for orange trees. Leaves compared to other plant parts showed the highest CR value in both crops. Furthermore new leaves and branches of the olive trees showed higher CR values than the old ones by approximately a factor of two. Potassium content of the different plant parts showed significant differences and they were higher in leaves and fruits. There is no correlation between K content and transfer factors of Cs in the different plant parts of both crops. To study the effect of soil type on CRs of 134 Cs for olive and orange trees a similar experiment was established two months later, using a sandy and acid soil. Based on first results, higher values of transfer factors of 134

Synthesis and Biological Activity of 2,5-Bisubstituted Derivatives of 1,3,4-Thiadiazol-2,5-dithiol

Directory of Open Access Journals (Sweden)

T. S. Zhivotova

2013-01-01

Full Text Available By reaction of 1,3,4-thiadiazol-2,5-dithiol with different organohalogens, chlorides of carboxylic acids, acrylic acid derivatives, alkaloids, and secondary amines, various derivatives of 2,5-bi-substituted 1,3,4-thiadiazole were synthesized, and biological properties of some of them were studied.

Samarium-modified vanadium phosphate catalyst for the selective oxidation of n-butane to maleic anhydride

International Nuclear Information System (INIS)

Wu, Hua-Yi; Wang, Hai-Bo; Liu, Xin-Hua; Li, Jian-Hui; Yang, Mei-Hua; Huang, Chuan-Jing; Weng, Wei-Zheng; Wan, Hui-Lin

2015-01-01

Graphical abstract: The addition of a small amount of Sm into VPO catalyst brought about great changes in its physicochemical properties such as surface area, surface morphology, phase composition and redox property, thus leading to a higher catalytic performance in the selective oxidation of n-butane to maleic anhydride, as compared to the undoped VPO catalyst. - Highlights: • The addition of Sm leads to great changes in the structure of VPO catalyst. • Sm improves performance of VPO for oxidation of n-butane to maleic anhydride. • Catalytic performance is closely related to structure of VPO catalyst. - Abstract: A series of samarium-modified vanadium phosphate catalysts were prepared and studied in selective oxidation of n-butane to maleic anhydride. The catalytic evaluation showed that Sm modification significantly increased the overall n-butane conversion and intrinsic activity. N 2 -adsorption, XRD, SEM, Raman, XPS, EPR and H 2 -TPR techniques were used to investigate the intrinsic difference among these catalysts. The results revealed that the addition of Sm to VPO catalyst can increase the surface area of the catalyst, lead to a significant change in catalyst morphology from plate-like structure into rosette-shape clusters, and largely promote the formation of (VO) 2 P 2 O 7 . All of these were related to the different catalytic performance of Sm-doped and undoped VPO catalysts. The roles of the different VOPO 4 phases and the influence of Sm were also described and discussed

47 CFR 25.134 - Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal...

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal (CSAT) networks. 25.134 Section 25.134 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...

Dgroup: DG01196 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available DG01196 Chemical ... DGroup Samarium (153Sm) lexidronam ... D08504 ... Samarium (153Sm) lexidron...am (INN) D05795 ... Samarium Sm 153 lexidronam pentasodium (USAN); Samarium (153Sm) lexidronam sodium (JA

Epiphytic fruticose lichens as biomonitors for retrospective evaluation of the 134Cs/137Cs ratio in Fukushima fallout

International Nuclear Information System (INIS)

Ramzaev, V.; Barkovsky, A.; Gromov, A.; Ivanov, S.; Kaduka, M.

2014-01-01

In 2011–2013, sampling of epiphytic fruticose lichens of the genera Usnea, Bryoria and Alectoria was carried out on Sakhalin and Kuril Islands (the Sakhalin region, Russia) to investigate contamination of these organisms with the Fukushima-derived 134 Cs and 137 Cs. Activities of the radionuclides were determined in all 56 samples of lichens taken for the analysis. After correction for radioactive decay (on 15 March 2011), the activity concentrations ranged from 2.1 Bq kg −1 (d.w.) to 52 Bq kg −1 for 134 Cs and from 2.3 Bq kg −1 to 52 Bq kg −1 for 137 Cs. Cesium-134 and 137 Cs activities for the whole set of lichens (n = 56) were strongly positively correlated; Spearman's rank correlation coefficient was calculated as 0.991 (P < 0.01). The activity concentrations of 134 Cs and 137 Cs in Usnea lichens from the Sakhalin and Kunashir islands declined with a factor of three in the period from 2011 to 2013. The average biological half-time for both cesium radionuclides in lichens of the genus Usnea is estimated as 1.3 y. The mean of 0.99 ± 0.10 and median of 0.99 were calculated for the decay corrected 134 Cs/ 137 Cs activities ratios in the lichens (n = 56). The radionuclides ratio in the lichens did not depend on location of sampling site, species and the time that had passed after the Fukushima accident. The regression analysis has shown the background pre-Fukushima level of 137 Cs of 0.4 ± 0.3 Bq kg −1 , whereas the ratio between the Fukushima-borne 134 Cs and 137 Cs in the lichens was estimated as 1.04. The 134 Cs/ 137 Cs activities ratio in lichens from the Sakhalin region is consistent with the ratios reported by others for the heavy contaminated areas on Honshu Island in Japan following the Fukushima accident. The activity concentrations of natural 7 Be in lichens from the Sakhalin region varied between 100 Bq kg −1 and 600 Bq kg −1 ; the activity concentrations did not exhibit temporal variations during a 2y-period of observations. The

Vapor-liquid critical surface of ternary difluoromethane + pentafluoroethane + 1,1,1,2-tetrafluoroethane (R-32/125/134a) mixtures

Energy Technology Data Exchange (ETDEWEB)

Higashi, Y.

1999-09-01

The plane of vapor-liquid criticality for ternary refrigerant mixtures of difluoromethane (R-32) + pentafluoroethane (R-125) + 1,1,1,2-tetrafluoroethane (R-134a) was determined from data on the vapor-liquid coexistence curve near the mixture critical points. The composition (mass percentage) of the mixtures studied were 23% R-32 + 25% R-125 + 52% R-134a (R-407C). 25% R-32 + 15% R-125 + 60% R-134a (R-407E), and 20% R-32 + 40% R-125 + 40% R-134a (R-407A). The critical temperature of each mixture was determined by observation of the disappearance of the meniscus. The critical density of each mixture was determined on the basis of meniscus disappearance level and the intensity of the critical opalescence. The uncertainties of the temperature, density, and composition measurements are estimated as {+-}10mK, {+-}5kg{center_dot}m{sup {minus}3}, and {+-}0.05%, respectively. In addition, predictive methods for the critical parameters of R-32/125/134a mixtures are discussed.

Munc13-4 Is a Rab11-binding Protein That Regulates Rab11-positive Vesicle Trafficking and Docking at the Plasma Membrane.

Science.gov (United States)

Johnson, Jennifer L; He, Jing; Ramadass, Mahalakshmi; Pestonjamasp, Kersi; Kiosses, William B; Zhang, Jinzhong; Catz, Sergio D

2016-02-12

The small GTPase Rab11 and its effectors control trafficking of recycling endosomes, receptor replenishment and the up-regulation of adhesion and adaptor molecules at the plasma membrane. Despite recent advances in the understanding of Rab11-regulated mechanisms, the final steps mediating docking and fusion of Rab11-positive vesicles at the plasma membrane are not fully understood. Munc13-4 is a docking factor proposed to regulate fusion through interactions with SNAREs. In hematopoietic cells, including neutrophils, Munc13-4 regulates exocytosis in a Rab27a-dependent manner, but its possible regulation of other GTPases has not been explored in detail. Here, we show that Munc13-4 binds to Rab11 and regulates the trafficking of Rab11-containing vesicles. Using a novel Time-resolved Fluorescence Resonance Energy Transfer (TR-FRET) assay, we demonstrate that Munc13-4 binds to Rab11a but not to dominant negative Rab11a. Immunoprecipitation analysis confirmed the specificity of the interaction between Munc13-4 and Rab11, and super-resolution microscopy studies support the interaction of endogenous Munc13-4 with Rab11 at the single molecule level in neutrophils. Vesicular dynamic analysis shows the common spatio-temporal distribution of Munc13-4 and Rab11, while expression of a calcium binding-deficient mutant of Munc13-4 significantly affected Rab11 trafficking. Munc13-4-deficient neutrophils showed normal endocytosis, but the trafficking, up-regulation, and retention of Rab11-positive vesicles at the plasma membrane was significantly impaired. This correlated with deficient NADPH oxidase activation at the plasma membrane in response to Rab11 interference. Our data demonstrate that Munc13-4 is a Rab11-binding partner that regulates the final steps of Rab11-positive vesicle docking at the plasma membrane. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

Microscopic structure of liquid 1-1-1-2-tetrafluoroethane (R134a) from Monte Carlo simulation.

Science.gov (United States)

Do, Hainam; Wheatley, Richard J; Hirst, Jonathan D

2010-10-28

1-1-1-2-tetrafluoroethane (R134a) is one of the most commonly used refrigerants. Its thermophysical properties are important for evaluating the performance of refrigeration cycles. These can be obtained via computer simulation, with an insight into the microscopic structure of the liquid, which is not accessible to experiment. In this paper, vapour-liquid equilibrium properties of R134a and its liquid microscopic structure are investigated using coupled-decoupled configurational-bias Monte Carlo simulation in the Gibbs ensemble, with a recent potential [J. Phys. Chem. B 2009, 113, 178]. We find that the simulations agree well with the experimental data, except at the vicinity of the critical region. Liquid R134a packs like liquid argon, with a coordination number in the first solvation shell of 12 at 260 K. The nearest neighbours prefer to be localized in three different spaces around the central molecule, in such a manner that the dipole moments are in a parallel alignment. Analysis of the pair interaction energy shows clear association of R134a molecules, but no evidence for C-HF type hydrogen bonding is found. The above findings should be of relevance to a broad range of fluoroalkanes.

N-(5-Benzylsulfanyl-1,3,4-thiadiazol-2-yl-2-(piperidin-1-ylacetamide

Directory of Open Access Journals (Sweden)

D. S. Ismailova

2014-03-01

Full Text Available The title compound, C16H20N4OS2, was synthesized by the reaction of 2-benzylsulfanyl-5-chloroacetamido-1,3,4-thiadiazole and piperidine in a 1:2 ratio. The planes of the acetamide and 1,3,4-thiadiazole units are twisted by 10.8 (4°. The thiadiazole S atom and the acetamide O atom are syn-oriented due to a hypervalent S...O interaction of 2.628 (4 Å. In the crystal, molecules form centrosymmetric dimers via N—H...N hydrogen bonds. These dimers are further connected by C—H...O interactions into (100 layers.

Causes of seasonal variations of Cs-134/137 activity concentrations in surface air

International Nuclear Information System (INIS)

Hoetzl, H.; Winkler, R.

1993-01-01

In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called 'Stagnationsindex'. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [de

In vitro and preclinical assessment of an intranasal spray\\ud formulation of parathyroid hormone PTH 1-34 for the treatment of osteoporosis

OpenAIRE

Williams, Allan J.; Jordan, Faron; King, Gareth; Lewis, Andrew L.; Illum, Lisbeth; Masud, Tahir; Perkins, Alan C.; Pearson, Richard G.

2017-01-01

Osteoporosis treatment with PTH 1-34 injections significantly reduces the incidence of bone fracture. Potential further reductions in fracture rate should be observed through nasal spray delivery to address the poor compliance associated with patient dislike of repeated PTH 1-34 subcutaneous injections. In vitro human osteoblast-like Saos-2 cell intracellular cAMP levels were used to define PTH 1-34 nasal spray formulation bioactivity. The chemically synthesised PTH 1-34 had an EC50 of 0.76nM...

EXPERIMENTAL INVESTIGATION OF R-134a AND R-600a ...

African Journals Online (AJOL)

Preet khandelwal

performance of blends of two existing refrigerant, R-134a and R-600a, blended together at ratios of 11%/89%, ... blending ratios, estimated GWPs ≤ 150 using Ali's model. .... series are less flammable among other HCs and its .... Figure 2: Variation of Evaporator Temperature with Time at an Ambient Temperature of 37oC.

An experiment using neutron activation analysis and a rare earth element to mark cotton plants and two insects that feed on them

Energy Technology Data Exchange (ETDEWEB)

Showler, Allan T. [USDA-ARS IFNRRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States)]. E-mail: ashowler@weslaco.ars.usda.gov; James, William D. [Elemental Analysis Laboratory, 3144 Texas A and M University, College Station, TX 77843-3144 (United States); Armstrong, John S. [USDA-ARS BIRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States); Westbrook, John K. [USDA-ARS APMRU, 2771 F and B Road, College Station, TX 77845-4966 (United States)

2006-08-15

Studies on insect dispersal and other behaviors can benefit from using markers that will not alter flight and fitness. Rare earth elements, such as samarium (Sm), have been used as ingested markers of some insects and detected using neutron activation analysis (NAA). In this study, samarium nitrate hexahydrate was mixed into artificial diet for boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), at different dosages and in water used to irrigate cotton, Gossypium hirsutum L. Samarium was detected in adult boll weevils fed on the samarium-labeled diet, but not after 5 or 10 days of being switched to non-labeled diet, even if the insects were given labeled diet for as long as 7 consecutive days. Introduced in irrigation water, 1% samarium (m/m) was detectable in cotton squares and leaf tissue. However, boll weevil adults fed samarium-labeled squares did not retain detectable levels of samarium, nor did boll weevil adults reared to adulthood from samarium-labeled squares. Fourth instar beet armyworms, Spodoptera exigua (Huebner) (Noctuidae: Lepidoptera), fed on samarium-labeled cotton leaves obtained enough samarium for NAA detection, but adult moths reared from them did not have detectable amounts of samarium. Although samarium can be useful as a marker when insects are presented with a continuous pulse of the label, elements that are assimilated by the insect would be more useful if a continuous infusion of the marker cannot be provided.

10 CFR 431.134 - Uniform test methods for the measurement of energy consumption and water consumption of automatic...

Science.gov (United States)

2010-01-01

... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This... consumption, but instead calculate the energy use rate (kWh/100 lbs Ice) by dividing the energy consumed...

Measurement of the effective thermal cross section of {sup 134}Cs by triple neutron capture reaction

Energy Technology Data Exchange (ETDEWEB)

Nakamura, Shoji; Harada, Hideo; Katoh, Toshio [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro; Kobayashi, Katsutoshi; Motoishi, Shoji; Tanase, Masakazu

1998-03-01

The effective thermal cross section ({sigma}{sub eff}) of the {sup 134}Cs(n,{gamma}){sup 135}Cs reaction was measured by the activation method and the {gamma}-ray spectroscopic method in order to obtain fundamental data for research on the transmutation of nuclear wastes. The effective thermal cross section of the reaction {sup 134}Cs(n,{gamma}){sup 135}Cs was found to be 140.6{+-}8.5 barns. (author)

Effects of cilostazol and k-134 on reconstructive surgery using prosthetic grafts in the abdominal aorta of beagle dogs.

Science.gov (United States)

Inoue, Yoshinori; Sugano, Norihide; Jibiki, Masatoshi; Kudo, Toshifumi; Iwai, Takehisa

2008-01-01

Problems associated with prosthetic graft replacement are stenosis at the anastomosis site and thrombus formation on the inner surface. Cilostazol is known to have antiplatelet activity and inhibit vascular smooth muscle cell proliferation and neointima thickening. A cilostazol derivative, (-)-6-[3-[3-cyclopropyl-3-[(1R,2R)-2-hydroxycyclohexyl]ureido]-propoxy]-2-(1H)-quinolinone (K-134), has more potent anti-platelet activity and anti-neointimal thickening activity than cilostazol in the in-vitro platelet aggregation and in-vivo anti-hyperplastic activity assay. The aim of this study was to investigate effects of cilostazol and K-134 on thrombus formation and neointimal thickening at the site of prosthetic graft replacement. Beagle dogs underwent infrarenal abdominal aortic resection with straight Dacron graft replacement, which were allocated to the control, cilostazol, and K-134 groups. Two dogs were dead without confirming the cause of death. After 6 months, all dogs were necropsied. All prosthetic grafts were patent in each group. Ratios of red thrombus to prosthetic graft area were 0.3+/-6.4%, and 3.3+/-4.5% in the cilostazol and K-134 groups, respectively, which were significant different from that in the control group (24.4+/-16.8%). However, no clear difference was seen among the 3 groups with respect to neointimal thickness (control group, 0.70+/-0.13 mm; cilostazol group, 0.59+/-0.14 mm; K-134 group, 0.67+/-0.14 mm). Cilostazol and K-134 significantly inhibited thrombus formation on the inner surface of the prosthetic graft at 6 months after graft replacement. Neointimal thickening on the inner surface was slight even in control-group animals, and the effects of cilostazol and K-134 on such thickening were unclear.

The radioimmunotoxicological and radiogenotoxicological effect induced by 134Cs retention in the whole body and skeleton and germ system

International Nuclear Information System (INIS)

Zhu Shoupeng; Xia Fen; Yang Weidong

1993-05-01

A fitted equation to describe the retention of 134 Cs in whole body is obtained by a whole body counter. The equation consists of two half-life components, the fast component is T 1/2 = 0.07 d and the slow component is T 1/2 = 16.14 d. Two fitted equations describing the retention of 134 Cs in skeleton and testes are also introduced. The T 1/2 in skeleton is 5.73 d and in testes is 5.21 d. The results of investigating radioimmunotoxicological effect induced by 134 Cs show that the inhibition of thymus cells is higher than bone marrow cells, the spleen T-lymphocytes is more sensitive to 134 Cs than B-lymphocytes and lymphocytes of peripheral immune organ are more sensitive to radiation than central immune cells and thymus cells. The study of radiogenotoxicological effect induced by 134 Cs shows that the chromosome aberration frequencies and PCE micronucleus formation in bone marrow cells are significantly high, it can induce chromosome aberrations of spermatogonia and increases the abnormality of sperm. The relations between injected dose and abnormalities can be expressed by power functions

Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

Energy Technology Data Exchange (ETDEWEB)

Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

2016-10-01

Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

2015-09-15

Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

13 CFR 134.703 - When must a person file an appeal from an WOSB or EDWOSB protest determination?

Science.gov (United States)

2010-01-01

... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must a person file an appeal from an WOSB or EDWOSB protest determination? 134.703 Section 134.703 Business Credit and Assistance...

Estimation of average burnup of damaged fuels loaded in Fukushima Dai-ichi reactors by using the 134Cs/137Cs ratio method

International Nuclear Information System (INIS)

Endo, T.; Sato, S.; Yamamoto, A.

2012-01-01

Average burnup of damaged fuels loaded in Fukushima Dai-ichi reactors is estimated, using the 134 Cs/ 137 Cs ratio method for measured radioactivities of 134 Cs and 137 Cs in contaminated soils within the range of 100 km from the Fukushima Dai-ichi nuclear power plants. As a result, the measured 134 Cs/ 137 Cs ratio from the contaminated soil is 0.996±0.07 as of March 11, 2011. Based on the 134 Cs/ 137 Cs ratio method, the estimated burnup of damaged fuels is approximately 17.2±1.5 [GWd/tHM]. It is noted that the numerical results of various calculation codes (SRAC2006/PIJ, SCALE6.0/TRITON, and MVP-BURN) are almost the same evaluation values of 134 Cs/ 137 Cs ratio with same evaluated nuclear data library (ENDF-B/VII.0). The void fraction effect in depletion calculation has a major impact on 134 Cs/ 137 Cs ratio compared with the differences between JENDL-4.0 and ENDF-B/VII.0. (authors)

Fabrication of samarium strontium aluminate ceramic and deposition of thermal barrier coatings by air plasma spray process

Directory of Open Access Journals (Sweden)

Baskaran T

2018-01-01

Full Text Available Thermal barrier coatings (TBC with the metallic NiCrAlY bond coat are often used in many aircraft engines to protect superalloy components from high-temperature corrosion thereby to improve the life of gas turbine components. The search for new TBC material has been intensified in recent years due to lack of thermo-physical properties of conventionally used Yttria stabilized Zirconia (YSZ TBCs. Recently, the rare earth containing Samarium Strontium Aluminate (SSA based ceramic was proposed as a new TBC material due to its matching thermo-physical properties with the substrate. The present work focused on the synthesis of SSA ceramics for TBCs application and its coatings development on Ni-based superalloy Inconel 718 substrate by air plasma spray process. The X-ray photoelectron spectroscopy (XPS result confirmed the formation of single phase SSA ceramic after synthesis. The surface morphology of SSA TBCs is mainly composed of melted splats, semi and un-melted particles. The cross-sectional SEM micrographs did not show any spallation at the interface which indicated good mechanical interlocking between the bond coat and ceramic top coat. The Young’s modulus and hardness of SSA TBCs were found to be 80 and 6.1 GPa, respectively. The load-depth curve of SSA TBC showed good elastic recovery about 47 %.

27 CFR 478.134 - Sale of firearms to law enforcement officers.

Science.gov (United States)

2010-04-01

... AMMUNITION Records § 478.134 Sale of firearms to law enforcement officers. (a) Law enforcement officers... complete Form 4473 or Form 5300.35. The law enforcement officer purchasing the firearm may purchase a...) In Federal law enforcement offices, the supervisor in charge of the office to which the Federal...

Effect of waste mica on transfer factors of 134Cs to spinach and lettuce

International Nuclear Information System (INIS)

Sreenivasa Chari, M.; Manjaiah, K.M.; Sachdev, P.; Sachdev, M.S.

2011-01-01

A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg -1 ) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in 134 Cs-contaminated (at 37 k Bq kg -1 soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average 134 Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg -1 soil. There exists an inverse relationship between the 134 Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)

Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers

International Nuclear Information System (INIS)

Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L.

1993-01-01

The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs

FAM134B, the Selective Autophagy Receptor for Endoplasmic Reticulum Turnover, Inhibits Replication of Ebola Virus Strains Makona and Mayinga.

Science.gov (United States)

Chiramel, Abhilash I; Dougherty, Jonathan D; Nair, Vinod; Robertson, Shelly J; Best, Sonja M

2016-10-15

Selective autophagy of the endoplasmic reticulum (termed ER-phagy) is controlled by members of the FAM134 reticulon protein family. Here we used mouse embryonic fibroblasts from mice deficient in FAM134B to examine the role of the ER in replication of historic (Mayinga) or contemporary (Makona GCO7) strains of Ebola virus (EBOV). Loss of FAM134B resulted in 1-2 log 10 higher production of infectious EBOV, which was associated with increased production of viral proteins GP and VP40 and greater accumulation of nucleocaspid lattices. In addition, only 10% of wild-type cells contained detectable nucleoprotein, whereas knockout of FAM134B resulted in 80% of cells positive for nucleoprotein. Together, these data suggest that FAM134B-dependent ER-phagy is an important limiting event in EBOV replication in mouse cells and may have implications for further development of antiviral therapeutics and murine models of infection. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism

Directory of Open Access Journals (Sweden)

Liu Yi

2011-09-01

Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.

The complete multipartite genome sequence of Cupriavidus necator JMP134, a versatile pollutant degrader.

Directory of Open Access Journals (Sweden)

Athanasios Lykidis

Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.

The effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases

International Nuclear Information System (INIS)

Ma Yubo; Huang Gang; Liu Jianjun

2004-01-01

Objectives: To evaluate the effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases. Methods: 380 patients with bone metastases were studied (221 men, 159 women; average age 65.3 y; ranged 27-91 y; average weight 59.3 kg, ranged 39-95 kg). The tumor types were prostate carcinoma (n=155), pulmonary carcinoma (n=92), breast cancer (n=57), gastric carcinoma (n=12), colorectal carcinoma (n=22), nasopharyngeal carcinoma (n=8), lymphoma (n=8), hepatic carcinoma (n=6), ovary carcinoma (n=4) and others (n=16). All patients were received 135Sm-EDTMP 0.8 or 1.0 mCi/kg during 1 to 7 course of treatment. Patients and physician evaluations were used to assess pain relief. Numbers of metastatic foci and activity of ROIs were used to observe post-therapy change in bone scanning. Results: In 380 patients, pain relief was observed in 257 patients (67.6%). Persistence of pain relief was seen through 2 to 24 weeks. The mean relief time is 5.8±3.4 weeks. KPS score was higher 10% than pre-therapy (71.2%±9.6% Vs 80.9%±10.3%, p<0.001). Numbers of metastatic foci (11.2+8.8 Vs 8.4±5.7, p<0.001) and activity of ROIs (3.28±2.04 Vs 2.15±0.94, p<0.01) were less than pre-therapy. Bone marrow suppression was mild and reversible (5.87±1.56 Vs 4.94±1.16 x 109/L). Conclusions: 153Sm-EDTMP provided relief of pain associated with bone metastases and inhibition of metastatic foci. As a relief drug of painful bone metastases, 153Sm-EDTMP is safe and effective. (authors)

In vitro and preclinical assessment of an intranasal spray formulation of parathyroid hormone PTH 1-34 for the treatment of osteoporosis.

Science.gov (United States)

Williams, Allan J; Jordan, Faron; King, Gareth; Lewis, Andrew L; Illum, Lisbeth; Masud, Tahir; Perkins, Alan C; Pearson, Richard G

2018-01-15

Osteoporosis treatment with PTH 1-34 injections significantly reduces the incidence of bone fracture. Potential further reductions in fracture rate should be observed through nasal spray delivery to address the poor compliance associated with patient dislike of repeated PTH 1-34 subcutaneous injections. In vitro human osteoblast-like Saos-2 cell intracellular cAMP levels were used to define PTH 1-34 nasal spray formulation bioactivity. The chemically synthesised PTH 1-34 had an EC 50 of 0.76nM. Absorption enhancers polyethylene glycol (15)-hydroxystearate (Solutol ® HS15), poloxamer 407, chitosan or sodium hyaluronate did not diminish the bioactivity of PTH 1-34 within an in vitro cell culture model (p >0.05). We also demonstrated the effectiveness of the transmucosal absorption enhancer Solutol ® HS15 in a nasal spray formulation using a preclinical pharmacokinetic model. In Sprague-Dawley rats without the absorption enhancer the uptake of PTH 1-34 into the blood via intranasal delivery produced a Cmax of 2.1±0.5ng/ml compared to 13.7±1.6ng/ml with Solutol ® HS15 enhancer (p=0.016) and a Cmax14.8±8ng/ml in subcutaneous injections. Together these data illustrate that the nasal spray formulation bioactivity in vitro is not affected by the nasal spray absorption enhancers investigated, and the Solutol ® HS15 nasal spray formulation had an equivalent pharmacokinetic profile to subcutaneous injection in the rat model. The Solutol ® HS15 formulation therefore demonstrated potential as a PTH 1-34 nasal spray formulation for the treatment of osteoporosis. Copyright © 2017. Published by Elsevier B.V.

MicroRNA-134 Contributes to Glucose-Induced Endothelial Cell Dysfunction and This Effect Can Be Reversed by Far-Infrared Irradiation.

Directory of Open Access Journals (Sweden)

Hsei-Wei Wang

Full Text Available Diabetes mellitus (DM is a metabolic disease that is increasing worldwide. Furthermore, it is associated with the deregulation of vascular-related functions, which can develop into major complications among DM patients. Endothelial colony forming cells (ECFCs have the potential to bring about medical repairs because of their post-natal angiogenic activities; however, such activities are impaired by high glucose- (HG and the DM-associated conditions. Far-infrared radiation (FIR transfers energy as heat that is perceived by the thermoreceptors in human skin. Several studies have revealed that FIR improves vascular endothelial functioning and boost angiogenesis. FIR has been used as anti-inflammatory therapy and as a clinical treatment for peripheral circulation improvement. In addition to vascular repair, there is increasing evidence to show that FIR can be applied to a variety of diseases, including cardiovascular disorders, hypertension and arthritis. Yet mechanism of action of FIR and the biomarkers that indicate FIR effects remain unclear. MicroRNA-134 (miR-134-5p was identified by small RNA sequencing as being increased in high glucose (HG treated dfECFCs (HG-dfECFCs. Highly expressed miR-134 was also validated in dmECFCs by RT-qPCR and it is associated with impaired angiogenic activities of ECFCs. The functioning of ECFCs is improved by FIR treatment and this occurs via a reduction in the level of miR-134 and an increase in the NRIP1 transcript, a direct target of miR-134. Using a mouse ischemic hindlimb model, the recovery of impaired blood flow in the presence of HG-dfECFCs was improved by FIR pretreatment and this enhanced functionality was decreased when there was miR-134 overexpression in the FIR pretreated HG-dfECFCs. In conclusion, our results reveal that the deregulation of miR-134 is involved in angiogenic defects found in DM patients. FIR treatment improves the angiogenic activity of HG-dfECFCs and dmECFCs and FIR has potential as

Isotope ratios and chemical fractionation of CO in Lynds 134

International Nuclear Information System (INIS)

Dickman, R.L.; Langer, W.D.

1977-01-01

Mahoney, McCutcheon and Shuter (1976) reported observations of the J = 1 → 0 transition of three isotopes of CO in the dust cloud Lynds 134 using the 4.6 m telescope at Aerospace Corporation. In this paper a new observation of 12 C 17 O is discussed and the question of the ratio 13 C 16 O/ 12 C 18 O across the dust cloud is considered further. (Auth.)

Determination of the speciation and bioavailability of samarium to Chlamydomonas reinhardtii in the presence of natural organic matter.

Science.gov (United States)

Rowell, Justine-Anne; Fillion, Marc-Alexandre; Smith, Scott; Wilkinson, Kevin J

2018-06-01

As technological interest and environmental emissions of the rare earth elements increase, it is becoming more important to assess their potential environmental impact. Samarium (Sm) is a lanthanide of intermediate molar mass that is used in numerous high-technology applications including wind turbines, solar panels, and electric vehicles. The present study relates the speciation of Sm determined in the presence of natural organic matter (NOM) to its bioavailability to the unicellular green alga Chlamydomonas reinhardtii. The free ion concentration was determined using a cation exchange resin (ion exchange technique) in dynamic mode and compared with thermodynamic modeling. Short-term biouptake experiments were performed in the presence of 4 types of NOM: Suwannee River fulvic acids, Pahokee Peat fulvic acids, Suwannee River humic acids, and a Luther Marsh dissolved organic matter isolate (90-95% humic acids). It was clearly shown that even a small amount of NOM (0.5 mg C L -1 ) resulted in a significant decrease (10 times) in the Sm internalization fluxes. Furthermore, complexation with humic acids (and the corresponding reduction in Sm bioavailability) was stronger than that with fulvic acids. The results showed that the experimentally measured (free) Sm was a better predictor of Sm internalization than either the total concentrations or the free ion concentrations obtained using thermodynamic modeling. Environ Toxicol Chem 2018;37:1623-1631. © 2018 SETAC. © 2018 SETAC.

Human CD134 (OX40) expressed on T cells plays a key role for human herpesvirus 6B replication after allogeneic hematopoietic stem cell transplantation.

Science.gov (United States)

Nagamata, Satoshi; Nagasaka, Miwako; Kawabata, Akiko; Kishimoto, Kenji; Hasegawa, Daiichiro; Kosaka, Yoshiyuki; Mori, Takeshi; Morioka, Ichiro; Nishimura, Noriyuki; Iijima, Kazumoto; Yamada, Hideto; Kawamoto, Shinichiro; Yakushijin, Kimikazu; Matsuoka, Hiroshi; Mori, Yasuko

2018-05-01

CD134 (OX40), which is a cellular receptor for human herpesvirus-6B (HHV-6B) and expresses on activated T cells, may play a key role for HHV-6B replication after allogeneic hematopoietic stem cell transplantation (allo-HSCT). Therefore, we examined the CD134 expression on T cells and HHV-6B replication after allo-HSCT, and analyzed the correlation between them. Twenty-three patients after allo-HSCT were enrolled. The percentages of CD134-positive cells within the CD4 + and CD8 + cell populations were measured by flow cytometry, and the viral copy number of HHV-6B was simultaneously quantified by real-time PCR. The correlation between CD134 and HHV-6B viral load was then statistically analyzed. HHV-6B reactivation occurred in 11 of 23 patients (47.8%). CD134 expression was seen on T cells and was coincident with the time of peak viral load. The percentage of CD134-positive cells decreased significantly when HHV-6B DNA disappeared (p = .005 in CD4 + T cells, p = .02 in CD8 + T cells). In the 4 patients who underwent umbilical cord blood transplantation (UCBT), the viral load varied with the percentage of CD134-positive cells. In the comparison between the HHV-6B reactivation group and non-reactivation group, maximum percentages of CD134-positive cells among CD4 + T cells in reactivation group were significantly higher than those in non-reactivation group (p = .04). This is the first study to show that a correlation of CD134 expression on T cells with HHV-6B replication after allo-HSCT, especially in UCBT. The results possibly indicate that CD134 on T cells plays a key role for HHV-6B replication after allo-HSCT. Copyright © 2018 Elsevier B.V. All rights reserved.

Samarium-153 Oksabifor in the treatment of metastatic bone disease

International Nuclear Information System (INIS)

Solodyannikova, O.; Voit, N.; Sukach, G.; Sagan, D.

2015-01-01

patients - reducing the number of foci and the level of radiopharmaceutical uptake in them. Conclusions: radionuclide therapy in patients with BM can effectively suppress pain and significantly reduce the number of analgesics. Post-treatment patients, life quality statistically significantly improved. Samarium-153 has the ability to reduce BM number and intensity of radiopharmaceutical accumulation in spots in the control study. (authors)

Experimental Study of Evaporative Heat Transfer Characteristics of R-134a with Channel-Bending Angle in Microchannel Heat Exchangers

International Nuclear Information System (INIS)

Lee, Hae Seung; Jeon, Dong Soon; Kim, Young Lyoul; Kim, Seon Chang

2010-01-01

Experimental investigations have been carried out to examine the evaporative heat transfer characteristics of R-134a with the channel-bending angle (CBA) in microchannel heat exchangers. In this study, we examined the effects of evaporation temperature and Reynolds number of R-134a on the evaporative heat transfer characteristics of R-134a in microchannel heat exchangers with CBAs of 120 .deg. , 150 .deg. , and 180 .deg. under counterflow conditions. Experimental results show that the evaporative heat transfer rate and evaporative heat transfer coefficient increased with an increase in the Reynolds number of R-134a. Further, the evaporative heat transfer rate corresponding to CBAs of 120 .deg. and 150 .deg. increased to values greater than the evaporative heat transfer rate corresponding to 180 .deg. by approximately 17.1% and 13.3%, respectively, for evaporating temperatures in the range 4.9-14.9 .deg. C. The evaporative heat transfer coefficient was affected by the channel angle with increasing evaporative heat transfer coefficient at small channel bending angle

Biology-Oriented Syntheses (BIOS) of Novel Santonic-1,3,4-oxadiazole Derivatives under Microwave-Irradiation and their Antimicrobial Activity

International Nuclear Information System (INIS)

Salar, U.; Khan, K. M.; Naz, F.; Siddiqui, N. I.

2015-01-01

Novel 2-thio substituted 1,3,4-oxadiazole derivatives of santonic acid (13-18) were synthesized. The synthesis of these derivatives was comprised of six steps which start from the basic hydrolysis of santonin 1 to the santoninic acid 2 followed by in situ rearrangement of 2 into santonic acid 3. Santonic acid 3 was then converted into its acyl imidazole derivative 4 followed by hydrazinolysis to give santonic carbohydrazide 5 which was further converted into santonic-1,3,4-oxadiazole-2-thiol 6. Santonic-1,3,4-oxadiazole-2-thiol 6 was alkylated to afford 2-thio substituted 1,3,4-oxadiazole derivatives of santonic acid (13-18). All the synthetic steps were carried out under microwave irradiation in controlled parameters. Compounds 13-18 along with intervening intermediates 5 and 6 were evaluated for their antimicrobial potential. Compound 14 showed appreciably good activity against Staphylococcus epidermidis. On the other hand compounds 6 and 17 demonstrated good activity against Escherichia coli and Shigella flexeneri, respectively. Compound 6 showed good antifungal activity. The synthesized compounds were characterized by different spectroscopy techniques. (author)

Synthesis, characterization of some novel 1,3,4-oxadiazole compounds containing 8-hydroxy quinolone moiety as potential antibacterial and anticancer agents

Directory of Open Access Journals (Sweden)

Vinayak Mahadev Adimule

2014-12-01

Full Text Available In the present work a series of novel derivatives of 8-hydroxy quinolone substituted 1,3,4-oxadiazole compounds were synthesized by convergent synthetic method and studied for their antibacterial and anticancer properties. The cell lines used for cytotoxic evaluation were HeLa, Caco-2 and MCF7. The synthetic chemistry involved conversion of various substituted aromatic acids into ethyl ester 2a-e. The ethyl ester was converted into corresponding carbohydrazide 3a-e. Carbohydrazides are reacted with chloroacetic acid, phosphorous oxytrichloride and irradiated with microwave in order to obtain the various key intermediates 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole 4a-e. The 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole was reacted with 8-hydroxy quinolone in presence of sodium hydride and obtained a series of 8-hydroxy quinoline substituted 1,3,4-oxadiazoles 5a-e. Among the synthesised compounds, the cytotoxicity of the compound 5b i.e. 8-{[5-(2,4-dichlorophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline against MCF7 with IC50 of 5.3µM and the compound 5e i.e. 8-{[5-(4-bromophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline showed MIC of < 6.25µg/mL against Staphylococcus aureus which is comparable with the known standards. The standards used for cytotoxic evaluation was 5-fluorouracil and for antibacterial was nitrofurazone

Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

Energy Technology Data Exchange (ETDEWEB)

Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

1981-01-01

Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?

Science.gov (United States)

2010-01-01

... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a final...

Measurements of HFC-134a and HCFC-22 in groundwater and unsaturated-zone air: implications for HFCs and HCFCs as dating tracers

Science.gov (United States)

Haase, Karl B.; Busenberg, Eurybiades; Plummer, Niel; Casile, Gerolamo; Sanford, Ward E.

2014-01-01

A new analytical method using gas chromatography with an atomic emission detector (GC–AED) was developed for measurement of ambient concentrations of hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) in soil, air, and groundwater, with the goal of determining their utility as groundwater age tracers. The analytical detection limits of HCFC-22 (difluorochloromethane, CHClF2) and HFC-134a (1,2,2,2-tetrafluoroethane, C2H2F4) in 1 L groundwater samples are 4.3 × 10− 1 and 2.1 × 10− 1 pmol kg− 1, respectively, corresponding to equilibrium gas-phase mixing ratios of approximately 5–6 parts per trillion by volume (pptv). Under optimal conditions, post-1960 (HCFC-22) and post-1995 (HFC-134a) recharge could be identified using these tracers in stable, unmixed groundwater samples. Ambient concentrations of HCFC-22 and HFC-134a were measured in 50 groundwater samples from 27 locations in northern and western parts of Virginia, Tennessee, and North Carolina (USA), and 3 unsaturated-zone profiles were collected in northern Virginia. Mixing ratios of both HCFC-22 and HFC-134a decrease with depth in unsaturated-zone gas profiles with an accompanying increase in CO2 and loss of O2. Apparently, ambient concentrations of HCFC-22 and HFC-134a are readily consumed by methanotrophic bacteria under aerobic conditions in the unsaturated zone. The results of this study indicate that soils are a sink for these two greenhouse gases. These observations contradict the previously reported results from microcosm experiments that found that degradation was limited above-ambient HFC-134a. The groundwater HFC and HCFC concentrations were compared with concentrations of chlorofluorocarbons (CFCs, CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6). Nearly all samples had measured HCFC-22 or HFC-134a that were below concentrations predicted by the CFCs and SF6, with many samples showing a complete loss of HCFC-22 and HFC-134a. This study indicates that HCFC-22 and HFC-134

Synthesis and crystal structure of novel fluorescent 1,3,4-oxadiazole-containing carboxylate ligands

Science.gov (United States)

Mikhailov, Igor E.; Popov, Leonid D.; Tkachev, Valery V.; Aldoshin, Sergey M.; Dushenko, Galina A.; Revinskii, Yurii V.; Minkin, Vladimir I.

2018-04-01

Novel chelating ligands, 3-(5-aryl-1,3,4-oxadiazol-2-yl)acrylic acids and their zinc complexes were synthesized and their spectral and luminescent properties studied. The compounds intensively (quantum efficiencies φ = 0.18-0.76) luminesce in nonpolar solvents in the blue-green region (λmaxPL = 458-504 nm) of the spectrum. Molecular and crystal structures of 3-[5-(4-dimethylaminophenyl)-1,3,4-oxadiazol-2-yl]acrylic acid were established using X-ray crystallography. In crystal, the infinite chains of the molecules lie in the parallel planes and are arranged by the "head to tail" type to provide for strong π-π stacking interactions between the layers facilitating appearance of high electron transport properties and formation of excimers.

Test of 134Cs, 85,89Sr leaching rate in a resemble vitrifiable cement waste form

International Nuclear Information System (INIS)

Lin Meiqiong; Wei Feng; Yin Qi; Fan Xianhua; Xu Shengli; Li Yongde

2003-01-01

A novel material--resemble vitrifiable cement for conditioning low and mediate level radioactive waste has been developed. Waste form has been characterized for their physical and chemical performance, phase composition. The cement formulation has been patented. In this experiment the cement is mixed with simulated wastes spiked with 134 Cs and 85,89 Sr by 5 min at least. The Ratio of the waste to the cement is 0.45-0.55. The mixture is packed into cylindrical molds which has the same dimension of diameter and height . The grouts are cured for a period of 28 d in a room temperature curing chamber at an atmospheric pressure. The cured waste form is then completely immersed into deionized water. According to standard GB7023-86, leaching rate of 134 Cs and 85,89 Sr are measured. The result shows that the leaching rate of the species 134 Cs and 85,89 Sr is to be on the order 10 -4 and 10 -5 on the 42 d immersion, respectively and is better than that of commercial cement

Experimental investigation of hydrocarbon mixtures to replace HFC-134a in an automotive air conditioning system

International Nuclear Information System (INIS)

Wongwises, Somchai; Kamboon, Amnouy; Orachon, Banchob

2006-01-01

This paper presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in automotive air conditioners. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). The measured data are obtained from an automotive air conditioning test facility utilizing HFC-134a as the refrigerant. The air conditioner, with a capacity of 3.5 kW driven by a Diesel engine, is charged and tested with four different ratios of hydrocarbon mixtures. The experiments are conducted at the same surrounding conditions. The temperature and pressure of the refrigerant at every major position in the refrigerant loop, the temperature, flow rate and humidity of air, torque and engine speed are recorded and analyzed. The parameters investigated are the refrigeration capacity, the compressor power and the coefficient of performance (COP). The results show that propane/butane/isobutane: 50%/40%/10% is the most appropriate alternative refrigerant to replace HFC-134a, having the best performance of all the hydrocarbon mixtures investigated

7 CFR 947.134 - Establishment of list of manufacturers of potato products.

Science.gov (United States)

2010-01-01

... 7 Agriculture 8 2010-01-01 2010-01-01 false Establishment of list of manufacturers of potato... AGRICULTURE IRISH POTATOES GROWN IN MODOC AND SISKIYOU COUNTIES, CALIF., AND IN ALL COUNTIES IN OREGON, EXCEPT MALHEUR COUNTY Rules and Regulations Safeguards § 947.134 Establishment of list of manufacturers of potato...

Decomposition of SF6-R134a effluents by RF plasma

International Nuclear Information System (INIS)

Joshi, Avinash V.

2012-01-01

The efficiency of recovery achieved by open or closed loop extraction of RPC exhaust gases is in the range of 90-95% under optimum conditions. For a large detector setup operating on one volume change per day basis, a 5% loss amounts to discharging 50 kg of R134a and 0.5 kg of SF 6 into atmosphere every day. The emissions are equivalent to create nearly 50 000 m 3 of carbon dioxide daily. The gas emissions need to be completely converted to safer compounds. The gases such as R134a and SF 6 are stable compounds. In order to decompose these, the mixture is first activated by adding of 50% oxygen and 2% argon and under typical RF plasma conditions of 13.56 MHz, 1 Torr pressure and 0.2 W/cm 2 power density. The chemical reaction takes place on the surface of a silicon electrode. The product of the reaction is mainly SiF 4 (gas), which is further hydrolyzed to form HF solution and silicon hydroxide sludge. More than 90% of the effluent gas mixture can be effectively removed by this method.

Studies of mechanism of radioactive cesium-134 adsorption from water solutions onto tri ammonium dodecamolybdenophosphate(V)

International Nuclear Information System (INIS)

Choma, J.; Stasiuk, J.

1992-01-01

A mechanism of radioactive cesium-134 adsorption from water solutions on new, inorganic adsorbent composed from 85% of tri ammonium dodecamolibdophosphate(V) and 15% of urea resin is presented. A migration is found of Cs cations into the adsorbent grains. The absorption of Cs-134 beta radiation is studied as a function of WMF-15 tablet thickness. The penetration depth of radionuclide was found to be function of the process duration and the adsorbent density. Diffusion of cesium into the adsorbent grains explains the effect of ''recreation'' of its adsorption capacitance. (author). 2 refs, 2 figs

High dose teriparatide (rPTH1-34) therapy increases callus volume and enhances radiographic healing at 8-weeks in a massive canine femoral allograft model.

Science.gov (United States)

Nishitani, Kohei; Mietus, Zachary; Beck, Christopher A; Ito, Hiromu; Matsuda, Shuichi; Awad, Hani A; Ehrhart, Nicole; Schwarz, Edward M

2017-01-01

Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34) effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20) received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1) Placebo (n = 5; daily saline), 2) Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op), or 3) Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op). Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT) was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05). These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR) on host bone and graft-host junctions (p<0.05). Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05). Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01). In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.

High dose teriparatide (rPTH1-34 therapy increases callus volume and enhances radiographic healing at 8-weeks in a massive canine femoral allograft model.

Directory of Open Access Journals (Sweden)

Kohei Nishitani

Full Text Available Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34 effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20 received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1 Placebo (n = 5; daily saline, 2 Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op, or 3 Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op. Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05. These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR on host bone and graft-host junctions (p<0.05. Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05. Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01. In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.

Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer

International Nuclear Information System (INIS)

Gerking, S.D.; Berg, A.; Gerard, P.

1976-01-01

The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C

The synthesis, characterization and optical properties of novel 1,3,4-oxadiazole-containing imidazo[1,5-a]pyridine derivatives

International Nuclear Information System (INIS)

Ge Yanqing; Hao Benqian; Duan Guiyun; Wang Jianwu

2011-01-01

A series of novel substituted 1,3,4-oxadiazole derivatives were synthesized by the reaction of 3-butyl-1-chloroimidazo[1,5-a]pyridine-7-carbohydrazide with propionyl chloride and substituted benzoic chloride in the presence of phosphorus oxychloride. The compounds were characterized using IR, 1 H NMR, 13 C NMR and HRMS. Absorption and fluorescence spectra were measured in dichloromethane; an intense absorption maxima was noted at ca. 290 nm and emission maxima was noted at ca. 470 nm. The absorption spectra of the 1,3,4-oxadiazole derivatives reveal that a phenyl and an ethyl group attached to the 1,3,4-oxadiazole ring markedly influenced the maximum absorption. The structures based on density function theory (DFT) calculation show planar configurations for the compounds. The calculated molecular orbital correlates well with their absorption. - Research highlights: → Novel imidazo[1,5-a]pyridine derivatives were synthesized. → The structures were determined by IR, 1 H NMR, 13 C NMR and HRMS spectra. → We investigated the absorption and fluorescence spectral characteristics of the compounds. → The side group in 1,3,4-oxadiazole ring can affect its photophysical properties markedly. → Quantum calculation correlates well with their absorption.

Transfer of Chernobyl-derived 134Cs, 137Cs, 131I and 103Ru from flowers to honey and pollen

International Nuclear Information System (INIS)

Bunzl, K.; Kracke, W.

1988-01-01

The activity concentrations of 137 Cs, 134 Cs, 131 I and 103 Ru were determined separately in honey and pollen samples collected from a single bee colony during several months after the deposition of Chernobyl fallout. The source of each honey and pollen sample was determined by pollen analysis. Although the activity concentrations in honey and pollen varied with time, the concentrations of 137 Cs and 134 Cs were, in general, higher in pollen than in honey. For 103 Ru and 131 I, these differences were comparatively small. The mean 131 I/ 137 Cs and 103 Ru/ 137 Cs ratios were about one order of magnitude higher in honey than in pollen. The mean 131 I/ 103 Ru ratio was about the same for honey and pollen. This observation, in the light of the corresponding nuclide ratios found in the deposition, suggests that 137 Cs, 134 Cs, 131 I and 103 Ru were taken up by the plant leaves and transported to nectar and pollen. The higher activity concentrations of 137 Cs and 134 Cs in pollen, relative to honey, indicate that these radionuclides behave analogously to potassium, which is also found in higher quantities in pollen. (author)

New 1,3,4-Oxadiazole Based Photosensitizers for Dye Sensitized Solar Cells (DSSCs

Directory of Open Access Journals (Sweden)

Umer Mehmood

2015-01-01

Full Text Available 1,3,4-Oxadiazole based photosensitizers with biphenyl, naphthalene, anthracene, and triphenylamine as the electron-donating moiety were synthesized for solar cell applications. In these photosensitizers, cyano groups were introduced as the electron acceptor and the anchor group because of their high electron-withdrawing ability and strong bonding to the semiconductor. Oxadiazole isomers were used as the π-conjugation system, which bridges the donor-acceptor systems. The electrochemical and optical properties of the sensitizers were investigated both in their native form and upon incorporation into dye sensitized solar cells. The results of UV-visible absorption spectroscopy, electrochemical impedance spectroscopic measurements, and photocurrent voltage characteristics indicate that 1,3,4-oxadiazole pi-spacer with the anthracene moiety has the highest efficiency of 2.58%. Density functional theory was employed to optimize the structures of the sensitizers and the TiO2 cluster.

Effect of waste mica on transfer factors of {sup 134}Cs to spinach and lettuce; Effet de dechets de mica sur les facteurs de transfert du {sup 134}Cs a l'epinard et la laitue

Energy Technology Data Exchange (ETDEWEB)

Sreenivasa Chari, M.; Manjaiah, K.M. [Indian Agricultural Research Institute, Division of Soil Science and Agricultural Chemistry, New Delhi - 110012 (India); Sachdev, P.; Sachdev, M.S. [Indian Agricultural Research Institute, Nuclear Research Laboratory, New Delhi - 110012 (India)

2011-07-15

A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg{sup -1}) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in {sup 134}Cs-contaminated (at 37 k Bq kg{sup -1} soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average {sup 134}Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg{sup -1} soil. There exists an inverse relationship between the {sup 134}Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)

Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

Directory of Open Access Journals (Sweden)

Marcelo Tatit Sapienza

2004-01-01

Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

20 CFR 220.134 - Medical-vocational guidelines in appendix 2 of this part.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Medical-vocational guidelines in appendix 2... THE RAILROAD RETIREMENT ACT DETERMINING DISABILITY Vocational Considerations § 220.134 Medical-vocational guidelines in appendix 2 of this part. (a) The Dictionary of Occupational Titles includes...

Establishment of EMab-134, a Sensitive and Specific Anti-Epidermal Growth Factor Receptor Monoclonal Antibody for Detecting Squamous Cell Carcinoma Cells of the Oral Cavity.

Science.gov (United States)

Itai, Shunsuke; Yamada, Shinji; Kaneko, Mika K; Chang, Yao-Wen; Harada, Hiroyuki; Kato, Yukinari

2017-12-01

Epidermal growth factor receptor (EGFR), a receptor tyrosine kinase, activates downstream signaling cascades in many tumors. In this study, we established novel anti-EGFR monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. We immunized mice with a combination of the extracellular domain of EGFR and EGFR-overexpressing LN229 glioblastoma cells (LN229/EGFR) and performed the first screening using enzyme-linked immunosorbent assay. Next, we selected mAbs using flow cytometry. Among 156 established clones, two mAbs, EMab-51 (IgG 1 , kappa) and EMab-134 (IgG 1 , kappa), reacted with EGFR in Western blot analysis; EMab-134 showed a much higher sensitivity compared with EMab-51. We compared the binding affinities of EMab-51 and EMab-134 using flow cytometry; the calculated K D values for EMab-51 and EMab-134 against SAS cells/HSC-2 cells were 9.2 × 10 -9 M/9.9 × 10 -9 M and 2.6 × 10 -9 M/8.3 × 10 -9 M, respectively, indicating that EMab-134 has a higher affinity to EGFR-expressing cells. Immunohistochemical analysis of EMab-51 and EMab-134 showed sensitive and specific reactions against oral cancer cells; EMab-134 demonstrated a much higher sensitivity (36/38 cases; 94.7%) to oral squamous cell carcinomas compared with EMab-51 (6/38 cases; 15.8%). This novel anti-EGFR mAb, EMab-134, could be advantageous for detecting EGFR in the pathological analysis of EGFR-expressing cancers.

134Cs-transport in an experimental ecological system

International Nuclear Information System (INIS)

Mocsy, Ildiko; Uray, Ildiko; Salagean, Stefania

1986-01-01

An experimental aquatic ecosystem was developed consisting of river water, slurry, algae and crustaceans. The change of the cesium concentration factor (F c ) of two alga species were measured using 20 Bq/ml of 134 CsCl. Measurements were performed in the 6th, 12th, 24th, 48th and 72nd hour after irradiation. F c in crustaceans was found to be 1300 in the 12th hr, then decreased rapidly down to 275. The temporal dependence of cesium accumulation in slurry increased consistently. It was found that algae accumulated cesium variously. Owing to its high accumulation, Cladophora glomerata can be used as a biological indicator of cesium concentration in surface waters. (K.I.)

Effects of samarium (Sm) additions on the microstructure and mechanical properties of as-cast and hot-extruded Mg-5 wt%Al-3 wt%Ca-based alloys

International Nuclear Information System (INIS)

Son, Hyeon-Taek; Lee, Jae-Seol; Kim, Dae-Guen; Yoshimi, Kyosuke; Maruyama, Kouichi

2009-01-01

Samarium (Sm) additions to as-cast Mg-5Al-3Ca-based alloys result in changes, such as equiaxed grains and a refined grain size. The microstructure of as-cast Mg-5Al-3Ca-xSm alloys consists of an α-Mg matrix, a (Mg, Al) 2 Ca eutectic phase, and an Al 2 Sm intermetallic compound. In as-cast alloys, the (Mg, Al) 2 Ca eutectic phase was located at grain boundaries with a chain structure, and the Al 2 Sm intermetallic compounds were homogeneously distributed at the α-Mg matrix and grain boundaries. The eutectic phase of the extruded alloys was elongated in the extrusion direction and crushed into fine particles because of severe deformation during hot extrusion, and the grain size was refined with an increased amount of Sm addition. The maximum values of the yield strength and tensile strength were 313 MPa and 330 MPa at 2 wt%Sm alloy content, respectively

Coulomb excitation of neutron-rich $^{134-136}$Sn isotopes

CERN Multimedia

We propose to study excited states in the isotopes $^{134,136}$Sn by $\\gamma$-ray spectroscopy following "safe" Coulomb excitation. The experiment aims to investigate the evolution of quadrupole collectivity beyond the magic shell closure at N = 82 by the determination of B(E2) values and electric quadrupole moments $\\mathcal{Q}_2$. Recent shell-model calculations using realistic interactions predict possible enhanced collectivity in neutron-rich regions. Evidence for this could be obtained by this experiment. Furthermore, the currently unknown excitation energies of the 2$^+_{1}$ and 4$^+_{1}$ states in $^{136}$Sn will be measured for the first time.

The combined effect of Parathyroid hormone (1-34) and whole-body Vibration exercise in the treatment of OSteoporosis (PaVOS)- study protocol for a randomized controlled trial

DEFF Research Database (Denmark)

Jepsen, Ditte Beck; Ryg, Jesper; Jørgensen, Niklas Rye

2018-01-01

Background: PaVOS is a randomized controlled trial (RCT) which aims to address the use of whole-body vibration exercise (WBV) in combination with parathyroid hormone 1-34 fragment teriparatide (PTH 1-34) treatment in patients with osteoporosis. PTH 1-34 is an effective but expensive anabolic...... fracture risk. Methods/design: PaVOS is a multicenter, assessor-blinded, superiority, two-armed randomized controlled trial (RCT). Postmenopausal women (n = 40, aged 50 years and older) starting taking PTH 1-34 from outpatient clinics will be randomized and assigned to a PTH 1-34 + WBV-exercise group...... (intervention group), or a PTH 1-34-alone group (control group). The intervention group will undergo WBV three sessions a week (12 min each, including 1:1 ratio of exercise: rest, 30 Hz, 1 mm amplitude) for a 12-month intervention period. Both the intervention and the control group will receive PTH 1...

Synthesis, characterization and pharmacological evaluation of different 1,3,4-oxadiazole and acetamide derivatives of ethyl nipecotate

Directory of Open Access Journals (Sweden)

Khadija Nafeesa

2017-12-01

Full Text Available A new series of N-substituted derivatives of 2-[(5-{1-[(4-chlorophenylsulfonyl]-3-piperidinyl}-1,3,4-oxadiazol-2-ylsulfanyl]acetamide (6a-w has been designed and synthesized with multifunctional moieties. The synthesized compounds were evaluated for their antibacterial and anti-enzymatic potential supported by % hemolytic activity. The synthesized compound 5-(1-(4-chlorophenylsulfonyl-3-piperidinyl-1,3,4-oxadiazole-2-thiol (3 was stirred with synthesized electrophiles as N-aryl/alkyl/aralkyl-2-bromoacetamide (5a-w in an aprotic solvent under basic conditions to acquire the target molecules, 6a-w. The spectral analytical techniques of IR, EI-MS, 1H NMR and 13C-NMR were utilized for structural elucidation of synthesized molecules. The antibacterial screening against certain bacterial strains of gram-negative and gram-positive bacteria rendered compound 6i as good inhibitor of gram-negative bacterial strains. The enzyme inhibition revealed low potential against lipoxygenase (LOX enzyme. The hemolytic study provided valuable information about cytotoxic behavior of synthesized molecules. Keywords: 1,3,4-Oxadiazole, Acetamide, Antibacterial activity, Hemolytic activity, Lipoxygenase inhibition

Determination of /sup 131/I, /sup 134/Cs, /sup 137/Cs in grass and cheese after Chernobyl accident in Austria

Energy Technology Data Exchange (ETDEWEB)

Teherani, D K

1987-09-14

Various samples from Styria (grass) and Salzburg (cheese) were analyzed for /sup 131/I, /sup 134/Cs and /sup 137/Cs concentration during April - July 1986 by ..gamma..-ray spectroscopy. The concentrations are reported in nCi kg/sup -1/ wet weight. The values found for /sup 131/I were 0.2-17.2 (grass), 0.1-0.5 (cheese), for /sup 134/Cs 1.1-6.2 (grass), 0.2-1.3 (cheese), for /sup 137/Cs 1.6-15.7 (grass), 0.3-2.2 (cheese). While radioactivity of /sup 131/I, /sup 134/Cs and /sup 137/Cs in cheese samples increased from May to June, it decreased in grass samples from May to July. (author) 5 refs

Synthesis and Antifungal Activity of Novel Sulfone Derivatives Containing 1,3,4-Oxadiazole Moieties

Directory of Open Access Journals (Sweden)

Maoguo Tong

2011-11-01

Full Text Available A series of new sulfone compounds containing 1,3,4-oxadiazole moieties were synthesized. The structures of these compounds were confirmed by spectroscopic data (IR, 1H- and 13C-NMR and elemental analyses. Antifungal tests indicated that all the title compounds exhibited good antifungal activities against eight kinds of plant pathogenic fungi, and some showed superiority over the commercial fungicide hymexazol. Among them, compounds 5d, 5e, 5f, and 5i showed prominent activity against B. cinerea, with determined EC50 values of 5.21 μg/mL, 8.25 µg/mL, 8.03 µg/mL, and 21.00 µg/mL, respectively. The present work demonstrates that sulfone derivatives such as 5d containing a 1,3,4-oxadiazole moiety can be used as possible lead compounds for the development of potential agrochemicals.

Compatibility of manufacturing process fluids with R-134a and polyolester lubricant. Final report

Energy Technology Data Exchange (ETDEWEB)

Cavestri, R.C.; Schooley, D.L. [Imagination Resources, Inc., Dublin, OH (United States)

1996-07-01

This report includes a broad list of processing fluids that are known to be used to manufacture air conditioning and refrigeration products. Sixty-four process fluids from this list were selected for compatibility studies with R-134a and ICI EMKARATE RL32H (32 ISO) polyolester lubricant. Solutions or suspensions of the process fluid residues in polyolester lubricant were heated for 14 days at 175{degrees}C (347{degrees}F) in evacuated sealed glass tubes containing only valve steel coupons. Miscibility tests were performed at 90 wt.% R-134a, 10 wt.% polyolester lubricant with process fluid residue contaminate and were scanned in 10{degrees}C (18{degrees}F) increments over a temperature range of ambient to -40{degrees}C (-40{degrees}F). Any sign of turbidity, haze formation or oil separation was considered the immiscibility point.

13 CFR 134.710 - Who can file a response to an appeal petition and when must such a response be filed?

Science.gov (United States)

2010-01-01

... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who can file a response to an appeal petition and when must such a response be filed? 134.710 Section 134.710 Business Credit and...

Cs-134 transfer from water or food to the Ciprinid Tinca tinca Linnaeus: uptake and loss kinetics

International Nuclear Information System (INIS)

Corisco, J.A.G.; Carreiro, M.C.V.

1991-01-01

Experiments with 134 Cs and the fish Tinca tinca Linnaeus (fam. Cyprinidae), as a part of a more extensive work, concerning a simplified freshwater trophic chain using water from Fratel dam, (at Tejo River), were undertaken. Direct uptake from water, during a period of about 30 days, leads to a kinetics expressed by the power function: CF (t) = 0.58 t 0.781 (t in days), the concentration factor (CF) referred to wet weight. Retention study, showed the existence of two biological half-lives, Tb 1 = 7 days and Tb 2 = 87 days, which might concern respectively, the 134 Cs desorption from the transit organs and the loss of the assimilated isotope from the storage organs. In the accumulation through the food chain, using planktonic crustacean Daphnia magna Straus (Cladocera) as prey, a transfer factor (TF) related to wet weight of both fish and prey, is estimated through the power function: TF (t) = 0.022 t 0.578 (t in days). Finally, the retention study following the food pathway contamination, stresses the existence of one long term component, with half-life Tb = 61 days. The transfer factor kinetics seems to point out to a rather slow process, leading to lower 134 Cs concentration values, than the contamination through the water. The loss of the assimilated 134 Cs, uptaken through both pathways, water or food, is a slow process. The longer biological half-life is very important in Radiological Protection, once it may be attributed to the radionuclide loss from the muscular mass. (author)

134Cs uptake by four plant species and Cs-K relations in the soil-plant system as affected by Ca(OH)2 application to an acid soil

International Nuclear Information System (INIS)

Massas, I.; Skarlou, V.; Haidouti, C.; Giannakopoulou, F.

2010-01-01

Three rates of Ca(OH) 2 were applied to an acid soil and the 134 Cs uptake by radish, cucumber, soybean and sunflower plants was studied. The 134 Cs concentration in all plant species was reduced from 1.6-fold in the sunflower seeds to 6-fold in the soybean vegetative parts at the higher Ca(OH) 2 rate. Potassium (K) concentration in plants was also reduced, but less effectively. The significantly decreased 134 Cs-K soil to plant distribution factors (D.F.) clearly suggest a stronger effect of soil liming on 134 Cs than on K plant uptake. This observation was discussed in terms of ionic interactions in the soil matrix and within the plants. The results also indicated that the increased Ca 2+ concentration in the exchange phase and in the soil solution along with the improved root activity, due to the soil liming, enhanced the immobilization of 134 Cs in the soil matrix and consequently lowered the 134 Cs availability for plant uptake.

Viscosity Measurements and Correlations for 1,1,1,2-tetrafluoroethane (HFC-134a) up to 140 MPa

DEFF Research Database (Denmark)

Comuñas, M.J.P.; Baylaucq, A.; Cisneros, Sergio

2003-01-01

In spite of being one of the most studied refrigerants, large discrepancies in the experimental determination of the dynamic viscosity of 1, 1, 1,2-tetrafluoroethane (HFC-134a) prevail. Additionally, there is a need for supplementary high-pressure measurements that can help to derive sound general...... correlations for the viscosity of this compound. Hence, in this work new dynamic viscosity measurements for HFC-134a using a falling-body viscometer in the temperature range of 293.15-373.15 K and pressures up to 140 MPa are presented. This work high-pressure data in combination with already published data...

Exergetic and thermodynamic comparison of R12 and R134a as vapour compression refrigeration working fluids

Energy Technology Data Exchange (ETDEWEB)

De Rossi, Filippo; Mastrullo, Rita; Mazzei, Pietro [Naples Univ. (Italy)

1993-05-01

A software package for both the computation of thermodynamic properties and the analysis of the usual vapour compression plant schemes is a useful tool for air conditioning and refrigeration researchers and manufacturers. At present, it could make an important contribution to the search for CFC substitutes; in fact, comparisons between two or more working fluids could be accomplished more easily. A program created by the authors is presented by means of some demonstrative diagrams referring to a comparison between the ''ozone killer'' R12 and its substitute R134a. An R134a exergy-enthalpy chart is also provided. (Author)

Test Report #33: Compressor Calorimeter Test of R-410A Alternative: R-32/R-134a Mixture Using a Scroll Compressor

Energy Technology Data Exchange (ETDEWEB)

Shrestha, Som [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sharma, Vishaldeep [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Abdelaziz, Omar [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2014-02-18

This report investigates the tested performance of lower - GWP candidate refrigerant, 94.07 wt% R - 32 + 5.93 wt % R - 134 a mixture (hereafter referred to as R - 32/134a), as an alternative to baseline refrigerant R - 410 A using a 36,000 Btu/hr compressor calorimeter located at the Heat Exchanger Advanced Testing Facility at Oak Ridge National Laboratory . These tests were conducted during May and August 2013. R - 410A is a near - azeotropic blend of R - 32 and R - 125 with 0.5/0.5 mass fraction and has a GWP 100 of 2100. R - 32 and R - 134a are pure refrigerants and have GWP 100 of 716 and 1370 1, respectively. Based on the GWP 100 values of pure refrigerants and their mass fraction in the blend, GWP 100 of R - 32/134a, which is under development by National Refrigerant, is 755. This report compares various performance parameters, such as cooling capacity, compressor power, refrigerant mass flow rate, EER, isentropic efficiency and discharge temperature of the alternative refrigerant to that of R - 410 A.

The effect of soil pH and the fungicide 'Captan' on 134Cs transfer factors for cucumber and radish plants

International Nuclear Information System (INIS)

Skarlou, V.; Massas, I.; Anoussis, J.; Haidouti, C.; Arapis, G.

1999-01-01

The effect of soil pH and the fungicide 'Captan' on 134 Cs transfer factors (TFs) was studied in a greenhouse pot experiment with cucumber and radish plants. A soil with a low pH (4.2) was selected and its pH value has increased to 5.7, 6.5 and 7.6 by the addition of different amounts of Ca(OH) 2 . Liming of the soil and the subsequent increase in pH values resulted in a reduction of 134 Cs TFs which was not always significant. TFs were the highest in the very acid soil (pH 4.2) and were practically the same above the pH 5.7 although they were the lowest in the calcareous soil. The ratio highest / lowest TF of each crop or plant part ranged between ∼ 2.0 for radish and 4.5 for cucumber plants and it was much lower than that previously reported and attributed to pH differences. Edible to other plant material TF ratio indicates that cucumber plant accumulates considerably more of the totally absorbed 134 CS in the edible part than radish crops. When biomass production was used for excluding dilution effects, 134 CS total activity (Bq/pot) was higher for both plants when grown in the intermediate soil pH (5.7 - 6.5), due to the higher yield at these pH values. The application of the fungicide 'Captan' gave no significant differences in 134 Cs TFs for both plant species and in all studied soil pH. Refs. 4 (author)

Idiopathic urolithiasis in Tunisian children: A report of 134 cases

Directory of Open Access Journals (Sweden)

A Alaya

2013-01-01

Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.

An experimental investigation on the substitution of HFC134a with HFO1234YF in a domestic refrigerator

International Nuclear Information System (INIS)

Aprea, Ciro; Greco, Adriana; Maiorino, Angelo

2016-01-01

Highlights: • An experimental comparison between R134A and HFO1234YF is presented. • A domestic refrigerator made to work with R134A is analysed. • The annual energy consumptions of the device are reported. • The energy saving achievable after the drop-in is evaluated. - Abstract: The latest international regulations on the reduction of greenhouse gases are strongly redesigning the scenario of use of refrigerants, gradually eliminating the possibility of employing the HFCs. Among all sectors of refrigeration, one of the most affected by these restrictions is the domestic refrigeration. Although for it have been suggested some solutions, such as the construction of household refrigerator operating with the hydrocarbons, there remains the need to find a substitute for HFC134a. In particular, the substitution may involve both existing machines and already in operation, which cannot be loaded with hydrocarbons, and new devices. With the aim of finding a simple implementation solution, in the present work, it is reported an experimental investigation carried out on a domestic refrigerator designed and built to operate with HFC134a and for which a drop-in with HFO1234yf has been realised. The experimentation has been addressed so as to highlight the behaviour of the system as a result of the drop-in, with a particular interest in the energy performance variation. A slight energy saving has been recorded with HFO1234yf, and an improving of the cooling capacity has been noticed.

Modified Peng-Robinson Equation of State for Pure and Mixture Refrigerants with R-32,R-125 and R-134a

Science.gov (United States)

Ll, Jin; Sato, Haruki; Watanabe, Koichi

On the basis of critically-evaluated thermodynamic property data among those recently published, a new Peng-Robinson equation of state for the HFC refrigerants,R-32,R-125 and R-134a,has be end eveloped so as to represent the VLE properties in the vapor-liquid coexisting phase at temperatures 223K-323K. In accord with a challenge to correlate the binary and/or ternary interatction parameters as functions of temperature, we have also applied the present modified Peng-Robinson equation of state to the promising alternative HFC refrigerant mixtures, i.e., R-32/125,R-32/134a and R-32/125/134a systems. The developed equation of state improves significantly its effectiveness for practical engineering property calculations at refrigerantion and air-conditioning industries in comparison with conventional Peng-Robinson equation.

34 CFR 668.134 - Institutional policies and procedures for requesting documentation and receiving secondary...

Science.gov (United States)

2010-07-01

... STUDENT ASSISTANCE GENERAL PROVISIONS Immigration-Status Confirmation § 668.134 Institutional policies and... immigration status of applicants for title IV, HEA student financial assistance who claim to meet the... eligible noncitizen until the institution has provided the student the opportunity to submit the...

Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

International Nuclear Information System (INIS)

Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

1985-01-01

The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

Effect of Rain Acidity Upon Mobility of Cs-134 and Co-60 in Soil

International Nuclear Information System (INIS)

Ruangchuay, S.; Harvey, N.W.; Sriyotha, P.

1998-01-01

This research was aimed to study the effects of groundwater and acid rain upon the mobility of radionuclides (Cs-134 and Co-60) in contaminated top soil. Clay soil was homogeneously packed in columns with dimension φ.12.5 cm. * 50 cm.. At the top 5 cm. of the columns, soil contaminated with radionuclides was added with the same consistency. Column were kept standing for 4 months in an artificial water table kept at 3 cm. from the bottom. During this period artificial acid rain with pH3, 4.5 and 6 was applied weekly at the top. Soil samples were taken every 30 days for examination of total and extracable radioactivity. It was shown that with the aide of the rain radionuclide movement down the profile was greater, with Co-60 > Cs-134. However acidity of the rain shown no effect on their movement

Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds

Directory of Open Access Journals (Sweden)

Lei Zhou

2017-11-01

Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.

Magnetic and magnetocaloric properties of spin-glass material DyNi{sub 0.67}Si{sub 1.34}

Energy Technology Data Exchange (ETDEWEB)

Chen, X. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); College of Physics and Electronic Information Engineering, Neijiang Normal University, Neijiang 641100 (China); Mudryk, Y., E-mail: slavkomk@ameslab.gov [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pathak, A.K.; Feng, W. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pecharsky, V.K. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Department of Materials Science and Engineering, Iowa State University, Ames, IA 50011-2300 (United States)

2017-08-15

Highlights: • Spin-glass state is observed in the DyNi{sub 0.67}Si{sub 1.4} compound. • Random Ni/Si distribution in the AlB{sub 2}-type structure leads to magnetic frustration. • Magnetic frustration affects magnetic field dependence of magnetocaloric effect. - Abstract: Structural, magnetic, and magnetocaloric properties of DyNi{sub 0.67}Si{sub 1.34} were investigated using X-ray powder diffraction, magnetic susceptibility, and magnetization measurements. X-ray powder diffraction pattern shows that DyNi{sub 0.67}Si{sub 1.34} crystallizes in the AlB{sub 2}-type hexagonal structure (space group: P6/mmm, No. 191, a = b = 3.9873(9) Å, and c = 3.9733(1) Å). The compound is a spin-glass with the freezing temperature T{sub G} = 6.2 K. The ac magnetic susceptibility measurements confirm magnetic frustration in DyNi{sub 0.67}Si{sub 1.34}. The maximum value of the magnetic entropy change determined from M(H) data is −16.1 J/kg K at 10.5 K for a field change of 70 kOe.

Inventory and mitigation opportunities for HFC-134a emissions from nonprofessional automotive service

Science.gov (United States)

Zhan, Tao; Potts, Winston; Collins, John F.; Austin, Jeff

2014-12-01

Many vehicle owners in the United States recharge their vehicles' air conditioning systems with small containers of hydrofluorocarbon-134a (HFC-134a, CH2FCF3), at a frequency estimated to be once every year on average. Such nonprofessional service produces immediate emissions of this potent greenhouse gas during service and from the residual heel in partially used containers. The nonprofessional operations are also associated with increased delayed refrigerant emissions that occur because owners are less likely to repair leaks than professional technicians. In California, an estimated 1.3 million nonprofessional service operations performed each year generate 0.27 ± 0.07 million metric ton CO2 equivalent (MMTCO2e) of immediate emissions and 0.54 ± 0.08 MMTCO2e of delayed emissions, using a Global Warming Potential of 1300 for HFC-134a. The immediate emissions can be largely mitigated by a regulation that requires self-sealing valves and improved labeling instructions on the containers, a deposit-return-recycling program for the containers, and a consumer education program. If 95% of the used containers were to be returned by consumers for recycling of the container heel, the annual immediate emissions would be reduced by 0.26 ± 0.07 MMTCO2e. In the United States, an estimated 24 million nonprofessional service operations are performed each year, generating 5.1 ± 1.4 MMTCO2e of immediate emissions and 10.4 ± 1.5 MMTCO2e of delayed emissions. Mitigation measures equivalent to the California regulation would reduce nationwide immediate emissions by 4.9 ± 1.4 MMTCO2e, if 95% of the used cans were returned for recycling. These business-as-usual emissions and mitigation potentials are projected to stay approximately constant until around 2022, and remain at significant levels into the 2030s.

Re-suspension of Cesium-134/137 into the Canadian Environment and the Contribution Stemming from the Fukushima-Daiichi Nuclear Incident

Science.gov (United States)

Mercier, Jean-Francois; Zhang, Weihua; Loignon-Houle, Francis; Cooke, Michael W.; Ungar, Kurt R.; Pellerin, Eric R.

2013-04-01

Cesium-137 (t1/2 = 30 yr) and cesium-134 (t1/2 = 2yr) constitute major fission by-products observed as the result of a nuclear incident. Such radioisotopes become integrated into the soil and biomass, and can therefore undergo re-suspension into the environment via activities such as forest fires. The Canadian Radiological Monitoring Network (CRMN), which consists of 26 environmental monitoring stations spread across the country, commonly observes cesium-137 in air filters due to re-suspension of material originating from long-past weapons testing. Cesium-134 is not observed owing to its relatively short half-life. The Fukushima-Daiichi nuclear power plant incident of March 2011 caused a major release of radioactive materials into the environment. In Canada, small quantities of both cesium-137 and cesium-134 fallout were detected with great frequency in the weeks which followed, falling off rapidly beginning in July 2011. Since September 2011, the CRMN has detected both cesium-137 and cesium-134 from air filters collected at Yellowknife, Resolute, and Quebec City locations. Using the known initial cesium-134/cesium-137 ratio stemming from this incident, along with a statistical assessment of the normality of the data distribution, we herein present evidence that strongly suggests that these activity spikes are due to re-suspended hot particles originating from the Fukushima-Daiichi nuclear power plant incident. Moreover, we have evidence to suggest that this re-suspension is localized in nature. This study provided empirical insight into the transport and uptake of radionuclides over vast distances, and it demonstrates that the CRMN was able to detect evidence of a re-suspension of Fukushima-Daiichi related isotopes.

The removal of 134Cs from radioactive process waste water by coprecipitate flotation

International Nuclear Information System (INIS)

Aziz, M.; Shakir, K.; Benyamin, K.

1986-01-01

The coprecipitate flotation of 134 Cs from radioactive process waste water using copper ferrocyanide as a coprecipitating agent and sodium lauryl sulphate, cetyl trimethyl ammonium bromide or gelatin as collector was extensively investigated to establish the best conditions for caesium removal with each of the collectors under test. The investigated parameters include the collector dosage, the Cu 2+ /Fe(CN) 6 4- ratio, the caesium, potassium, sodium and calcium ion concentrations, the ageing time period of the Cu 2+ - Fe(CN) 6 4- - 134 Cs - water system and the bubbling time duration. The results indicate that copper ferrocyanide has a high affinity for caesium and can preferentially co-precipitate it in presence of relatively high amounts of other alkali or alkaline earth cations. For the alkali metals the affinity increases in the order Na < K < Cs. Under the optimal conditions removals higher than 99% could be achieved with any of the tested collectors. The results are discussed in terms of the ion exchange properties of copper ferrocyanide and collector behaviour. Advantages of the coflotation technique over other methods are enumerated. (Auth.)

Synthesis and biological activity of a new class of insecticides: the N-(5-aryl-1,3,4-thiadiazol-2-yl)amides.

Science.gov (United States)

Eckelbarger, Joseph D; Parker, Marshall H; Yap, Maurice Ch; Buysse, Ann M; Babcock, Jonathan M; Hunter, Ricky; Adelfinskaya, Yelena; Samaritoni, Jack G; Garizi, Negar; Trullinger, Tony K

2017-04-01

Optimization studies on a high-throughput screening (HTS) hit led to the discovery of a series of N-(6-arylpyridazin-3-yl)amides with insecticidal activity. It was hypothesized that the isosteric replacement of the pyridazine ring with a 1,3,4-thiadiazole ring could lead to more potent biological activity and/or a broader sap-feeding pest spectrum. The resulting N-(5-aryl-1,3,4-thiadiazol-2-yl)amides were explored as a new class of insecticides. Several methods for 2-amino-1,3,4-thiadiazole synthesis were used for the preparation of key synthetic intermediates. Subsequent coupling to variously substituted carboxylic acid building blocks furnished the final targets, which were tested for insecticidal activity against susceptible strains of Aphis gossypii (Glover) (cotton aphid), Myzus persicae (Sulzer) (green peach aphid) and Bemisia tabaci (Gennadius) (sweetpotato whitefly). Structure-activity relationship (SAR) studies on both the amide tail and the aryl A-ring of novel N-(5-aryl-1,3,4-thiadiazol-2-yl)amides led to a new class of insecticidal molecules active against sap-feeding insect pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Diversity oriented high-throughput screening of 1,3,4-oxadiazole modified chlorophenylureas and halogenobenzamides by HPLC with peptidomimetic calixarene-bonded stationary phases.

Science.gov (United States)

Bazylak, Grzegorz; Malak, Anna; Ali, Imran; Borowiak, Teresa; Dutkiewicz, Grzegorz

2008-06-01

Retention profiles in series of the neutral and highly hydrophobic 1,3,4-oxadiazoles containing chlorophenylurea and halogenobenzamide moiety and indicating analgesic activity were determined in the isocratic standard- and narrow-bore HPLC systems employing, respectively, various octadecylsilica and different calixarene bonded stationary phases. When acetonitrile - 2.65 mM phosphoric acid (55 : 45, %, v/v), pH* 3.25, mobile phase was applied retention of these compounds increased with decline of their overall hydrophobicity according to the general preference of more polar compounds by calixarene cavity in time of its non-specific host-guest supramolecular interactions with halogenated substances. The size of calixarene nanocavity and its upper-rim substitution did not change the observed retention order, resolution and selectivity of separation for oxadiazoles. Compared to the retention on the non-end-capped and the highly-end-capped octadecylsilica HPLC column a most improved separation of some regioisomers of halogenated 1,3,4-oxadiazoles were observed on both used calixarene-type HPLC supports. In addition, preliminary data on the self-assembled supramolecular crystal structure of exemplary 1,3,4-oxadiazolchlorophenylurea with cis-elongated conformation was reported and formation of the monovalent inclusion host-guest complexes between 1,3,4-oxadiazoles and each calixarene-type stationary phase was studied with molecular modelling MM+ and AM1 methods. The structural, isomeric and energetic factors leading to the hydrogen bond stabilized inclusion complexes between these species were considered and used for explanation of observed retention sequence and selectivity of 1,3,4-oxadiazoles separation in applied calixarene-based HPLC systems. All these data would be useful in future development of optimized procedures enabling encapsulation of 1,3,4-oxadiazolurea-type drugs with calixarenes.

Uptake and release of {sup 134} Cs and {sup 137} Cs and iTs relation to {sup 40} K concentration in rats

Energy Technology Data Exchange (ETDEWEB)

Essa, M W.A.; Hussein, H H.M.; Abdelfattah, A T; Abdelbaky, W M [Nuclear research Center, Atomic Energy Authority, Cairo (Egypt)

1997-12-31

Studies were performed to examine the effect of a accumulation of {sup 134} Cs and Cs-137 on the concentration of K-40 in white rats. Five male and five female rats were fed with normal diet for four weeks. After that, the ten rats were fed with macaroni contaminated with Cs-134 (116 Bq/kg) and Cs-137 (318 Bq/kg) besides the normal diet. Animal whole body counting was done once weekly for four months using HPGe and multichannel analyzer. The results should that the uptake of cesium increases until saturation was reached after about one month to values 60,65 Bq/kg for Cs-134, and 200,240 Bq/kg for Cs-137. Results show a decrease in k-40 concentration due to the replacement of potassium ions by cesium ions in the cell. After saturation, feeding with radioactive diet was replaced by normal diet. A release of Cs-134 and Cs-137 was noticed with increase of K-40 concentration. 6 figs., 2 tabs.

19 CFR 134.47 - Souvenirs and articles marked with trademarks or trade names.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Souvenirs and articles marked with trademarks or... Imported Articles § 134.47 Souvenirs and articles marked with trademarks or trade names. When as part of a trademark or trade name or as part of a souvenir marking, the name of a location in the United States or...

Pharmacokinetics of labelled compounds with technetium-99m and samarium-153; Farmacocinetica de compuestos marcados con tecnecio-99m y samario-153

Energy Technology Data Exchange (ETDEWEB)

Borda O, L B; Torres L, M N

1997-07-01

The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa.

Chimeric HCMV/HSV-1 and Δγ134.5 oncolytic herpes simplex virus elicit immune mediated antigliomal effect and antitumor memory

Directory of Open Access Journals (Sweden)

Mohammed G. Ghonime

2018-02-01

Full Text Available Malignant gliomas are the most common primary brain tumor and are characterized by rapid and highly invasive growth. Because of their poor prognosis, new therapeutic strategies are needed. Oncolytic virotherapy (OV is a promising strategy for treating cancer that incorporates both direct viral replication mediated and immune mediated mechanisms to kill tumor cells. C134 is a next generation Δγ134.5 oHSV-1 with improved intratumoral viral replication. It remains safe in the CNS environment by inducing early IFN signaling which restricts its replication in non-malignant cells. We sought to identify how C134 performed in an immunocompetent tumor model that restricts its replication advantage over first generation viruses. To achieve this we identified tumors that have intact IFN signaling responses that restrict C134 and first generation virus replication similarly. Our results show that both viruses elicit a T cell mediated anti-tumor effect and improved animal survival but that subtle difference exist between the viruses effect on median survival despite equivalent in vivo viral replication. To further investigate this we examined the anti-tumor activity in immunodeficient mice and in syngeneic models with re-challenge. These studies show that the T cell response is integral to C134 replication independent anti-tumor response and that OV therapy elicits a durable and circulating anti-tumor memory. The studies also show that repeated intratumoral administration can extend both OV anti-tumor effects and induce durable anti-tumor memory that is superior to tumor antigen exposure alone.

Spatial variation in low-level 134Cs in the coastal sediments off central Honshu in the Sea of Japan. Implications for delivery, migration, and redistribution patterns

International Nuclear Information System (INIS)

Inoue, Mutsuo; Uemura, H.; Kofuji, H.; Shirotani, Y.; Nagao, S.; Fujimoto, K.; Takata, H.; Kudo, N.

2017-01-01

In 2014 and 2015, we examined the spatial distribution of cesium-134 (half-life: 2.06 years) from the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) in marine sediments within coastal-basin areas (water depths of 40-520 m) off central Honshu Island (the main island of Japan) in the Sea of Japan. The 134 Cs concentrations in both the surface sediment (0-1 cm depth) and whole-core inventory exhibited wide variations, and were highest at the site closest to the Agano River Estuary area (6.7 Bq/kg-dry and 886 Bq/m 2 , respectively). This indicates that 134 Cs in coastal areas was delivered by riverine suspended solids (SS). Given the spatial variation in 134 Cs concentrations, we believe that 134 Cs partially migrated northeastward within ∼50 km along Honshu Island (at water depths shallower than ∼140 m), and southwestward, including the Sado Basin area. This is predominantly attributable to the transport of SS by bottom currents and unsteady downward delivery onto the steep slopes of the basin. The total amount of 134 Cs in the study area in 2014 was estimated at approximately 0.6 TBq (decay-corrected to March 11, 2011, date of FDNPP accident). (author)

YNL134C from Saccharomyces cerevisiae encodes a novel protein with aldehyde reductase activity for detoxification of furfural derived from lignocellulosic biomass.

Science.gov (United States)

Zhao, Xianxian; Tang, Juan; Wang, Xu; Yang, Ruoheng; Zhang, Xiaoping; Gu, Yunfu; Li, Xi; Ma, Menggen

2015-05-01

Furfural and 5-hydroxymethylfurfural (HMF) are the two main aldehyde compounds derived from pentoses and hexoses, respectively, during lignocellulosic biomass pretreatment. These two compounds inhibit microbial growth and interfere with subsequent alcohol fermentation. Saccharomyces cerevisiae has the in situ ability to detoxify furfural and HMF to the less toxic 2-furanmethanol (FM) and furan-2,5-dimethanol (FDM), respectively. Herein, we report that an uncharacterized gene, YNL134C, was highly up-regulated under furfural or HMF stress and Yap1p and Msn2/4p transcription factors likely controlled its up-regulated expression. Enzyme activity assays showed that YNL134C is an NADH-dependent aldehyde reductase, which plays a role in detoxification of furfural to FM. However, no NADH- or NADPH-dependent enzyme activity was observed for detoxification of HMF to FDM. This enzyme did not catalyse the reverse reaction of FM to furfural or FDM to HMF. Further studies showed that YNL134C is a broad-substrate aldehyde reductase, which can reduce multiple aldehydes to their corresponding alcohols. Although YNL134C is grouped into the quinone oxidoreductase family, no quinone reductase activity was observed using 1,2-naphthoquinone or 9,10-phenanthrenequinone as a substrate, and phylogenetic analysis indicates that it is genetically distant to quinone reductases. Proteins similar to YNL134C in sequence from S. cerevisiae and other microorganisms were phylogenetically analysed. Copyright © 2015 John Wiley & Sons, Ltd.

Endogenous PTH deficiency impairs fracture healing and impedes the fracture-healing efficacy of exogenous PTH(1-34.

Directory of Open Access Journals (Sweden)

Yongxin Ren

Full Text Available Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH.Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth(-/- mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg for 1-4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth(-/- mice compared to vehicle-treated wild-type and Pth(-/- mice.Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing.

Endogenous PTH deficiency impairs fracture healing and impedes the fracture-healing efficacy of exogenous PTH(1-34).

Science.gov (United States)

Ren, Yongxin; Liu, Bo; Feng, Yuxu; Shu, Lei; Cao, Xiaojian; Karaplis, Andrew; Goltzman, David; Miao, Dengshun

2011-01-01

Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s) whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH. Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth(-/-)) mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg) for 1-4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth(-/-) mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth(-/-) mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth(-/-) mice compared to vehicle-treated wild-type and Pth(-/-) mice. Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing.

Isosteric heats of adsorption extracted from experiments of ethanol and HFC 134a on carbon based adsorbents

Energy Technology Data Exchange (ETDEWEB)

El-Sharkawy, Ibrahim I.; Saha, Bidyut B.; Koyama, Shigeru [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, Kasuga-koen 6-1, Kasuga-shi, Fukuoka 816-8580 (Japan); Srinivasan, Kandadai [School of Engineering and Logistics, Charles Darwin University, Darwin NT 0909 (Australia)

2007-03-15

The purpose of this paper is to provide empirical correlations for isosteric heats of adsorption on carbon based adsorbents for two refrigerants namely ethanol and HFC 134a. A non-dimensional correlation which partitions the contributions of the concentration and temperature dependence is proposed. The correlation is tested out against data obtained from experimental isotherms of ethanol adsorption on activated carbon fibers [ACF (A-20) and ACF (A-15)] and HFC 134a on two specimens of activated carbon powders and one specimen of carbon granules. It is expected that the suggested correlation will be useful for designers of adsorption chillers where indenting heat inventories fulcrums on the magnitude of isosteric heat of adsorption. (author)

The epigraphic tradition at Labraunda seen in the light of Labraunda inscription no. 134

DEFF Research Database (Denmark)

Isager, Signe

2008-01-01

An important new inscription was discovered in the sanctuary of Zeus Labraundos in 2002. The inscription belongs to the so-called Olympichos file, and together with I. Labraunda no. 49 it is now numbered I. Labraunda no. 134. The inscription has just been published by Lars Karlsson and Signe Isager...

Emissions of CO2, CO, NOx, HC, PM, HFC-134a, N2O and CH4 from the global light duty vehicle fleet

Directory of Open Access Journals (Sweden)

Timothy J. Wallington

2008-04-01

Full Text Available Vehicles emit carbon dioxide (CO2, carbon monoxide (CO, nitrogen oxides (NOx, hydrocarbons (HC, particulate matter (PM, hydrofluorocarbon 134a (HFC-134a, methane (CH4, and nitrous oxide (N2O. An understanding of these emissions is needed in discussions of climate change and local air pollution issues. To facilitate such discussions an overview of past, present, and likely future emissions from light duty vehicles is presented. Emission control technologies have reduced the emissions of CO, VOCs, PM, HFC-134a, CH4, and N2O from modern vehicles to very low levels.

Performance characteristics of low global warming potential R134a alternative refrigerants in ejector-expansion refrigeration system

Directory of Open Access Journals (Sweden)

Mishra Shubham

2016-12-01

Full Text Available Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%, which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle. Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.

Performance characteristics of low global warming potential R134a alternative refrigerants in ejector-expansion refrigeration system

Science.gov (United States)

Mishra, Shubham; Sarkar, Jahar

2016-12-01

Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene) is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP) for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%), which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle). Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.

Modulation of notch signaling pathway to prevent H2O2/menadione-induced SK-N-MC cells death by EUK134.

Science.gov (United States)

Kamarehei, Maryam; Yazdanparast, Razieh

2014-10-01

The brain in Alzheimer's disease is under increased oxidative stress, and this may have a role in the pathogenesis and neural death in this disorder. It has been verified that numerous signaling pathways involved in neurodegenerative disorders are activated in response to reactive oxygen species (ROS). EUK134, a synthetic salen-manganese antioxidant complex, has been found to possess many interesting pharmacological activities awaiting exploration. The present study is to characterize the role of Notch signaling in apoptotic cell death of SK-N-MC cells. The cells were treated with hydrogen peroxide (H2O2) or menadione to induce oxidative stress. The free-radical scavenging capabilities of EUK134 were studied through the MTT assay, glutathione peroxidase (GPx) enzyme activity assay, and glutathione (GSH) Levels. The extents of lipid peroxidation, protein carbonyl formation, and intracellular ROS levels, as markers of oxidative stress, were also studied. Our results showed that H2O2/menadione reduced GSH levels and GPx activity. However, EUK134 protected cells against ROS-induced cell death by down-regulation of lipid peroxidation and protein carbonyl formation as well as restoration of antioxidant enzymes activity. ROS induced apoptosis and increased NICD and HES1 expression. Inhibition of NICD production proved that Notch signaling is involved in apoptosis through p53 activation. Moreover, H2O2/menadione led to Numb protein down-regulation which upon EUK134 pretreatment, its level increased and subsequently prevented Notch pathway activation. We indicated that EUK134 can be a promising candidate in designing natural-based drugs for ROS-induced neurodegenerative diseases. Collectively, ROS activated Notch signaling in SK-N-MC cells leading to cell apoptosis.

Isothermal (vapour + liquid) equilibrium for the binary {l_brace}1,1,2,2-tetrafluoroethane (R134) + propane (R290){r_brace} and {l_brace}1,1,2,2-tetrafluoroethane (R134) + isobutane (R600a){r_brace} systems

Energy Technology Data Exchange (ETDEWEB)

Dong Xueqiang [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Gong Maoqiong, E-mail: gongmq@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Liu Junsheng [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Wu Jianfeng, E-mail: jfwu@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China)

2010-09-15

(Vapour + liquid) equilibrium (VLE) data for the binary systems of {l_brace}1,1,2,2-tetrafluoroethane (R134) + propane (R290){r_brace} and {l_brace}1,1,2,2-tetrafluoroethane (R134) + isobutane (R600a){r_brace} were measured with a recirculation method at the temperatures ranging from (263.15 to 278.15) K and (268.15 to 288.15) K, respectively. All of the data were correlated by the Peng-Robinson (PR) equation of state (EoS) with the Huron-Vidal (HV) mixing rules utilizing the non-random two-liquid (NRTL) activity coefficient model. Good agreement can be found between the experimental data and the correlated results. Azeotropic behaviour can be found at the measured temperature ranges for these two mixtures.

Engraftment and bone mass are enhanced by PTHrP 1-34 in ectopically transplanted vertebrae (vossicle model) and can be non-invasively monitored with bioluminescence and fluorescence imaging.

Science.gov (United States)

Hildreth, Blake Eason; Williams, Michelle M; Dembek, Katarzyna A; Hernon, Krista M; Rosol, Thomas J; Toribio, Ramiro E

2015-12-01

Evidence exists that parathyroid hormone-related protein (PTHrP) 1-34 may be more anabolic in bone than parathyroid hormone 1-34. While optical imaging is growing in popularity, scant information exists on the relationships between traditional bone imaging and histology and bioluminescence (BLI) and fluorescence (FLI) imaging. We aimed to evaluate the effects of PTHrP 1-34 on bone mass and determine if relationships existed between radiographic and histologic findings in bone and BLI and FLI indices. Vertebrae (vossicles) from mice coexpressing luciferase and green fluorescent protein were implanted subcutaneously into allogenic nude mice. Transplant recipients were treated daily with saline or PTHrP 1-34 for 4 weeks. BLI, FLI, radiography, histology, and µCT of the vossicles were performed over time. PTHrP 1-34 increased bioluminescence the most after 2 weeks, fluorescence at all time points, and decreased the time to peak bioluminescence at 4 weeks (P ≤ 0.027), the latter of which suggesting enhanced engraftment. PTHrP 1-34 maximized vertebral body volume at 4 weeks (P bone observed histologically increased in both groups at 2 and 4 weeks (P ≤ 0.002); however, PTHrP 1-34 exceeded time-matched controls (P ≤ 0.044). A positive linear relationship existed between the percentage of trabecular bone and (1) total bioluminescence (r = 0.595; P = 0.019); (2) total fluorescence (r = 0.474; P = 0.074); and (3) max fluorescence (r = 0.587; P = 0.021). In conclusion, PTHrP 1-34 enhances engraftment and bone mass, which can be monitored non-invasively by BLI and FLI.

{sup 134}Cs uptake by four plant species and Cs-K relations in the soil-plant system as affected by Ca(OH){sub 2} application to an acid soil

Energy Technology Data Exchange (ETDEWEB)

Massas, I., E-mail: massas@aua.g [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece); Skarlou, V.; Haidouti, C.; Giannakopoulou, F. [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece)

2010-03-15

Three rates of Ca(OH){sub 2} were applied to an acid soil and the {sup 134}Cs uptake by radish, cucumber, soybean and sunflower plants was studied. The {sup 134}Cs concentration in all plant species was reduced from 1.6-fold in the sunflower seeds to 6-fold in the soybean vegetative parts at the higher Ca(OH){sub 2} rate. Potassium (K) concentration in plants was also reduced, but less effectively. The significantly decreased {sup 134}Cs-K soil to plant distribution factors (D.F.) clearly suggest a stronger effect of soil liming on {sup 134}Cs than on K plant uptake. This observation was discussed in terms of ionic interactions in the soil matrix and within the plants. The results also indicated that the increased Ca{sup 2+} concentration in the exchange phase and in the soil solution along with the improved root activity, due to the soil liming, enhanced the immobilization of {sup 134}Cs in the soil matrix and consequently lowered the {sup 134}Cs availability for plant uptake.

Excited state luminescence of multi-(5-phenyl-1,3,4-oxadiazo-2-yl)benzenes in an electron-donating matrix: exciplex or electroplex?

Science.gov (United States)

Yang, Chih-Chiang; Hsu, Chia-Jung; Chou, Pi-Tai; Cheng, Hsu Chun; Su, Yuhlong Oliver; Leung, Man-kit

2010-01-21

Multi-(5-phenyl-1,3,4-oxadiazo-2-yl)benzenes show emission in organic solvents from ultraviolet to blue (339-447 nm). The reduction potentials E(1/2)(red) cover a large range of -2.11 V for 2,5-diphenyl-1,3,4-oxadiazole to -0.76 V for 1,2,3,4,5,6-hexa(5-phenyl-1,3,4-oxadiazo-2-yl)benzene. An unexpectedly wide spectral range of the oxadiazole (OXD) exciplex emissions in PVK is observed, ranging from 406 to 603 nm. The OXDs also exhibit similar electroluminescence (EL) when blended into polyvinylcarbazole (PVK). A linear correlation between the lambda(max) of the electroluminescence and photoluminescence is observed, implying that the emission mechanisms in both processes are similar. In addition, the linear correlation between the E(1/2)(red) versus lambda(max) of EL (eV) reflected that the term of the charge-transfer configuration of the contact electron-hole pair plays a major role in the exciplex emission. The exciplex EL of 1,2,5-tri(5-phenyl-1,3,4-oxadiazo-2-yl)benzene (5) could be as high as 1.0 cd/A. Since the exciplex emission usually has a large Stokes shift, this provides a window for us to generate duo emissions for near white light EL with high efficiency. Among the devices we tried, the device of PVK/2-tert-butylphenyl-5-biphenyl-1,3,4-oxadiazole/5/2,5,8,11-tetra-tert-butylperylene (100:40:40:4) gave EL with good current efficiency of 1.63 cd/A.

Lifetimes of low-lying states in 132Nd and 134Nd

International Nuclear Information System (INIS)

Kruecken, R.; Mullins, S.M.; Thornley, D.J.; Kirwan, A.J.; Nolan, P.J.; Regan, P.H.; Wadsworth, R.

1995-01-01

Lifetimes of low-lying states have been measured in 132 Nd and 134 Nd using the coincidence-plunger technique. The reaction 32 S+ 105 Pd was used at a bombarding energy of 152 MeV. The measurement has been performed at the NSF Daresbury using the ESSA 30 array. The differential decay-curve method (DDCM) was used to analyze the recoil-distance Doppler-shift (RDDS) data. The experimental B(E2) values in 132 Nd are well described by the predictions of the rotational model and the IBM in the O(6) limit. ((orig.))

Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

Energy Technology Data Exchange (ETDEWEB)

Essman, Stephanie C. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)], E-mail: essmans@missouri.edu; Lewis, Michael R. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri-Columbia, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Fox, Derek B. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)

2008-02-15

Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ({sup 153}Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic {sup 153}Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of {sup 153}Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of {sup 153}Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of {sup 153}Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P<.05. Results: Significant differences in lengths of multiple bones were detected between the high-dose group and other treatment groups and controls at each time interval. A significant difference in lengths of the tibias was also noted in the medium-treatment group, compared to controls. Mean reduction of bone length was first detected at 4 months and did not increase significantly over time. Conclusions: These data suggest that clinically significant bone shortening may occur as a result of high-dosage administration of {sup 153}Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted.

Analysis of the direct contamination pathway of 85Sr, 103Ru and 134Cs in soybean

International Nuclear Information System (INIS)

Yim, K. M.; Park, D. W.; Park, H. K.; Choi, Y. H.; Choi, S. D.; Lee, C. M.

2001-01-01

A solution containing 85 Sr, 103 Cs was sprayed to the aerial part of the soybean plant in a greenhouse at 6 different times before harvest and the direct contamination pathway of the radionuclide analyzed. Plant interception factor showed little difference among radionuclides. The maximum value was 0.93, which was observed at the middle growth stage. Translocation factors 85 Sr, 103 Cs in the soybean seed at harvest were in the range of 4.5x10 -5 ∼2.5x10 -3 , 6.0x10 -5 ∼2.3x10 -4 and 4.5x10 -3 ∼3.0x10 -1 , respectively. They were highest at the 3rd application for 85 Sr and 134 Cs and at the 2nd application for 103 Ru. Translocation factors of 85 Sr and 103 Ru in the soybean shell tended to increase with decreasing time interval between application and harvest but that of 134 Cs was highest at the 2nd application. The fractions of the initial deposition that remained in the soybeam plant at harvest were in the range of 0.14 ∼15.2% for 85 Sr and 103 Ru, 9.9∼41.9% for 134 Cs. These results can be utilized for predicting the radionuclide concentration in mature soybean plant and deciding counter-measures when an accidental deposition of the radionuclides occurs during the growing season of soybean

Loss of Catalytic Activity in the E134D, H67A, and H349A Mutants of DapE: Mechanistic Analysis with QM/MM Investigation.

Science.gov (United States)

Dutta, Debodyuti; Mishra, Sabyashachi

2016-11-17

In the fight against bacterial infections and antibiotic resistance, the dapE-encoded N-succinyl-l,l-diaminopimelic acid desuccinylase (DapE) is a potentially safe target enzyme. The role of the Glu134, His67, and His349 residues in the binding and hydrolysis of N-succinyl-l,l-diaminopimelic acid (SDAP) is investigated by employing molecular dynamics simulation and hybrid quantum mechanical-molecular mechanical (MM) calculations of the E134D, H67A, and H349A mutants of DapE. The free energy of substrate binding obtained from the MM-Poisson-Boltzmann surface area approach correctly reproduced the experimentally observed ordering of substrate affinity, that is, E134D > wt > H67A > H349A. The mechanism of catalytic action by the E134D mutant is elucidated by structurally and energetically characterizing the intermediates and the transition states along the reaction pathway. The rate-determining step in the general acid-base hydrolysis reaction by the E134D mutant is found to be the nucleophilic attack step, which involves an activation energy barrier 10 kcal/mol greater than that in the wild-type (wt)-DapE. This explains the 3 orders of magnitude decrease in the experimentally determined k cat value for the E134D mutant compared to that of wt-DapE. In the H67A and H349A mutants, the Glu134 residue undergoes a conformational change and exhibits a strong coordination with the metal centers. This not only results in a weaker substrate binding in the two histidine mutants but also hinders the activation of the catalytic water molecule, which constitutes the first step of the substrate hydrolysis by DapE. This leads to an effective quenching of the catalytic activity in the H67A and H349A mutants.

Recombinant Adeno-Associated Virus-Mediated microRNA Delivery into the Postnatal Mouse Brain Reveals a Role for miR-134 in Dendritogenesis in Vivo

DEFF Research Database (Denmark)

Christensen, Mette; Larsen, Lars A; Kauppinen, Sakari

2010-01-01

delivery of microRNAs in vivo by use of recombinant adeno-associated virus (rAAV). rAAV-mediated overexpression of miR-134 in neurons of the postnatal mouse brain provided evidence for a negative role of miR-134 in dendritic arborization of cortical layer V pyramidal neurons in vivo, thereby confirming...

Energy and exergy analysis of LPG (liquefied petroleum gas) as a drop in replacement for R134a in domestic refrigerators

International Nuclear Information System (INIS)

El-Morsi, Mohamed

2015-01-01

This study presents a comparison of energetic and exergetic performance of a vapour compression refrigeration system using pure HC (hydrocarbon) refrigerants. In this study, three different pure HCs propane (R290), butane (R600) and commercial LPG (liquefied petroleum gas) are used in the theoretical analysis. R134a is also used in the analysis as a reference refrigerant. The evaporator temperature ranges from −30 to 0 °C while the condenser ranges from 30 to 50 °C. MATLAB software is used for solving the thermodynamic equations, while the thermo-physical properties are calculated using REFPROP software. The results show that R600 has the highest COP c and exergetic efficiency, while LPG has the lowest. When compared to R134a, the COP c for R134a is higher than that for LPG by 10%. Also, the exergetic efficiency is higher by 5%. However, LPG has the advantage of being not expensive, available in large amounts and zero ozone depletion potential and low global warming potential. - Highlights: • The results show that R600 has the highest COP c & exergy efficiency, and the lowest irreversibility. • LPG has the lowest COP c & exergy efficiency, and the highest irreversibility. • Compared to R134a, LPG has a lower COP c and exergy efficiency by an average of 10% and 5%, respectively

Emergence of CD134 cysteine-rich domain 2 (CRD2)-independent strains of feline immunodeficiency virus (FIV) is associated with disease progression in naturally infected cats.

Science.gov (United States)

Bęczkowski, Paweł M; Techakriengkrai, Navapon; Logan, Nicola; McMonagle, Elizabeth; Litster, Annette; Willett, Brian J; Hosie, Margaret J

2014-11-28

Feline immunodeficiency virus (FIV) infection is mediated by sequential interactions with CD134 and CXCR4. Field strains of virus vary in their dependence on cysteine-rich domain 2 (CRD2) of CD134 for infection. Here, we analyse the receptor usage of viral variants in the blood of 39 naturally infected cats, revealing that CRD2-dependent viral variants dominate in early infection, evolving towards CRD2-independence with disease progression. These findings are consistent with a shift in CRD2 of CD134 usage with disease progression.

S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5 ...

African Journals Online (AJOL)

Purpose: To evaluate the antibacterial, enzyme-inhibitory and hemolytic activities of Salkylated/aralkylated 2-(1H-indol-3-ylmethyl)-1,3,4-oxadiazole-5-thiol derivatives. Methods: Antibacterial activities of the compounds were evaluated using broth dilution method in 96 well plates. Enzyme inhibitory activities assays were ...

Slow desensitization of imatinib-induced nonimmediate reactions and dynamic changes of drug-specific CD4+CD25+CD134+ lymphocytes.

Science.gov (United States)

Klaewsongkram, Jettanong; Thantiworasit, Pattarawat; Sodsai, Pimpayao; Buranapraditkun, Supranee; Mongkolpathumrat, Pungjai

2016-11-01

Imatinib is a tyrosine kinase inhibitor indicated for the treatment of gastrointestinal stromal tumors (GISTs) and certain neoplastic diseases; however, nonimmediate adverse reactions are common. To describe the process of imatinib slow desensitization in patients who experienced nonimmediate reactions to imatinib and the dynamic change in drug-specific CD4 + CD25 + CD134 + T-lymphocyte percentages. Five patients diagnosed as having GISTs and with a recent history of imatinib-induced nonimmediate reactions (maculopapular exanthema with eosinophilia, exfoliative dermatitis, palmar-plantar erythrodysesthesia, and drug rash with eosinophilia and systemic symptoms) were desensitized using a slow desensitization protocol. The reintroduced imatinib dosage was stepped up every week starting from 10 mg/d and increasing to 25, 50, 75, 100, 150, 200, and 300 mg/d until the target dose of 400 mg/d was achieved. Prednisolone of up to 30 mg/d was allowed if allergic reactions recurred. The percentages of CD4 + CD25 + CD134 + T cells present after incubating peripheral blood mononuclear cells with imatinib, at baseline and after successful desensitization, were analyzed using flow cytometric analysis. By using a slow desensitization technique, all patients were able to receive 400 mg/d of imatinib, and prednisolone was gradually tapered off. The percentages of imatinib-induced CD4 + CD25 + CD134 + T cells decreased from a mean (SD) of 11.3% (6.5%) and 13.4% (7.3%) at baseline to 3.2% (0.7%) and 3.0% (1.1%) after successful desensitization, when stimulating peripheral blood mononuclear cells with 1 and 2 μM of imatinib, respectively. Slow desensitization is a helpful procedure in treating patients with imatinib-induced nonimmediate reactions other than simple maculopapular exanthema. The reduced percentages of imatinib-induced CD4 + CD25 + CD134 + T cells in these patients may be associated with immune tolerance. Copyright © 2016 American College of Allergy, Asthma & Immunology

Investigation into the conditions under which HFC134a may become flammable.

CSIR Research Space (South Africa)

Kramers, AP

2002-01-01

Full Text Available or approaching 180°C would be associated with an onset of catastrophic conditions such as plant room fires and total mechanical failure of equipment. It is suggested in that the guidelines listed in Section 5.2, pertaining to abnormal plant conditions... /lubricant mixtures can become explosive. The work must therefore consider both normal and abnormal operating conditions to which HFC134a may be exposed to empower machine operators, mine maintenance personnel and contractors to take preventative...

S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5 ...

African Journals Online (AJOL)

ylmethyl)-1,3,4- oxadiazole-5-thiol derivatives. Methods: 2-(1H-indol-3-yl)acetic acid (1) was reacted with absolute ethanol and catalytic amount of sulfuric acid to form ethyl 2-(1H-indol-3-yl)acetate (2) which was transformed to 2-(1H-indol-3- ...

Equation of state and thermmodynamic properties of 1,1,1,2-tetrafluoroethane (refrigerant R134a)

International Nuclear Information System (INIS)

Vas'kov, E.T.

1995-01-01

An equation of state and tables of thermodynamic properties of R134a in the saturation state and in the one-phase region are obtained in the temperature interval 320-500 K at pressures ranging from 0.01 to 7.5 MPa

Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase.

Science.gov (United States)

Li, Qunrui; Metthew Lam, L K; Xun, Luying

2011-11-01

Ethanol is a renewable biofuel, and it can be produced from lignocellulosic biomass. The biomass is usually converted to hydrolysates that consist of sugar and sugar derivatives, such as furfural. Yeast ferments sugar to ethanol, but furfural higher than 3 mM is inhibitory. It can take several days for yeast cells to reduce furfural to non-inhibitory furfuryl alcohol before producing ethanol. Bioreduction of furfural to furfuryl alcohol before fermentation may relieve yeast from furfural toxicity. We observed that Cupriavidus necator JMP134, a strict aerobe, rapidly reduced 17 mM furfural to less than 3 mM within 14 min with cell turbidity of 1.0 at 600 nm at 50°C. The rapid reduction consumed ethanol. The "furfural reductase" (FurX) was purified, and it oxidized ethanol to acetaldehyde and reduced furfural to furfuryl alcohol with NAD(+) as the cofactor. The protein was identified with mass spectrometry fingerprinting to be a hypothetical protein belonging to Zn-dependent alcohol dehydrogenase family. The furX-inactivation mutant of C. necator JMP134 lost the ability to rapidly reduce furfural, and Escherichia coli producing recombinant FurX gained the ability. Thus, an alcohol dehydrogenase enabled bacteria to rapidly reduce furfural with ethanol as the reducing power.

Design and synthesis of novel HDAC8 inhibitory 2,5-disubstituted-1,3,4-oxadiazoles containing glycine and alanine hybrids with anti cancer activity.

Science.gov (United States)

Pidugu, Vijaya Rao; Yarla, Nagendra Sastry; Pedada, Srinivasa Rao; Kalle, Arunasree M; Satya, A Krishna

2016-11-01

Oxadiazole is a heterocyclic compound containing an oxygen atom and two nitrogen atoms in a five-membered ring. Of the four oxadiazoles known, 1,3,4-oxadiazole has become an important structural motif for the development of new drugs and the compounds containing 1,3,4-oxadiazole cores have a broad spectrum of biological activity. Herein, we describe the design, synthesis and biological evaluation of a series of novel 2,5-disubstituted 1,3,4-oxadiazoles (10a-10j) as class I histone deacetylase (HDAC) inhibitors. The compounds were designed and evaluated for HDAC8 selectivity using in silico docking software (Glide) and the top 10 compounds with high dock score and obeying Lipinski's rule were synthesized organically. Further the biological HDAC inhibitory and selectivity assays and anti-proliferative assays were carried out. In in silico and in vitro studies, all compounds (10a-10j) showed significant HDAC inhibition and exhibited HDAC8 selectivity. Among all tested compounds, 10b showed substantial HDAC8 inhibitory activity and better anticancer activity which is comparable to the positive control, a FDA approved drug, vorinostat (SAHA). Structural activity relation is discussed with various substitutions in the benzene ring connected on 1,3,4-oxadizole and glycine/alanine. The study warranted further investigations to develop HDAC8-selective inhibitory molecule as a drug for neoplastic diseases. Novel 1,3,4-oxadizole substituted with glycine/alanine showed HDAC8 inhibition. Copyright © 2016 Elsevier Ltd. All rights reserved.

134cs uptake by plants from soil applying different absorbents

International Nuclear Information System (INIS)

Oncsik, M.

1998-01-01

A study of isotope uptake by plants using different zeolite clay minerals (montmorillonite, mordenite, clinoptilolite) was started with a view to reducing the rate of isotope uptake by plants by applying additives given to the soil. In pot experiments, the 134 Cs activity of green peas was reduced by 16% in average as compared to the control in the soils enriched with zeolite (mordenite type). Under field conditions, the radioactivity of millet and carrot yields were investigated in soils ameliorated with montmorillonite clay mineral. The radioactive contamination of the yield in soil treated with zeolite was in average 10% lower for millet and 24% for carrot roots as compared to the control

Cellular effects and delivery propensity of penetratin is influenced by conjugation to parathyroid hormone fragment 1-34 in synergy with pH

DEFF Research Database (Denmark)

Kristensen, Mie; Nielsen, Line Hagner; Zor, Kinga

2018-01-01

The cell-penetrating peptide (CPP) penetratin, has demonstrated potential as a carrier for transepithelial delivery of cargo peptides, such as the therapeutically relevant part of parathyroid hormone, i.e. PTH(1-34). The purpose of the present study was to elucidate the relevance of modifying the pH...... evaluated by using the Real-Time-GLO assay as well as by microscopy following Tryphan blue staining. Morphological Caco-2 cell changes were studied exploiting the impedance-based xCELLigence system as well as optically using the oCelloscope setup. Finally, the effect of pH on the folding propensity...... the conjugation approach, the PTH(1-34) permeation was significantly enhanced by lowering the pH from 7.4 to 5, but also associated with a compromised barrier and a lowering of the cellular viability. The negative effects on the cellular viability following cellular incubation with the PTH(1-34)-penetratin...

Studies of radioactivity of vegetables: determination of transfer factors 85Sr and 134Cs in some vegetables

International Nuclear Information System (INIS)

Oncsik, M.B.

1999-01-01

The radioisotope uptake of potato and culinary dry bean was studied in field experiments on meadow soil enriched with vermiculite and humanite by artificial soil contamination. The isotope uptake from the soil was characterized by a transfer factor (TF). Based on the results of the potato experiment it was found that the TF value characterizing the 134 Cs contamination of the crop, changed between 1.31 - 0.77*10 -4 m 2 (kg dry matter) -1 on high humus content soil (treated with humanite) and on soil treated with vermiculite, while it was 22-45 % higher in plants grown on the radioactive control plots. lt was 1.69*10 -4 m 2 (kg dry matter)2 -1 in average. The TF values of 85 Sr uptake of potato are several times higher than those of experiments treated by isotope 134 Cs. The TF values fluctuated between 5.30-7.33*10 -4 m 2 (kg dry matter) -1 in soils treated with the additives, while on the plots with radioactive contamination it was 8.42*10 -4 m 2 (kg dry matter) -1 . Based on the results of 134 Cs studies of edible part of dry bean, it could be stated that after the soil contamination the TF value was 0.99*10 -4 m 2 (kg dry matter) -1 in average. According to the activity results of the experiments there was significant difference between the contamination of the plant parts. Refs. 6 (author)

Determination of distribution ratio for 60Co, 85Sr and 134Cs in loess medium

International Nuclear Information System (INIS)

Tanaka, Tadao; Ogawa, Hiromichi; Zhentang Li; Hui Wang; Kamiyama, Hideo.

1994-06-01

Distribution ratio R for 60 Co, 85 Sr and 134 Cs between loess and ground water was measured by using 16 loess samples taken from the field test site of China Institute for Radiation Protection, in which the field test of radionuclide migration had been performed. The R of each radionuclide was taken nearly constant value among 16 samples. This revealed that the site can be regarded as uniform loess medium from the view point of sorption ability. The sorption ability between the three radionuclides was the order of 134 Cs > 60 Co >> 85 Sr. The 85 Sr was an available nuclide for examining the migration phenomena, because 85 Sr might easily migrate in the loess medium due to its low sorption ability. The results of parametric check suggested that it is necessary to select the valid temperature and pH for determining the R value. The sorption of Sr on the loess was dominated by reversible ion-exchange reaction, while that of Co and Cs was dominated by irreversible one. (author)

Immobilization of styrene-substituted 1,3,4-oxadiazoles into thermoreversible luminescent organogels and their unexpected photocatalyzed rearrangement.

Science.gov (United States)

Dumur, Frédéric; Contal, Emmanuel; Wantz, Guillaume; Phan, Trang N T; Bertin, Denis; Gigmes, Didier

2013-01-21

A series of styrene-substituted 1,3,4-oxadiazoles has been designed and investigated as new low-molecular-weight organogelators. The photophysical properties of the resulting thermoreversible organogels have been characterized by UV/Vis absorption and luminescence spectroscopies. Surprisingly, the gelation ability of the oxadiazoles depended on the presence of the styrene moiety as gelation of the investigated oxadiazoles did not take place in its absence. Gel formation was accompanied by a modification of the fluorescence of the organogelators in the supramolecular state. UV irradiation of the gels caused a rearrangement of the immobilized 1,3,4-oxadiazoles bearing a styrene moiety by a tandem [4+2] and [3+2] cascade reaction. Structure modification and color change of the gels were also evident upon irradiation. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

2-Isobutyl-6-(4-methoxyphenylimidazo[2,1-b][1,3,4]thiadiazole

Directory of Open Access Journals (Sweden)

Hoong-Kun Fun

2011-02-01

Full Text Available In the title compound, C15H17N3OS, the dihedral angle between the statistically planar imidazo[2,1-b][1,3,4]thiadiazole fused-ring system (r.m.s. deviation = 0.002 Å and the methyoxbenzene ring is 4.52 (6°. In the crystal, molecules are arranged into columns and stacked down the a axis. The crystal structure is stabilized by weak C—H...π and π–π interactions [centroid–centroid separations = 3.6053 (8 and 3.7088 (7 Å].

NEW DERIVATIVES OF 2-R1-N-(5-R-1,3,4-THIADIAZOL-2-YL-BENZOLSULFONAMIDES: SYNTHESIS, PHYSICOCHEMICAL PROPERTIES AND BIOLOGICAL ACTIVITY PREDICTION

Directory of Open Access Journals (Sweden)

Sych I.V.

2015-12-01

Full Text Available Introduction: The analysis of modern literature, including overseas one, showed that a lot of the scientific researches is devoted to finding and creating biologically active compounds on base 1,3,4-thiadiazole. Derivatives of 1,3,4-thiadiazole are the large group of heterocyclic compounds with high rates of antimicrobial, antituberculosis, antidiabetic, antineoplastic and anticonvulsant activity. Material and methods: The purpose of this study was the expansion of sulfone derivatives substituted nitrogen-containing heterocyclic systems through the synthesis of 2-R1-N (5-R-1,3,4-thiadiazol-2-ilbenzolsulfonamides and prediction their pharmacological activity for future planning pharmacological screening. Synthesis of semi-products 2-amino-5-R-1,3,4-thiadiazoles was carried out by cyclization thiosemicarbazide and substituted derivatives of carboxylic acids in the presence of concentrated sulfuric acid. The synthesis of target compounds 2-R1-N(5-R-1,3,4-thiadiazol-2-ylbenzolsulfon-amides was carried out by N-acylation of 2-amino-5R-1,3,4-thiadiazole substituted benzolsul-fochlorides in the presence of anhydrous pyridine. The reaction proceeds by the classic SN2-mechanism. The resulting compounds are white crystalline substances, soluble in alcohol, chloroform and acetone, difficult to dissolve in water. Yields of obtained compounds was satisfactory (76-84%. The purity of the obtained compounds was determined by TLC. The structure of the obtained compounds was proved by elemental analysis, IR methods and 1H NMR spectroscopy. NMR 1H spectra were recorded at Bruker WM spectrometer (200 MHz; solvent DMSO-d6; chemical shifts were in ppm, internal standard (TMS (tetramethylsilane was used. The prognosis of biological activity for obtained compounds were carried out using the program PASS (Prediction of Activity Spectra for Substances in order to plan the further pharmacological screening. The program PASS predicts more than 500 kinds of biological

A Combined Synthetic and DFT Study on the Catalyst-Free and Solvent-Assisted Synthesis of 1,3,4-Oxadiazole-2-thiol Derivatives

Directory of Open Access Journals (Sweden)

Mohammad Soleiman-Beigi

2013-01-01

Full Text Available A novel practical and efficient catalyst-free method for the synthesis of 5-substituted 1,3,4-oxadiazole-2-thiols has been developed, which is assisted by reaction solvent (DMF. The solvent effects on product selectivity were studied based on Onsager’s reaction field theory of electrostatic solvation. The ab initio theoretical studies on the effect of solvents on the process also supported the suitability of DMF as the reaction medium for the preparation of 1,3,4-oxadiazole-2-thiol derivatives.

Synthesis, crystal structures, fluorescence and xanthine oxidase inhibitory activity of pyrazole-based 1,3,4-oxadiazole derivatives

Science.gov (United States)

Qi, De-Qiang; Yu, Chuan-Ming; You, Jin-Zong; Yang, Guang-Hui; Wang, Xue-Jie; Zhang, Yi-Ping

2015-11-01

A series of pyrazole-based 1,3,4-oxadiazole derivatives were rationally designed and synthesized in good yields by following a convenient route. All the newly synthesized molecules were fully characterized by IR, 1H NMR and elemental analysis. Eight compounds were structurally determined by single crystal X-ray diffraction analysis. The fluorescence properties of all the compounds were investigated in dimethyl sulfoxide media. In addition, these newly synthesized compounds were evaluated for in vitro inhibitory activity against commercial enzyme xanthine oxidase (XO) by measuring the formation of uric acid from xanthine. Among the compounds synthesized and tested, 3d and 3e were found to be moderate inhibitory activity against commercial XO with IC50 = 72.4 μM and 75.6 μM. The studies gave a new insight in further optimization of pyrazole-based 1,3,4-oxadiazole derivatives with excellent fluorescence properties and XO inhibitory activity.

Double beta decay searches of 134Xe, 126Xe and 124Xe with large scale Xe detectors

International Nuclear Information System (INIS)

Barros, N; Thurn, J; Zuber, K

2014-01-01

The sensitivity for double beta decay studies of 134 Xe and 124 Xe is investigated assuming a potential large scale Xe experiment developed for dark matter searches depleted in 136 Xe. The opportunity for an observation of the 2νββ - decay of 134 Xe is explored for various scenarios. A positive observation should be possible for all calculated nuclear matrix elements. The detection of 2ν ECEC of 124 Xe can be probed in all scenarios covering the theoretical predicted half-life uncertainties and a potential search for 126 Xe is discussed. The sensitivity to β + EC decay of 124 Xe is discussed and a positive observation might be possible, while β + β + decay still remains unobservable. The performed studies take into account solar pp–neutrino interactions, 85 Kr beta decay and remaining 136 Xe double beta decay as background components in the depleted detector. (paper)

Trichloroethylene degradation by two independent aromatic-degrading pathways in Alcaligenes eutrophus JMP134.

OpenAIRE

Harker, A R; Kim, Y

1990-01-01

The bacterium Alcaligenes eutrophus JMP134(pJP4) degrades trichloroethylene (TCE) by a chromosomal phenol-dependent pathway and by the plasmid-encoded 2,4-dichlorophenoxyacetic acid pathway. The two pathways were independent and exhibited different rates of removal and capacities for quantity of TCE removed. The phenol-dependent pathway was more rapid (0.2 versus 0.06 nmol of TCE removed per min per mg of protein) and consumed all detectable TCE. The 2,4-dichlorophenoxyacetic acid-dependent p...

Synthesis and Anticancer Activity of New 1-Thia-4-azaspiro[4.5]decane, Their Derived Thiazolopyrimidine and 1,3,4-Thiadiazole Thioglycosides

Directory of Open Access Journals (Sweden)

Eman M. Flefel

2017-01-01

Full Text Available New 1-thia-azaspiro[4.5]decane derivatives, their derived thiazolopyrimidine and 1,3,4-thiadiazole compounds were synthesized. The thioglycoside derivatives of the synthesized (1,3,4-thiadiazolylthiaazaspiro[4.5]decane and thiazolopyrimidinethione compounds were synthesized by glycosylation reactions using acetylated glycosyl bromides. The anticancer activity of synthesized compounds was studied against the cell culture of HepG-2 (human liver hepatocellular carcinoma, PC-3 (human prostate adenocarcinoma and HCT116 (human colorectal carcinoma cell lines and a number of compounds showed moderate to high inhibition activities.

Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

Directory of Open Access Journals (Sweden)

J. Kameník

2013-09-01

Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m–3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m–3 were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m–3 (Station Aloha, 18 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m–3, and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

Energy Technology Data Exchange (ETDEWEB)

Kamenik, J.; Dulaiova, H. [Hawaii Univ., Manoa, Honolulu, HI (United States). Dept. of Geology and Geophysics; Buesseler, K.O.; Pike, S.M. [Woods Hole Oceanographic Institution, Woods Hole, MA (United States). Dept. of Marine Chemistry and Geochemistry; St' astna, K. [Czech Technical Univ., Prague (Czech Republic). Dept. of Nuclear Chemistry

2013-07-01

Surface seawater {sup 134}Cs and {sup 137}Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable {sup 134}Cs values that were impacted by Fukushima releases. Between March and May 2011, {sup 134}Cs was not detected around the Hawaiian Islands and Guam. Here, most {sup 137}Cs activities (1.2-1.5 Bq m{sup -3}) were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6-1.8 Bq m{sup -3}) were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m{sup -3} (Station Aloha, 18 values). In contrast, samples collected between Japan and Hawaii contained {sup 134}Cs activities in the range of 1-4 Bq m{sup -3}, and {sup 137}Cs levels were about 2-3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

Closure Report for Corrective Action Unit 134: Aboveground Storage Tanks, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2009-01-01

Corrective Action Unit (CAU) 134 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Aboveground Storage Tanks' and consists of the following four Corrective Action Sites (CASs), located in Areas 3, 15, and 29 of the Nevada Test Site: (1) CAS 03-01-03, Aboveground Storage Tank; (2) CAS 03-01-04, Tank; (3) CAS 15-01-05, Aboveground Storage Tank; and (4) CAS 29-01-01, Hydrocarbon Stain

Abatement of CFC emissions in air conditioning and refrigerating technology. Partial project 9. Minderung von FCKW-Emissionen in der Klima- und Kaeltetechnik. Teilvorhaben 9; Bestimmung thermodynamischer Eigenschaften des Gemisches R 152a - R 134a. Schlussbericht

Energy Technology Data Exchange (ETDEWEB)

1991-01-01

There are two ozone-neutral materials that could substitute the strongly ozone-destructive refrigerant R12, namely 1,1 difluoroethane (R152a) and 1,1,1,2 tetrafluoroethane (R134a). R152a has excellent thermodynamic and energetic properties. It is innocuous and easy to produce. Its great drawback is its inflammability due to the four hydrogen atoms per molecule. R134a is chemically inert and non-flammable, but its mixing behaviour with refrigerating oils poses problems. Idealised refrigeration processes using R134a show somewhat lower performance data than these using R128 so R134a would be expected to have a slightly greater primary energy demand. It may turn out that by using a mixture of R152a and R134a the unfavourable properties of the two components when used singly can be mutually moderated or completely neutralised, as follows. Addition of R134a neutralises the inflammability of R152a. A mixture may be expected to have more favourable thermodynamic and energetic properties than R134a alone. The foremost aim of the project was to determine by experiment the thermodynamic properties of the mixture of R152a and R134a. (orig./EF)

Symmetries of Quadrupole-Collective Vibrational Motion in Transitional Even-Even 124−134Xenon Nuclei

CERN Document Server

Pietralla, N; Rainovski, G; Ahn, T; Bauer, C; Leske, J; Möller, O; Möller, T

2010-01-01

Projectile-Coulomb excitation of Xe isotopes has been performed at ANL using the Gammasphere array for the detection of γ-rays. The one-quadrupole phonon 2+ 1,ms mixed-symmetry state (MSS) has been traced in the stable N=80 isotones down to 134Xe. First, the data on absolute E2 andM1 transition rates quantify the amount of F-spin symmetry in these nuclei and provide a new local measure for the pn-QQ interaction. Second, the evolution of the 2+ 1,ms state has been studied along the sequence of stable even-even 124−134Xe isotopes that are considered to form a shape transition path from vibrational nuclei with vibrational U(5) symmetry near N=82 to γ-softly deformed shapes with almost O(6) symmetry. Third, our data on more than 50 absolute E2 transition rates between off-yrast low-spin states of 124,126Xe enable us to quantitatively test O(6) symmetry in these nuclei. As a result we find that O(6) symmetry is more strongly broken in the A=130 mass region than previously thought. The data will be discussed.

Solvent Induced Disulfide Bond Formation in 2,5-dimercapto-1,3,4-thiadiazole

OpenAIRE

Palanisamy Kalimuthu; Palraj Kalimuthu; S. Abraham John

2007-01-01

Disulfide bond formation is the decisive event in the protein folding to determine the conformation and stability of protein. To achieve this disulfide bond formation in vitro, we took 2,5-dimercapto-1,3,4-thiadiazole (DMcT) as a model compound. We found that disulfide bond formation takes place between two sulfhydryl groups of DMcT molecules in methanol. UV-Vis, FT-IR and mass spectroscopic as well as cyclic voltammetry were used to monitor the course of reaction. We proposed a mechanism for...

Effect of samarium (Sm) addition on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys

International Nuclear Information System (INIS)

Qiu, Hongxu; Yan, Hong; Hu, Zhi

2013-01-01

Highlights: •Sm affected the secondary dendrite arm spacing of Al–7Si–0.7Mg alloy. •The coarse plate-like eutectic silicon was fully modified into a fine branched and particle structure when 0.6 wt.% Sm added. •The tensile properties were enhanced by the addition of Sm. •Sm has marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior. •The morphology and chemical composition of Sm-rich intermetallics were studied. -- Abstract: The effects of samarium (Sm) additions (0–0.9 wt.%) on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys have been studied in this article. The microstructures of the as-cast samples were examined by optical microscopy (OM) and scanning electron microscopy (SEM). The experimental results indicated that the rare earth Sm affected the secondary dendrite arm spacing (SDAS) of Al–7Si–0.7Mg alloy. And it was found that Sm had great modification effects on the microstructures of eutectic silicon. When 0.6 wt.% Sm was added to the alloy, the coarse plate-like eutectic silicon was fully modified into a fine fibrous structure; the dendrites of Al–7Si–0.7Mg alloy was best refined. The mechanical properties were investigated by tensile test. The findings indicate that the tensile properties and elongation were improved by the addition of Sm. And a good combination of ultimate tensile strength (215 MPa) and elongation (3.3%) was obtained when the Sm addition was up to 0.6 wt.%. Furthermore the results of thermal analysis reveal that Sm addition had marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior

Structural and superconducting properties of (Y,Gd)Ba2Cu3O7-δ grown by MOCVD on samarium zirconate buffered IBAD-MgO

International Nuclear Information System (INIS)

Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X; Chen, Y; Selvamanickam, V

2008-01-01

Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 μm thick (Y,Gd)Ba 2 Cu 3 O 7-δ ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9 0 and 3.4 0 for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J c ) of over 2 MA cm -2 at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J c and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd) 2 O 3 particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes

Desorption of Sr 89, Co 60 and Cs 134 from Suez Canal bottom sediments (Port Tawfeek Area)

International Nuclear Information System (INIS)

El-Assy, N.B.; Abdel-Fattah, A.T.; El-Shinawy, R.M.K.; Essa, M.W.A.

1986-01-01

Chemical and physical properties of Suez Canal Bottom Sediments (S.C.B.S) and seawater at Port Tawfeek, the south entrance of Suez Canal, were studied. The (S.C.B.S) was separated into its size fractions (natural sediment, sand, silt and clay). These different sediment fractions were allowed to be in equilibrium with Strontium 89, Cobalt 60 and Cesium 134 solutions. Desorption studies were carried out on these contaminated sediments. The release of Strontium 89 and Cesium 134 was found to be identical and the sequence of this release was as follows : sand> silt> natural sediment> clay. The effect of seawater is 6-8 times that of bidistilled water. In case of Cobalt 60 the above sequence was disturbed and the salinity effect was only 2 times that of bidistilled water. It was also found that Strontium and Cobalt were more easily desorbed from the sand fraction a behaviour which can be explained by their loose attachment to the crystal surface

Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

International Nuclear Information System (INIS)

Eikelmann, I.M.H.; Bye, K.; Sletten, H.D.

1990-01-01

The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively

An Inversion Disrupting FAM134B Is Associated with Sensory Neuropathy in the Border Collie Dog Breed

Directory of Open Access Journals (Sweden)

Oliver P. Forman

2016-09-01

Full Text Available Sensory neuropathy in the Border Collie is a severe neurological disorder caused by the degeneration of sensory and, to a lesser extent, motor nerve cells with clinical signs starting between 2 and 7 months of age. Using a genome-wide association study approach with three cases and 170 breed matched controls, a suggestive locus for sensory neuropathy was identified that was followed up using a genome sequencing approach. An inversion disrupting the candidate gene FAM134B was identified. Genotyping of additional cases and controls and RNAseq analysis provided strong evidence that the inversion is causal. Evidence of cryptic splicing resulting in novel exon transcription for FAM134B was identified by RNAseq experiments. This investigation demonstrates the identification of a novel sensory neuropathy associated mutation, by mapping using a minimal set of cases and subsequent genome sequencing. Through mutation screening, it should be possible to reduce the frequency of or completely eliminate this debilitating condition from the Border Collie breed population.

Adaptive neuro-fuzzy inference system model for adsorption of 1,3,4-thiadiazole-2,5-dithiol onto gold nanoparticales-activated carbon

Science.gov (United States)

Ghaedi, M.; Hosaininia, R.; Ghaedi, A. M.; Vafaei, A.; Taghizadeh, F.

2014-10-01

In this research, a novel adsorbent gold nanoparticle loaded on activated carbon (Au-NP-AC) was synthesized by ultrasound energy as a low cost routing protocol. Subsequently, this novel material characterization and identification followed by different techniques such as scanning electron microscope (SEM), Brunauer-Emmett-Teller (BET) and transmission electron microscopy (TEM) analysis. Unique properties such as high BET surface area (>1229.55 m2/g) and low pore size (influence of variables, including the amount of adsorbent, initial pollutant concentration, contact time on pollutants removal percentage has great effect on the removal percentage that their influence was optimized. The optimum parameters for adsorption of 1,3,4-thiadiazole-2, 5-dithiol onto gold nanoparticales-activated carbon were 0.02 g adsorbent mass, 10 mg L-1 initial 1,3,4-thiadiazole-2,5-dithiol concentration, 30 min contact time and pH 7. The Adaptive neuro-fuzzy inference system (ANFIS), and multiple linear regression (MLR) models, have been applied for prediction of removal of 1,3,4-thiadiazole-2,5-dithiol using gold nanoparticales-activated carbon (Au-NP-AC) in a batch study. The input data are included adsorbent dosage (g), contact time (min) and pollutant concentration (mg/l). The coefficient of determination (R2) and mean squared error (MSE) for the training data set of optimal ANFIS model were achieved to be 0.9951 and 0.00017, respectively. These results show that ANFIS model is capable of predicting adsorption of 1,3,4-thiadiazole-2,5-dithiol using Au-NP-AC with high accuracy in an easy, rapid and cost effective way.

Sorption of samarium in soils: influence of soil properties and Sm concentration

Energy Technology Data Exchange (ETDEWEB)

Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

2014-07-01

Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

Identification of boiler tube leak in PHWR by measuring short lived radioisotope Iodine-134 in boiler water using gamma spectrometric techniques

International Nuclear Information System (INIS)

Pal, P.K.; Bohra, R.C.

2015-01-01

The boiler tube made up of Monel-400 of RAPS-2 has failed on few occasions. Due to the failure of boiler tube, the active heavy water enters into boiler and feed water leading to contamination of radioactivity in secondary water circuit. The identification of boiler tube failure was done by measuring gamma ray activity of Iodine-134 in the boiler water with sample using gamma spectrometry with high purity germanium detector. In order to increase the sensitivity of the method 5 liters of Boiler water sample was passed through a plastic column containing 40 ml of anion resin and 10 ml of activated charcoal to capture the isotopes of Iodine in the anionic form and molecular form. Samples were collected from all 8 Boilers of RAPS-2. The activity of 134 I was shown only by Boiler - 5. No other boilers showed any activity of 134 I. This indicated that Boiler - 5 had leaky tubes. The leaky hairpin of boiler - 5 was identified by measuring Tritium and IP in the riser and down comer of all 10 HXs. On the basis of Tritium and IP result, HX-7 was identified as leaky hairpin. (author)

US emissions of HFC-134a derived for 2008-2012 from an extensive flask-air sampling network

NARCIS (Netherlands)

Hu, Lei; Montzka, Stephen A.; Miller, John B.; Andrews, Aryln E.; Lehman, Scott J.; Miller, Benjamin R.; Thoning, Kirk; Sweeney, Colm; Chen, Huilin; Godwin, David S.; Masarie, Kenneth; Bruhwiler, Lori; Fischer, Marc L.; Biraud, Sebastien C.; Torn, Margaret S.; Mountain, Marikate; Nehrkorn, Thomas; Eluszkiewicz, Janusz; Miller, Scot; Draxler, Roland R.; Stein, Ariel F.; Hall, Bradley D.; Elkins, James W.; Tans, Pieter P.

2015-01-01

U.S. national and regional emissions of HFC-134a are derived for 2008-2012 based on atmospheric observations from ground and aircraft sites across the U.S. and a newly developed regional inverse model. Synthetic data experiments were first conducted to optimize the model assimilation design and to

An estimation of influence of humic acid and organic matter originated from bentonite on samarium solubility

International Nuclear Information System (INIS)

Kanaji, Mariko; Sato, Haruo; Sasahira, Akira

1999-10-01

Organic acids in groundwater are considered to form complexes and increase the solubility of radionuclides released from vitrified waste in a high-level radioactive waste (HLW) repository. To investigate whether the solubility of samarium (Sm) is influenced by organic substances, we measured Sm solubility in the presence of different organic substances and compared those values with results from thermodynamic predictions. Humic acid (Aldrich) is commercially available and soluble organic matter originated from bentonite were used as organic substances in this study. Consequently, the solubility of Sm showed a tendency to apparently increase with increasing the concentration of humic acid, but in the presence of carbonate, thermodynamic predictions suggested that the dominant species are carbonate complexes and that the effect of organic substances are less than that of carbonate. Based on total organic carbon (TOC), the increase of Sm solubility measured with humic acid (Aldrich) was more significant than that in the case with soluble organic matter originated from bentonite. Since bentonite is presumed to include also simple organic matters of which stability constant for forming complexes is low, the effect of soluble organic matter originated from bentonite on the solubility of Sm is considered to be less effective than that of humic acid (Aldrich). Experimental values were compared with model prediction, proposed by Kim, based on data measured in a low pH region. Tentatively we calculated the increase in Sm solubility assuming complexation with humic acid. Trial calculations were carried out on the premise that the complexation reaction of metal ion with humic acid is based on neutralization process by 1-1 complexation. In this process, it was assumed that one metal ion coordinates with one unit of complexation sites which number of proton exchange sites is equal to ionic charge. Consequently, Kim's model indicated that carbonate complexes should be dominant

The behaviour of a hybrid compressor and ejector refrigeration system with refrigerants 134a and 142b

Energy Technology Data Exchange (ETDEWEB)

Hernandez, J.I.; Best, R.; Estrada, C.A. [UNAM, Morelos (Mexico). Centro de Investigacion en Energia; Dorantes, R.J. [UAM Azcapotzalco, Reynosa Tamaulipas (Mexico). Dpto. de Energia

2004-09-01

A complete theoretical analysis on the thermodynamic behaviour of a HYbrid Compressor and Ejector Refrigeration System - HYCERS - is carried out. An ejector under optimum performance is employed. Two working fluids were selected: refrigerant 142b (HCFC 142b) which has shown very good characteristics in air conditioning applications of ejector systems and refrigerant 134a (HFC134a) which is widely used in refrigeration applications and readily available in most countries. The variation of the generator and condenser temperatures as well as the intercooler pressure were considered for an evaporator temperature of 10{sup o}C and a unitary cooling capacity of 1 kW. The ideal efficiency, the enthalpy-based coefficient of performance, the exergy efficiency and the supplied energy ratio are obtained. With this information, at a moderate condenser and generator temperature of 30 and 85{sup o}C, respectively, the HYCERS working with R134a had the best operation with a highest coefficient of performance of 0.48 and an exergy efficiency of 0.25. On the other hand, if a higher condenser temperature is imposed, the HYCERS with 142b had its best performance at a higher generator temperature. In selecting a working fluid the ejector subsystem behaviour is determinant in system performance. If a working fluid is badly selected, despite having high entrainment ratios, the system will not function properly. Therefore, the methodology here defined becomes an effective tool for selecting adequate working fluids and optimum system design conditions. Also, the employment of a unitary cooling load allows system scaling at any capacity as it increases linearly. (author)

Exposure of a herbivorous fish to 134Cs and 137Cs from the riverbed following the Fukushima disaster

International Nuclear Information System (INIS)

Tsuboi, Jun-ichi; Abe, Shin-ichiro; Fujimoto, Ken; Kaeriyama, Hideki; Ambe, Daisuke; Matsuda, Keishi; Enomoto, Masahiro; Tomiya, Atsushi; Morita, Takami; Ono, Tsuneo; Yamamoto, Shoichiro; Iguchi, Kei'ichiro

2015-01-01

Ayu Plecoglossus altivelis, a herbivorous fish, is an important fishery resource and key component of the foodweb in many Japanese streams. Radionuclide contamination of this species is likely transferred to higher trophic levels, include humans, in the food chain. After the Fukushima accident in March 2011, ayu were exposed to highly contaminated silt while feeding on algae attached to the riverbed stones. To understand the route by which herbivorous fish are exposed to radionuclides, the activity concentrations of sum of 134 Cs and 137 Cs (radiocesium) were analyzed in riverbed samples (algae and silt) and in the internal organs and the muscle of ayu in five river systems in the Fukushima Prefecture between summer 2011 and autumn 2013. Although there was a positive correlation between the radiocesium activity concentrations in the muscle and the internal organs of ayu, the median activity concentration in the muscle was much lower than those in the internal organs. The activity concentrations of radiocesium in the riverbed samples and the internal organs and the muscle of ayu were correlated with contamination levels in soil samples taken from the watershed upstream of the sample sites. The results of the generalized linear mixed models suggest that the activity concentrations in both the internal organs and the muscle of ayu declined over time. Additionally, the activity concentrations in the internal organs were correlated with those in the riverbed samples that were collected around the same time as the ayu. The activity concentrations in the muscle were correlated with ayu body size. Our results suggest that ayu ingest 134 Cs and 137 Cs while grazing silt and algae from the riverbed, and a part of the 134 Cs and 137 Cs is assimilated into the muscle of the fish. - Highlights: • The radiocesium (sum of 134 Cs and 137 Cs) concentrations in a herbivorous fish were measured following the Fukushima disaster. • The muscle concentrations were correlated with

Synthesis and antimicrobial properties of 1,3,4-oxadiazole analogs containing dibenzosuberone moiety

Energy Technology Data Exchange (ETDEWEB)

Moger, Manjunath [Mangalore University, Karnataka (India). Department of Chemistry; Satam, Vijay; Paniraj, A.S.; Gopinath, Vadiraj S.; Hindupur, Rama Mohan; Pati, Hari N., E-mail: hari.pati@advinus.com [Advinus Therapeutics Ltd., 21 and 22, Phase II, Peenya Industrial Area, Karnataka (India); Govindaraju, Darshan Raj C. [Department of Bio-Medicinal Research, Vidya Herbs Pvt. Ltd., Karnataka (India)

2014-01-15

A series of ten novel 1,3,4-oxadiazole analogs containing dibenzosuberone moiety were synthesized using linear as well as convergent synthesis approach. All the compounds were characterized by mass spectrometry, infrared (IR), {sup 1}H and {sup 13}C nuclear magnetic resonance ({sup 1}H NMR and {sup 13}C NMR) spectroscopies and elemental analysis. These compounds were evaluated for antibacterial and antifungal activities. Among ten analogs, four compounds, namely, 8a, 8d, 8e and 8j were found to be highly active antibacterial and antifungal agents (author)

Pre-assessment of dose rates of 134Cs, 137Cs, and 60Co for marine biota from discharge of Haiyang Nuclear Power Plant, China

International Nuclear Information System (INIS)

Li, Jingjing; Liu, Senlin; Zhang, Yongxing; Chen, Ling; Yan, Yuan; Cheng, Weiya; Lou, Hailin; Zhang, Yongbao

2015-01-01

Haiyang Nuclear Power Plant to be built in China was selected as a case for the dose pre-assessment for marine biota in this study. The concentrations of Cs and Co in organisms (turbot, yellow croaker, swimming crab, abalone, sea cucumber, and sea lettuce), seawater, and bottom sediment sampled on-site were measured by neutron activation analysis, and the site-specific transfer parameters (concentration ratios and distribution coefficients) of Cs and Co were calculated. 134 Cs, 137 Cs, and 60 Co activity concentrations in the organisms and the sediment at the site were calculated with the site-specific transfer parameters and the anticipated activity concentrations in the liquid effluent of the nuclear power plant. The ERICA tool was used to estimate the dose rates of 134 Cs, 137 Cs, and 60 Co to the selected organisms based on the biological models developed. The total dose rates of 134 Cs, 137 Cs, and 60 Co to the six organisms were all <0.001 μGy h −1 . - Highlights: • Pre-assessment for biota dose rates from Haiyang Nuclear Power Plant was made. • The site-specific transfer parameters were obtained by neutron activation analysis. • The dose rates of 134 Cs, 137 Cs, and 60 Co to the organisms were <0.001 μGy h −1

On-road performance analysis of R134a/R600a/R290 refrigerant mixture in an automobile air-conditioning system with mineral oil as lubricant

International Nuclear Information System (INIS)

Ravikumar, T.S.; Mohan Lal, D.

2009-01-01

R134a has been accepted as the single major refrigerant in the automobile industry and it has been used worldwide. But, the problem associated with it is the use of the PAG oil as the lubricant. Unlike the conventional mineral oil, the synthetic PAG oil used with R134a is highly hygroscopic in nature. The PAG lubricants come with different additives unique for different compressors. This leads to serious service issues. Therefore, a refrigerant, which will be readily available to replace R12, and also compatible with mineral oil, is needed. In the present study the readily available R134a is used in place of R12. However, to avoid PAG oil and to use the conventional mineral oil as lubricant, R134a is mixed with the commercially available hydrocarbon blend, (45.2% R290 and 56.8% R600a) in the proportion of 91% and 9%, respectively by mass. The quantity of hydrocarbons used is well below the lower flammable limit. This new mixture R134a/R600a/R290 is tested in the air-conditioning system of a passenger car 'on road' in the true running conditions and compared with the results that has been obtained with R12. The cool down performance under varying speed and varying ambient conditions, system performance under severe accelerating conditions and bumper-to-bumper traffic conditions is studied. The test results show that the new blend can be a promising substitute for the existing R12 systems and it can eliminate the use of hygroscopic PAG oil.

Experimental and computation method for determination of burnup and isotopic composition of the WWER-440 fuel using the 134Cs and 137Cs concentrations

International Nuclear Information System (INIS)

Babichev, B.A.; Kozharin, V.V.

1990-01-01

An experimental and computational method for determination of burnup and actinoid concentrations in WWER fuel elements using 134 Cs and 137 Cs concentrations in fuel is considered. It is shown that the error in calculation of fuel burnup and U and Pu isotope concentrations in WWER-440 fuel elements is 1.3-4.9% provided that the error in 134 Cs and 137 Cs concentration measurements does not exceed 1.7 and 1.2%. 9 refs.; 10 figs.; 4 tabs

Functional analysis of α1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells

International Nuclear Information System (INIS)

Guo, Qiya; Guo, Bin; Wang, Yingming; Wu, Jun; Jiang, Wenjun; Zhao, Shenan; Qiao, Shouyi; Wu, Yanhua

2012-01-01

Highlights: ► Human FUT6 is up-regulated in HCC tissues. ► Expression of FUT6 promotes G0/G1-S transition and cell growth. ► FUT6 confers a growth advantage in vivo. ► FUT6 suppresses p21 expression through modulating PI3K/Akt signaling. -- Abstract: The α1,3/4-fucosyltransferases (FUT) subfamily are key enzymes in cell surface antigen synthesis during various biological processes. A novel role of FUTs in tumorigenesis has been discovered recently, however, the underlying mechanism remains largely unknown. Here, we characterized FUT6, a member of α1,3/4-FUT subfamily, in human hepatocellular carcinoma (HCC). In HCC tissues, the expression levels of FUT6 and its catalytic product SLe x were significantly up-regulated. Overexpression of FUT6 in HCC cells enhanced S-phase cell population, promoted cell growth and colony formation ability. Moreover, subcutaneously injection of FUT6-overexpressing cells in nude mice promoted cell growth in vivo. In addition, elevating FUT6 expression markedly induced intracellular Akt phosphorylation, and suppressed the expression of the cyclin-dependent kinases inhibitor p21. Bath application of the PI3K inhibitor blocked FUT6-induced Akt phosphorylation, p21 suppression and cell proliferation. Our results suggest that FUT6 plays an important role in HCC growth by regulating the PI3K/Akt signaling pathway.

The crystal structure of 6-(4-chlorophenyl-2-(4-methylbenzylimidazo[2,1-b][1,3,4]thiadiazole-5-carbaldehyde

Directory of Open Access Journals (Sweden)

A. Sowmya

2016-10-01

Full Text Available In the title imidazo[2,1-b][1,3,4]thiadiazole derivative, C19H14ClN3OS, the 4-methylbenzyl and chlorophenyl rings are inclined to the planar imidazo[2,1-b][1,3,4]thiadiazole moiety (r.m.s. deviation = 0.012 Å by 64.5 (1 and 3.7 (1°, respectively. The molecular structure is primarily stabilized by a strong intramolecular C—H...O hydrogen bond, leading to the formation of a pseudo-seven-membered S(7 ring motif, and a short intramolecular C—H...N contact forming an S(5 ring motif. In the crystal, molecules are linked by pairs of C—H...S hydrogen bonds, forming inversion dimers. The dimers are linked by C—H...O and C—H...π interactions, forming chains propagating along [110].

Spectroscopic and structural investigation of interaction of 5-mercapto-3-phenyl-1,3,4-thiadiazole-2-thione potassium salt with molecular iodine

Science.gov (United States)

Ivolgina, Victoria A.; Chernov'yants, Margarita S.

2018-06-01

The interest in the study of heteroaromatic thioamides which are known to exhibit antithyroid activity is stimulated by the variety and an unusual structure their complexes with molecular iodine. The directions of dithiones investigation are diversity enough, however a few works are devoted to the study them as the potential thyreostatics. The ability of 5-mercapto-3-phenyl-1,3,4-thiadiazole-2-thion potassium salt to form the outer-sphere charge-transfer complex in dilute chloroform solution, coordinating 2 iodine molecules has been studied by UV-vis spectroscopy (lgβ = 7.91). The compound of the 5,5‧-disulfanediylbis(3-phenyl-1,3,4-thiadiazole-2(3H)-thione) - product of irreversible oxidation of 5-mercapto-3-phenyl-1,3,4-thiadiazole-2-thione potassium salt has been isolated and characterized by X-ray diffraction. Intermolecular interactions between sulfur atoms are observed with very short interatomic distance, shorter than sum of van der Waals radii. The contact between heterocyclic sulfur and heterocyclic nitrogen is also slightly short - 3.169 Å (0.053 Å less than vdW radii sum). This investigation constitutes a starting point for study of novel antithyroid drugs in future.

Export of 134 Cs and 137 Cs in the Fukushima river systems at heavy rains by Typhoon Roke in September 2011

Directory of Open Access Journals (Sweden)

S. Nagao

2013-10-01

Full Text Available At stations on the Natsui River and the Same River in Fukushima Prefecture, Japan, effects of a heavy rain event on radiocesium export were studied after Typhoon Roke during 21–22 September 2011, six months after the Fukushima Dai-ichi Nuclear Power Plant accident. Radioactivity of 134Cs and 137Cs in river waters was 0.009–0.098 Bq L−1 in normal flow conditions during July–September 2011, but it increased to 0.85 Bq L−1 in high flow conditions because of heavy rains occurring with the typhoon. The particulate fractions of 134Cs and 137Cs were 21–56% of total radiocesium in the normal flow condition, but were close to 100% after the typhoon. These results indicate that the pulse input of radiocesium associated with suspended particles from land to coastal ocean occurred because of the heavy rain event. Export flux of 134Cs and 137Cs attributable to the heavy rain accounts for 30–50% of the annual radiocesium flux from inland to coastal ocean region in 2011. Results show that rain events are one factor contributing to the transport and dispersion of radiocesium in river watersheds and coastal marine environments.

Estimation of the R134a gas refractive index for use as a Cherenkov radiator, using a high energy charged particle beam

Science.gov (United States)

Charitonidis, N.; Karyotakis, Y.; Gatignon, L.

2017-11-01

Gases with relatively high refractive index, n - 1 ≥ 500 ×10-6 at atmospheric pressure, giving a satisfactory photoelectron yield at relatively low pressures (≤ 5 bar) are rare. These gases are often the only practical solution for low momentum particle identification in conventional secondary beam lines. The refractive index of R134a, one of the most common gases available to the physics community, has never been measured or reported. In the present note, the results of a dedicated experiment to estimate the refractive index of R134a, using mixed hadron/electron beams in the range 0.5-10 GeV are presented.

Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers; Is oral ursodeoxycholic acid treatment worhtwhile

Energy Technology Data Exchange (ETDEWEB)

Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L. (Inst. of Medicine, Univ. of Parma (Italy))

1993-03-01

The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: (i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and (ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs.

The effect of samarium doping on structure and enhanced thermionic emission properties of lanthanum hexaboride fabricated by spark plasma sintering

Energy Technology Data Exchange (ETDEWEB)

Zhou, Shenlin; Hu, Qianglin [College of Mathematics and Physics, Jinggangshan University, Jian (China); Zhang, Jiuxing; Liu, Danmin [Key Laboratory of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing (China); Huang, Qingzhen [NIST Center for Neutron Research, National Institute of Standards and Technology, MD (United States)

2014-03-15

Single-phase polycrystalline solid solutions (La{sub 1-x}Sm{sub x})B{sub 6} (x = 0, 0.2, 0.4, 0.8, 1) are fabricated by spark plasma sintering (SPS). This study demonstrates a systematic investigation of structure-property relationships in Sm-doped LaB{sub 6} ternary rare-earth hexaborides. The microstructure, crystallographic orientation, electrical resistivity, and thermionic emission performance of these compounds are investigated. Analysis of the results indicates that samarium (Sm) doping has a noticeable effect on the structure and performance of lanthanum hexaboride (LaB{sub 6}). The analytical investigation of the electron backscatter diffraction confirms that (La{sub 0.6}Sm{sub 0.4})B{sub 6} exhibits a clear (001) texture that results in a low work function. Work functions are determined by pulsed thermionic diode measurements at 1500-1873 K. The (La{sub 0.6}Sm{sub 0.4})B{sub 6} possesses improved thermionic emission properties compared to LaB{sub 6}. The current density of (La{sub 0.6}Sm{sub 0.4})B{sub 6} is 42.4 A cm{sup -2} at 1873 K, which is 17.5% larger than that of LaB{sub 6}. The values of Φ{sub R} for (La{sub 0.6}Sm{sub 0.4})B{sub 6} and LaB{sub 6} are 1.98 ± 0.03 and 1.67 ± 0.03 eV, respectively. Furthermore, the Sm substitution of lanthanum (La) effectively increases the electrical resistivity. These results reveal that Sm doping lead to significantly enhanced thermionic emission properties of LaB{sub 6}. The compound (La{sub 0.6}Sm{sub 0.4})B{sub 6} appears most promising as a future emitter material. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident

Energy Technology Data Exchange (ETDEWEB)

Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza, E-mail: lararapls@hotmail.com, E-mail: camilabiouff@gmail.com, E-mail: akelecom@id.uff.br [Universidade Federal Fluminense (LARARA-PLS/UFF), Niteroi, RJ (Brazil). Lab. de Radiobiologia e Radiometria Pedro Lopes dos Santos; Pereira, Wagner de S., E-mail: pereiraws@gmail.com [Industrias Nucleares do Brasil (UNB), Pocos de Caldas, MG (Brazil). Servico de Radioprotecao. Grupo Multidisciplinar de Radioprotecao

2013-07-01

The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C{sub s}-134 and C{sub s}-137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C{sub s}-134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)

Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident

International Nuclear Information System (INIS)

Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza; Pereira, Wagner de S.

2013-01-01

The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C s -134 and C s -137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C s -134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)

An Inversion Disrupting FAM134B Is Associated with Sensory Neuropathy in the Border Collie Dog Breed.

Science.gov (United States)

Forman, Oliver P; Hitti, Rebekkah J; Pettitt, Louise; Jenkins, Christopher A; O'Brien, Dennis P; Shelton, G Diane; De Risio, Luisa; Quintana, Rodrigo Gutierrez; Beltran, Elsa; Mellersh, Cathryn

2016-09-08

Sensory neuropathy in the Border Collie is a severe neurological disorder caused by the degeneration of sensory and, to a lesser extent, motor nerve cells with clinical signs starting between 2 and 7 months of age. Using a genome-wide association study approach with three cases and 170 breed matched controls, a suggestive locus for sensory neuropathy was identified that was followed up using a genome sequencing approach. An inversion disrupting the candidate gene FAM134B was identified. Genotyping of additional cases and controls and RNAseq analysis provided strong evidence that the inversion is causal. Evidence of cryptic splicing resulting in novel exon transcription for FAM134B was identified by RNAseq experiments. This investigation demonstrates the identification of a novel sensory neuropathy associated mutation, by mapping using a minimal set of cases and subsequent genome sequencing. Through mutation screening, it should be possible to reduce the frequency of or completely eliminate this debilitating condition from the Border Collie breed population. Copyright © 2016 Forman et al.

Solvated copper(I) hexafluorosilicate π-complexes based on [Cu2(amtd)2]2+ (amtd = 2-allylamino-5-methyl-1,3,4-thiadiazole) dimer

OpenAIRE

Goreshnik, E.A.; Veryasov, G.; Morozov, Dmitry; Slyvka, Yu.; Ardan, B.; Mys'kiv, M.G.

2016-01-01

[Cu2(amdt)2]SiF6·C6H6 and [Cu2(amdt)2(H2O)2]SiF6·CH3CN·2H2O (amdt = 2-allylamino-5- methyl-1,3,4-thiadiazole) were obtained by alternating-current electrochemical synthesis, starting from water–acetonitrile–benzene mixtures containing 2-allylamino-5-methyl-1,3,4- thiadiazole and CuSiF6·4H2O. The electrochemical reduction of the saturated copper hexafluorosilicate water solution beneath the neatly poured layer of acetonitrile-benzene amdt solution resulted in the formation of cr...

Improved synthesis of 1,3,4-thiadiazolium-2-phenylamines using microwave and ultrasound irradiation and investigation of their cytotoxic activity

Energy Technology Data Exchange (ETDEWEB)

Reis, Camilla Moretto dos; Miranda, Amanda Fraga; Echevarria, Aurea, E-mail: echevarr@ufrrj.b [Universidade Federal Rural do Rio de Janeiro (DQ/ICE/UFRRJ), Seropedica, RJ (Brazil). Inst. de Ciencias Exatas. Dept. de Quimica; Echevarria-Lima, Juliana [Universidade Federal do Rio de Janeiro (DI/IMPG/UFRJ), RJ (Brazil). Inst. de Microbiologia Paulo de Goes. Dept. de Imunologia

2011-07-01

A new and efficient synthesis of eight 1,3,4-thiadiazolium-2-phenylamine derivatives (1-8, where 8 is novel in the literature) was performed using thionyl chloride or trimethylsilyl chloride as catalysts under microwave or ultrasound irradiation. The target compounds were obtained in good yields and remarkably short times, 5 min under microwave irradiation and 10 min under ultrasound irradiation, where compared to traditional methodology (24 to 48 h at room temperature standing). The best yields were obtained using the microwave irradiation and, in general way, using thionyl chloride instead trimethylsilyl chloride. The cytotoxicity against K562 human leukemia and Daudi lymphoma lines was evaluated and showed promising results from the 4-phenyl-5-(4'-nitro-styryl)-1,3,4-thiadiazolium-2-phenylamine chloride derivative. (author)

The relation between carbon monoxide emission and visual extinction in cloud L134

International Nuclear Information System (INIS)

Tucker, K.D.; Dickman, R.L.; Encrenaz, P.J.; Kutner, M.L.

1976-01-01

Emission from the J=1→0 transition of carbon monoxide has been mapped over an area of 40' x 55' in cloud L134, and visual extinctions over the entire cloud have been obtained by means of star counts. Line intensities of > or =2 K are observable down to an extinction level of about one magnitude. From observations of the J=1→0 transition of the 13 CO isotopic species at 18 locations in the cloud, we have found a linear correlation between the local thermodynamic equilibrium (LTE) column densities of 13 CO and magnitudes of visual extinction

Eosin Y Catalyzed Visible-light-promoted One –Pot Facile Synthesis of 1,3,4- Thiadiazole

Directory of Open Access Journals (Sweden)

Vishal Srivastava

2015-03-01

Full Text Available A novel one-pot visible light irradiated synthesis of 1,3,4-thiadiazole from aldehydes and thioacyl hydrazides have been reported in presence of eosin Y as an organophotoredox catalyst at room temperature under aerobic condition. This synthesis includes application of air and visible light as inexpensive, readily available, non-toxic and sustainable regents, which fulfils the basic principle of green chemistry.

Dry deposition of particulate Cs-134 to several leafy vegetable species and comparison to deposition of gaseous radioiodine

International Nuclear Information System (INIS)

Tschiersch, J.; Shinonaga, T.; Heuberger, H.

2004-01-01

The height of the dry deposition of particulate radionuclides to leafy vegetable is quite uncertain because of the different habit, surface texture and leaf uptake of the different species. There is no comparative data on the deposition to various species, but leafy vegetables are taken as reference plants for the estimation of the height of contamination of vegetable foods after a nuclear accident. Therefore new chamber experiments were performed to determine under homogeneous and controlled conditions the dry deposition of particulate radio-caesium on mature leafy vegetable. The simultaneous exposition of endive, head lettuce, red oak leaf lettuce and spinach (spring leafy vegetable) rsp. curly kale, white cabbage and spinach (summer leafy vegetable) was arranged. The sample collective of each species was such large that for the expected variation of the results a statistically firm analysis was possible. For spring vegetable, there was no significant difference observed in deposition of 134 Cs between spinach and leaf lettuce, about twice the amount was deposited on both species as on endive and 3 times as on head lettuce. All summer vegetables showed differences in deposition for Caesium, the deposition to curly kale was highest, about twice that on spinach and 35 times (80 times) that on white cabbage. The normalized deposition velocity could be estimated, in average it was about 8 times lower for 134 Cs than for gaseous elemental 131 I. The influence of the particle size on the deposition velocity was small in the considered size range of 0.58-1.1μm (AMAD) of the monodisperse aerosol. Washing could reduce the contamination by about 45% for 134 Cs. (author)

Paddy-field contamination with 134Cs and 137Cs due to Fukushima Dai-ichi Nuclear Power Plant accident and soil-to-rice transfer coefficients

International Nuclear Information System (INIS)

Endo, Satoru; Kajimoto, Tsuyoshi; Shizuma, Kiyoshi

2013-01-01

The transfer coefficient (TF) from soil to rice plants of 134 Cs and 137 Cs in the form of radioactive deposition from the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident in March 2011 was investigated in three rice paddy fields in Minami-Soma City. Rice crops were planted in the following May and harvested at the end of September. Soil cores of 30-cm depth were sampled from rice-planted paddy fields to measure 134 Cs and 137 Cs radioactivity at 5-cm intervals. 134 Cs and 137 Cs radioactivity was also measured in rice ears (rice with chaff), straws and roots. The rice ears were subdivided into chaff, brown rice, polished rice and rice bran, and the 134 Cs and 137 Cs radioactivity concentration of each plant part was measured to calculate the respective TF from the soil. The TF of roots was highest at 0.48 ± 0.10 in the field where the 40 K concentration in the soil core was relatively low, in comparison with TF values of 0.31 and 0.38 in other fields. Similar trends could be found for the TF of whole rice plants, excluding roots. The TF of rice ears was relatively low at 0.019–0.026. The TF of chaff, rice bran, brown rice and polished rice was estimated to be 0.049, 0.10–0.16, 0.013–0.017 and 0.005–0.013, respectively. - Highlights: ► We investigated the transfer coefficient of 134 Cs and 137 Cs from soil to rice plants in Minami-Soma City due to the Fukushima accident in 2011. ► The rice ears, straws, roots, chaff, brown rice, polished rice, rice bran and soil samples have been measured by Ge-detector. ► Transfer coefficient of chaff, rice bran, brown rice, and polished rice is estimated as 0.049, ranging from 0.10 to 0.16, 0.013 to 0.017, and 0.005 to 0.013, respectively.

Critical heat flux experimental facility using Freon R-134a fluid

Energy Technology Data Exchange (ETDEWEB)

Hong, Sung Deok; Chung, C. H.; Kim, B. D. [Korea Atomic Energy Research Institute, Taejeon (Korea)

2000-02-01

A CHF experimental loop using Freon R-134a as a working fluid has been designed and built to facilitate modeling of high pressure/temperature water CHF experiments. This loop was designed to operate at 4 MPa, 100 deg C with the maximum flow rate of 2.5 kg/s. The detailed technical specification and operating procedure of the loop are described together with comments on the performance and limitations of the loop. A series of CHF experiment was carried out in a vertical round tube and the fluid-to-fluid modeling techniques are applied for it's validity for the high temperature/pressure reactor conditions. The experimental range covered all the application ranges of CHF correlations developed for both PWR and PHWR. 28 refs., 9 figs., 5 tabs. (Author)

Definition of influence of some derivatives of 1,3,4-thia-diazol[3.2a]pirimidin on catalase Escherichia coliactivity

International Nuclear Information System (INIS)

Ashurova, Z.D.; Sangov, Z.G.; Murvatulloeva, M.S.; Khalikova, Z.D.; Djamshedov, D.N.; Salimova, Z.D.

2009-01-01

Studying of some pharmacologic and biologic parameters of 1,3,4-thia-diazol[3.2a]pirimidin derivatives let make conclusion on possibility of using of these matters as a substance at elaboration of antibacterial drugs

Rab27a regulates epithelial sodium channel (ENaC) activity through synaptotagmin-like protein (SLP-5) and Munc13-4 effector mechanism

International Nuclear Information System (INIS)

Saxena, Sunil K.; Horiuchi, Hisanori; Fukuda, Mitsunori

2006-01-01

Liddle's syndrome (excessive absorption of sodium ions) and PHA-1 (pseudohypoaldosteronism type 1) with decreased sodium absorption are caused by the mutations in the amiloride-sensitive epithelial sodium channel ENaC. Rab proteins are small GTPases involved in vesicle transport, docking, and fusion. Earlier, we reported that Rab27a inhibits ENaC-mediated currents through protein-protein interaction in HT-29 cells. We hereby report that Rab27a-dependent inhibition is associated with the GTP/GDP status as constitutively active or GTPase-deficient mutant Q78L inhibits amiloride-sensitive currents whereas GDP-locked inactive mutant T23N showed no effect. In order to further explore the molecular mechanism of this regulation, we performed competitive assays with two Rab27a-binding proteins: synaptotagmin-like protein (SLP-5) and Munc13-4 (a putative priming factor for exocytosis). Both proteins eliminate negative modulation of Rab27a on ENaC function. The SLP-5 reversal of Rab27a effect was restricted to C-terminal C2A/C2B domains assigned for putative phospholipids-binding function while the Rab27a-binding SHD motif imparted higher inhibition. The ENaC-mediated currents remain unaffected by Rab27a though SLP-5 appears to strongly bind it. The immunoprecipitation experiments suggest that in the presence of excessive Munc13-4 and SLP-5 proteins, Rab27a interaction with ENaC is diminished. Munc13-4 and SLP-5 limit the Rab27a availability to ENaC, thus minimizing its effect on channel function. These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins

Pre-assessment of dose rates of (134)Cs, (137)Cs, and (60)Co for marine biota from discharge of Haiyang Nuclear Power Plant, China.

Science.gov (United States)

Li, Jingjing; Liu, Senlin; Zhang, Yongxing; Chen, Ling; Yan, Yuan; Cheng, Weiya; Lou, Hailin; Zhang, Yongbao

2015-09-01

Haiyang Nuclear Power Plant to be built in China was selected as a case for the dose pre-assessment for marine biota in this study. The concentrations of Cs and Co in organisms (turbot, yellow croaker, swimming crab, abalone, sea cucumber, and sea lettuce), seawater, and bottom sediment sampled on-site were measured by neutron activation analysis, and the site-specific transfer parameters (concentration ratios and distribution coefficients) of Cs and Co were calculated. (134)Cs, (137)Cs, and (60)Co activity concentrations in the organisms and the sediment at the site were calculated with the site-specific transfer parameters and the anticipated activity concentrations in the liquid effluent of the nuclear power plant. The ERICA tool was used to estimate the dose rates of (134)Cs, (137)Cs, and (60)Co to the selected organisms based on the biological models developed. The total dose rates of (134)Cs, (137)Cs, and (60)Co to the six organisms were all <0.001 μGy h(-1). Copyright © 2015 Elsevier Ltd. All rights reserved.

Structure of 2{sub 1,2}{sup +} states in {sup 132,134,136}Te

Energy Technology Data Exchange (ETDEWEB)

Severyukhin, A. P., E-mail: sever@theor.jinr.ru; Arsenyev, N. N. [Joint Institute for Nuclear Research, Bogoliubov Laboratory of Theoretical Physics (Russian Federation); Pietralla, N.; Werner, V. [Technische Universität Darmstadt, Institut für Kernphysik (Germany)

2016-07-15

Starting fromthe Skyrme interaction f- together with the volume pairing interaction, we study the g factors for the 2{sub 1,2}{sup +} excitations of {sup 132,134,136}Te. The coupling between one- and two-phonon terms in the wave functions of excited states is taken into account within the finite-rank separable approximation. Using the same set of parameters we describe the available experimental data and give the prediction for {sup 136}Te, g(2{sub 1}{sup +}) = −0.18 in comparison to +0.32 in the case of {sup 132}Te.

Synthesis and Bioassay of a New Class of Furanyl-1,3,4-Oxadiazole Derivatives

Directory of Open Access Journals (Sweden)

Galila A. Yacout

2013-07-01

Full Text Available Tyrosinase enzyme is a monophenol monoxygenase enzyme, which plays an important role in human as a rate limiting step enzyme for different specific metabolic pathways, as well as its useful application in industry and agriculture. So this study was carried out to test the effect of newly prepared compounds containing 1,3,4-oxadiazoles with different substituted groups on tyrosinase enzyme activity, hoping to use them in the treatment of some diseases arising from tyrosinase activity disorders such as Parkinson’s disease, schizophrenia, autism, attention deficit, hyperactivity disorder, and cancer.

Synthesis of carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinolinium derivatives as new potential PET SKCa channel imaging agents.

Science.gov (United States)

Gao, Mingzhang; Wang, Min; Zheng, Qi-Huang

2008-02-01

Small conductance Ca2+-activated K+ (SKCa) channels play an important role in many functions such as neuronal communication and behavioral plasticity, secretion, and cell proliferation. SKCa channel modulation is associated with various brain, heart, and cancer diseases. N-methyl-laudanosine and its structurally related derivatives, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums, are reversible and selective SKCa channel blockers. Carbon-11 labeled N-methyl-laudanosine and its tetrahydroisoquinolinium derivatives may serve as new probes for positron emission tomography (PET) to image SKCa channels in the brain, heart, and cancer. The key intermediates, substituted isoquinolines (3a-c), were synthesized using a modification of the Pomeranz-Fritsch procedure. The precursors, substituted 1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinolines (8a-c), and their corresponding reference standards, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums (9a-c), were synthesized from compounds 3a-c with 3,4-dimethoxybenzyl chloride (2) in multiple steps with moderate to excellent chemical yields. The precursor 6,7-dimethoxy-1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinoline (10) was commercially available, and the methylation of compound 10 with methyl iodide provided N-methyl-laudanosine (11). The target quaternary ammonium tracers, carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums ([11C]9a-c and [11C]11), were prepared by N-[11C]methylation of the tertiary amine precursors (8a-c and 10) with [11C]methyl triflate and isolated by a simplified solid-phase extraction (SPE) purification using a SiO2 or cation-exchange CM Sep-Pak cartridge in 40-65% radiochemical yields.

Corrosion inhibition performance of 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole for carbon steel in HCl solution: Gravimetric, electrochemical and XPS studies

Energy Technology Data Exchange (ETDEWEB)

Bouanis, M.; Tourabi, M.; Nyassi, A. [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); Zarrouk, A. [LCAE-URAC 18, Faculty of Science, First Mohammed University, PO Box 717, M-60 000 Oujda (Morocco); Jama, C. [UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France); Bentiss, F., E-mail: fbentiss@gmail.com [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France)

2016-12-15

Highlights: • 2,5-Bis(4-dimethylaminophenyl)-1,3,4-oxadiazole is good corrosion inhibitor for carbon steel in 1 M HCl. • XPS analysis has provided the composition of adsorbed protective layer on the steel surface. • The adsorption of the investigated 1,3,4-oxadiazole is mainly due to chemisorption. - Abstract: Corrosion inhibition of carbon steel in normal hydrochloric acid solution at 30 °C by 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole (DAPO) has been studied by weight loss measurements and electrochemical techniques (polarization and AC impedance). The experimental results showed that DAPO acted as an efficient inhibitor against the carbon steel corrosion in 1 M HCl, and its inhibition efficiency increased with the inhibitor concentration reaching a value up to 93% at 1 mM. Polarization studies showed that the DAPO was a mixed-type inhibitor. The adsorption of this 1,3,4-oxadiazole derivative on the carbon steel surface in 1 M HCl solution followed the Langmuir adsorption isotherm and the corresponding value of the standard Gibbs free energy of adsorption (ΔG°{sub ads}) is associated to a chemisorption mechanism. Scanning Electron Microscopy (SEM) and X-Ray Photoelectron Spectroscopy (XPS) analyses were carried out to characterize the chemical composition of the inhibitive film formed on the steel surface. The surfaces studies showed that the inhibitive layer is composed of an iron oxide/hydroxide mixture where DAPO molecules are incorporated. The cytotoxicity of DAPO was also determined using cell culture system.

Designing the STS-134 Re-Rendezvous: A Preparation for Future Crewed Rendezvous Missions

Science.gov (United States)

Stuit, Timothy D.

2011-01-01

In preparation to provide the capability for the Orion spacecraft, also known as the Multi-Purpose Crew Vehicle (MPCV), to rendezvous with the International Space Station (ISS) and future spacecraft, a new suite of relative navigation sensors are in development and were tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the Orion relative navigation sensors on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle orbiter at the end of the mission. Unlike the rendezvous and docking at the beginning of the mission, the re-rendezvous profile replicates the newly designed Orion coelliptic approach trajectory, something never before attempted with the shuttle orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this rerendezvous to make the flight test successful. Additionally, all of this work had to be integrated with the normal operations of the ISS and shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and rerendezvous trajectory design that would not only prove the design of the relative navigation sensors for the Orion vehicle, but also would serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.

Prediction of cesium-134 and strontium-85 crop uptake based on soil properties

International Nuclear Information System (INIS)

Roca, M.C.; Vallejo, V.R.; Roig, M.; Tent, J.; Vidal, M.; Rauret, G.

1997-01-01

Nowadays, there is still the need to improve the quantification of parameters that affect radionuclide mobility. With this aim, radiocesium and radiostrontium soil-to-plant transfer was measured in lysimeters in a Calcic Luvisol, loamy soil and in a Fluvisol, loam-sandy soil, using lettuce [Lactuca sativa L. cv. Kinemontepas] and pea plants [Pisum sativum L. cv. Kelvedon Wonder]. Weighted Concentration Ratios (WCR), expressed as kg soil/kg plant, were calculated for different growth stages. Weighted Concentration Ratios were in general higher for 85Sr than for 134Cs, and also higher in the loam-sandy than in the loamy soil. To predict plant uptake, we evaluated a set of soil properties to define a prediction factor for the relative transfer in the two soils using cation exchange capacity (CEC) and radionuclide available fraction (fav) for radiostrontium, and soil solution composition, solid-liquid distribution coefficient, and radionuclide available fraction for radiocesium. The ratios of WCR in the loam-sandy and loamy soil were compared with the prediction factor. There was good agreement in lettuce for 85Sr (ratio of WCR was 5.4 for seedling and 3.9 for commercial samples, whereas prediction factor was 3.1) and for 134Cs (ratio of WCR was 5.1 for seedling and 5.5 for commercial samples, the prediction factor being 5.1), although for pea only the relative root uptake of radiocesium in seedling pea was well predicted (the ratio of WCR was 8.8, the prediction factor being 9.1). These soil parameters improved former predictions based solely on the fav, although factors depending on plant physiology should be better evaluated

sup 8 sup 9 Sr and sup 1 sup 5 sup 3 Sm-EDTMP therapy of disseminated skeletal metastasis

CERN Document Server

Zhang Jun Ning; Zhu Shou Peng

2001-01-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

89Sr and 153Sm-EDTMP therapy of disseminated skeletal metastasis

International Nuclear Information System (INIS)

Zhang Junning; Hong Chengjiao; Zhu Shoupeng

2001-01-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

{sup 89}Sr and {sup 153}Sm-EDTMP therapy of disseminated skeletal metastasis

Energy Technology Data Exchange (ETDEWEB)

Junning, Zhang; Chengjiao, Hong; Shoupeng, Zhu [Suzhou Univ., Suzhou (China)

2001-07-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis.

Five years of monitoring Cs-137 And Cs-134 in moss and soil samples in the campania region of Italy after the Chernobyl accident

International Nuclear Information System (INIS)

Fontana, C.; Tenero, A.Lo; Musumeci, R.G.; Valeriani, F.

2000-01-01

The Central Laboratory of The Italian Red Cross is part of the National Network for the Monitoring of the Environmental Radioactivity in Italy, coordinated by the National Environmental Agency (ANPA). The Central Laboratory took part in the national campaigns for the monitoring of the environmental gamma radioactivity in order to evaluate the deposition of artificial radioactivity on Italian territory after the Chernobyl accident. The distribution of the concentration of artificial radionuclide Cs-137 as reached, in North and Central Italy, the higher values: 2-185 kBq/m 2 and 0-40 kBq/m 2 . This paper presents the data of the concentration of artificial radionuclides Cs-137 and Cs-134 in mosses picked up in four different locations in the Campania Region of Italy with the help of the Department of the State Forestry Corp of S.Gregorio Matese, Vesuvio, Laviano, Piaggine from 1993 to 1998. The deposition of artificial radioactivity on the territory expected after the Chernobyl fallout was evaluated. The content of K-40 was also measured. Soil samples were also taken from the same sites. In this study Hypnum cupressiforme and Homalotecium lutescens mosses were used as bioindicators, available in all Italian ecosystems. The soil and moss samples were gathered according to a national standard procedure. These results, obtained by gamma spectrometry analyses, initially have shown values of medium concentration in mosses in the Campania Region of Cs-137 of 375 Bq/m 2 and of Cs-134 of 16 Bq/m 2 and K-40 of 150 Bq/m 2 in line with the ones of other Italian regions. The results of the average concentrations of the Cs-137 and Cs-134 in the mosses confirm a uniform distribution of post-Chernobyl radioactivity in the regional territory, in the Department of the State Forestry Corp of Vesuvio, Laviano and Piaggine. The results of Cs-137 and Cs-134 of S.Gregorio Matese are in accordance with the previous data relative to the monitoring campaign of mosses in Italy from 1992 to

134Cs foliar contamination of vine: translocation to grapes and transfer to wine

International Nuclear Information System (INIS)

Carini, F.; Anguissola Scotti, I.; Montruccoli, M.; Silva, S.

1996-01-01

Grape vines growing in pots placed in open field were contaminated by sprinkling an aqueous solution of carrier free 134 Cs. Activity was determined in acini and must at the ripening stage. Interception and Translocation Factors (TLF) were quantified. They strictly depend on the state of growth of the crop. Wine was produced by a laboratory process and analysed as to radiocesium. Transfer parameters, F r and P e , were calculated to predict radiocesium concentration in wine: it is 0.6 times the activity found in grapes. The leaf fruit translocation seems to be the dominant process in the contamination of acini when compared to direct deposition. (author)

Synthesis and characterization of wide range mesogenic esters based on asymmetrical 2,5-disubstituted 1,3,4-thiadiazole

Science.gov (United States)

Tomi, Ivan H. R.; Jaffer, Hamed J.; Aldhaif, Yasmeen A.

2018-04-01

A homologous series of new 13 esters, 4-(5-(p-tolyl)-1,3,4-thiadiazol-2-yl)-phenyl-4-alkoxybenzoate, (IVn), based on 1,3,4-thiadiazole core has been synthesized. The structures of these esters were confirmed by Fourier transform infrared spectroscopy, proton nuclear magnetic resonance and mass techniques. Their mesophases behavior was investigated with hot-stage polarizing optical microscope and differential scanning calorimetry. The thermal stability for most of these derivatives was measured by thermal gravimetric analysis. All the target esters showed enantiotropic mesomorphic behaviors with nematic and nematic/smectic C phases. The phase transition temperatures and liquid crystalline properties were affected by the nature of heterocyclic ring and the length of the alkoxy chain. Only the nematic phase was observed in the first 10 derivatives, (n = 1-10), while the last 3, (n = 12, 16 and 18) showed nematic and smectic C phases. These compounds demonstrated high liquid crystalline ranges, both in heating and cooling cycles. The mesomorphic results obtained were compared with the reported analogs of similar constituents.

Determination of beta-radiation in 14C-labelled biological samples by 2,5-diphenyl-1,3,4-oxadiazole

International Nuclear Information System (INIS)

Kiehl, B.; Neumann, R.; Beger, J.

1991-01-01

2,5-Diphenyl-1,3,4-oxadiazole (PPD) has been investigated for its suitability as a primary szintillator. This compound can be used together with the secondary szintillator POPOP in toluene solution for the measurement of low-energetic β-radiation in biological samples marked by 14 C. A convenient approach to laboratory syntheses is presented. (orig.) [de

Use of inorganic and organic compounds as decontaminates for cobalt T-60 and cesium-134 by clover plant grown on Inshas Sandy soil

International Nuclear Information System (INIS)

Abdel-Sabour, M.F.; El-naggr, H.A.; Soliman, S.M.

1994-01-01

Out door lysimeter experiment was carried out to elucidate the effect of four inorganic and three organic salts on 60 Co and 134 Cs uptake and dry matter yield of three cuts of clover in the soil Inshas A new concept was proposed for assessing the difference in capacity of soil to supply radionuclides (i.e. 60 Co and 134 Cs) to plants as affected by applied inorganic or organic compounds. The relation of plant tissues (P c ) Co/IR Cs content with increasing time can be expressed as log (Pc) = A + B log time (T), where A and B the regression. When the same plant species is grown on the same soil differ only in the applied compound (e.g. Fe-EDDHA, Fe-DTPA, Fe-O A C, Fe(Coo)z, A1(OH)3, Ca(H2 P O 4 )2 and Fe 2 O 3 ) the equation will change to, log (P'c) = A + B' log (T) (I). Based on both equations, the relationship between (Pc) becomes; log (P'c) = [(A'B')/(A B + A B ) [ +[1/A'B + A B ) [ log (Pc) (II). The intercept (C) and slope (S) in Eq. (II) were determined among 7 treatments (for either 60 Co or 134 Cs). Then the difference of either Co or Cs accumulation with time between control and any other treatment was evaluated according to (C) and (S) values. The data also that Fe-DTPA is preferred for 60 Co as enhancing compound for plant uptake (for decontamination use); compared with other applied salts; on the other hand, any tested salts did not significantly effect 134 Cs taken by clover. Also, it was found that more than 70% of total cobalt uptake was accumulated in the roots which indicate that Co is less mobile in plants than Cs. 3 figs., 4 tabs

Radio observations of the γ-ray quasar 0528+134. Superluminal motion and an extreme scattering event.

Science.gov (United States)

Pohl, M.; Reich, W.; Krichbaum, T. P.; Standke, K.; Britzen, S.; Reuter, H. P.; Reich, P.; Schlickeiser, R.; Fiedler, R. L.; Waltman, E. B.; Ghigo, F. D.; Johnston, K. J.

1995-11-01

We report on multifrequency radio observations made with the Effelsberg 100-m telescope, the IRAM 30-m telescope and the Green Bank Interferometer between 1992 and 1994 of the γ-ray quasar 0528+134. We present a new VLBI based map of 0528+134 at 22GHz with sub-mas angular resolution observed in November 1992. At that time the source was in a phase of brightening at all of our observing frequencies above 3GHz. The increase of brightness may be related to activity in the unresolved core component of the quasar. The VLBI map at 22GHz (epoch 1992.85) shows a one-sided core jet structure of ~5mas length. A new component close to the core indicates an apparent transverse velocity of β_app_object of the AGN and that a remnant of this outburst moved further outward in the jet until it became optically thin at radio frequencies after a few months. During the flare in July 1993 we observed with the Effelsberg 100-m telescope an unusually strong decrease of the flux density by about 50% at 4.75GHz and 10.55GHz and slightly less at 2.695GHz. This behaviour is also seen in the monitoring data at 2.25GHz and 8.3GHz taken with the Green Bank Interferometer (NRL-GBI). The event lasted less than three days at the higher frequencies and more than two weeks at 2.25GHz. For the case that this event is related to the intense radio flare some geometrical effects like a small variation of the viewing angle of the quasars jet orientated very close to the line of sight are considered, but found to be an unlikely explanation for the observed behaviour. Alternatively, an extreme scattering event by a small dense plasma cloud in the line of sight is able to match the observed time lag in the lightcurves if we take into account the mas-structure of the source and different spectra of the components on the basis of their brightness in the VLBI maps. The importance of interstellar scattering is stressed as 0528+134 is seen in the direction of the dark cloud Barnard 30 located at 400pc distance

Experimental investigations on automobile air conditioners working with R134a and R290/R600a as an alternative

Directory of Open Access Journals (Sweden)

Kandhaswamy Karthikeyan

2017-01-01

Full Text Available In this work, the performance of R134a based automobile air conditioning system has been evaluated by retrofitted with R290/R600a mixture (in the ratio of 50:50, by mass, as an alternative. The performance was evaluated at five different operating speeds (1000, 1500, 2000, 2500, and 3000, which covers the entire range of working conditions with four different cabin load (100, 200, 300, and 400 W. The condenser inlet air temperature was varied in the range between 30 and 50°C, which covers the entire climatic variations in Coimbatore city of India. The performance characteristics such as, refrigerating effect, coefficient of performance, compressor power consumption, and compressor discharge temperatures were considered for comparison. The results showed that, hydrocarbon mixture has faster cooling rate due to its high latent heat of vaporization, 5% higher coefficient of performance due to higher refrigeration effect, 8-10 K lower compressor discharge temperature due to its lower specific heat ratio with 5% lower compressor power consumption due to its lower viscosity and lower liquid density. The charge requirement of R290/R600a mixture is about 50% less compared to R134a. However, the mixture composition is considered as an interment replacement in automobile air conditioners due to composition shift under leak-age conditions. Hence, R290/R600a mixture is considered as an interim energy efficient and environment friendly option in R134a automobile air conditioners to extend its life.

1.34 µm picosecond self-mode-locked Nd:GdVO4 watt-level laser

Science.gov (United States)

Han, Ming; Peng, Jiying; Li, Zuohan; Cao, Qiuyuan; Yuan, Ruixia

2017-01-01

With a simple linear configuration, a diode-pumped, self-mode-locked Nd:GdVO4 laser at 1.34 µm is experimentally demonstrated for the first time. Based on the aberrationless theory of self-focusing and thermal lensing effect, through designing and optimizing the resonator, a pulse width as short as 9.1 ps is generated at a repetition rate of 2.0 GHz and the average output power is 2.51 W. The optical conversion efficiency and the slope efficiency for the stable mode-locked operation are approximately 16.7% and 19.2%, respectively.

134Cs and 137Cs whole-body measurements and internal dosimetry of the population living in areas contaminated by radioactivity after the Chernobyl accident

International Nuclear Information System (INIS)

Zvonova, I.A.; Jesko, T.V.; Balonov, M.I.; Danilova, I.O.; Wallstroem, E.; Alpsten, M.; Thornberg, C.; Mattsson, S.

1995-01-01

Six western districts of the Bryansk region, Russia, were heavily contaminated with radioactive fallout after the Chernobyl NPP accident. Annually, between 1991 and 1994, inhabitants of four settlements were studied. Whole-body 134+137 Cs contents were measured in about 500 inhabitants. No correlation between Cs whole-body content and Cs soil contamination was found; Cs accumulation in a body depends greatly on natural factors such as type of soil, on social factors such as food habits including consumption of forest products, and on countermeasures to reduce internal exposure. During 1991-1994 average whole-body content of 134+137 Cs in adult inhabitants was about 3-60 kBq, corresponding to an effective dose of 0.1-2.4 mSv.y -1 . Cs whole-body content increases equally for girls and boys up to adult age. Cs content in adults does not depend significantly on age and is usually 1.2-2 times higher in men than in women. The average annual internal effective dose varies with age significantly less than 134+137 Cs whole-body content. In children (0-5 years) the mean absorbed dose is usually 1.2-1.5 times less than in adults. (author)

Heat transfer during condensation of HFC-134a and R-404A inside of a horizontal smooth and micro-fin tube

Energy Technology Data Exchange (ETDEWEB)

Sapali, S N [Govt. College of Engineering, Department of Mechanical Engineering, Shivaji Nagar, Pune, Maharashtra 411 005 (India); Patil, Pradeep A [AISSMS College of Engineering, Pune University, Mechanical Engineering Department, Kennedy Road, Near R.T.O., Pune, Maharashtra 411 001 (India)

2010-11-15

In recent small and medium capacity refrigeration systems, the condenser tubes are provided with micro-fins from inside. The vapour refrigerant at the compressor outlet and the condenser inlet is in superheat state. As it advances in the condenser it is in two phases and at the outlet it is in sub cooled liquid. The heat transfer coefficient (HTC) during condensation of HFC-134a and R-404A in a smooth (8.56 mm ID) and micro-fin tubes (8.96 mm ID) are experimentally investigated. Different from previous studies, the present experiments are performed for various condensing temperatures, with superheating and sub cooling and using hermetically sealed compressor. The test runs are done at average saturated condensing temperatures ranging from 35 C to 60 C. The mass fluxes are between 90 and 800 kg m{sup -2} s{sup -1}. The experimental results indicate that the average HTC increases with mass flux but decreases with increasing condensing temperature for both smooth and micro-fin tubes. The average condensation HTCs of HFC-134a and R-404A for the micro-fin tubes were 1.5-2.5 and 1.3-2 times larger than that in smooth tube respectively. The HTCs for R-404A are less than that of HFC-134a. New correlations based on the data gathered during the experimentation for predicting condensation HTCs are proposed for wide range of operating conditions. (author)

Flow condensation heat transfer coefficients of R22, R134a, R407C, and R410A inside plain and microfin tubes

Energy Technology Data Exchange (ETDEWEB)

Jung, Dongsoo; Cho, Youngmok; Park, Kiho [Inha Univ., Incheon (Korea). Dept. of Mechanical Engineering

2004-01-01

Flow condensation heat transfer coefficients (HTCs) of R22, R134a, R407C, and R410A inside horizontal plain and microfin tubes of 9.52 mm outside diameter and 1 m length were measured at the condensation temperature of 40{sup o}C with mass fluxes of 100, 200, and 300 kg m{sup -2} s{sup -1} and a heat flux of 7.7-7.9 kW m{sup -2}. For a plain tube, HTCs of R134a and R410A were similar to those of R22 while HTCs of R407C are 11-15% lower than those of R22. For a microfin tube, HTCs of R134a were similar to those of R22 while HTCs of R407C and R410A were 23-53% and 10-21% lower than those of R22. For a plain tube, our correlation agreed well with the present data for all refrigerants exhibiting a mean deviation of 11.6%. Finally, HTCs of a microfin tube were 2-3 times higher than those of a plain tube and the heat transfer enhancement factor decreased as the mass flux increased for all refrigerants tested. (Author)

Daily variation of I-131, Cs-134 and Cs-137 activity concentrations in the atmosphere in Osaka during the early phase after the FDNPP accident

International Nuclear Information System (INIS)

Zijian Zhang; Kazuhiko Ninomiya; Naruto Takahashi; Atsushi Shinohara

2015-01-01

To investigate the time variations of radionuclides discharged from the Fukushima Daiichi nuclear power plants accident, we started collecting aerosol samples in Osaka, Japan, using a high-volume sampler from March 15 to May 1, 2011. Atmospheric radioactivity concentrations of I-131, Cs-134 and Cs-137 were measured with germanium semi-conductor detectors. Only I-131 was detected in the early phase and two Cs-134.137 peaks were found in Osaka in April. Using the HYSPLIT model, we concluded that direct transportation of the air mass from the Fukushima area was responsible for such events. (author)

Genetically divergent strains of feline immunodeficiency virus from the domestic cat (Felis catus) and the African lion (Panthera leo) share usage of CD134 and CXCR4 as entry receptors.

Science.gov (United States)

McEwan, William A; McMonagle, Elizabeth L; Logan, Nicola; Serra, Rodrigo C; Kat, Pieter; Vandewoude, Sue; Hosie, Margaret J; Willett, Brian J

2008-11-01

The env open reading frames of African lion (Panthera leo) lentivirus (feline immunodeficiency virus [FIV(Ple)]) subtypes B and E from geographically distinct regions of Africa suggest two distinct ancestries, with FIV(Ple)-E sharing a common ancestor with the domestic cat (Felis catus) lentivirus (FIV(Fca)). Here we demonstrate that FIV(Ple)-E and FIV(Fca) share the use of CD134 (OX40) and CXCR4 as a primary receptor and coreceptor, respectively, and that both lion CD134 and CXCR4 are functional receptors for FIV(Ple)-E. The shared usage of CD134 and CXCR4 by FIV(Fca) and FIV(Ple)-E may have implications for in vivo cell tropism and the pathogenicity of the E subtype among free-ranging lion populations.

Five-membered heterocycles. Part II. Crystal structures and HOMA index calculations for selected 1,3,4-thiadiazole derivatives

Science.gov (United States)

Mrozek, A.; Karolak-Wojciechowska, J.; Amiel, P.; Barbe, J.

2000-06-01

Crystal structures of four bisubstituted 1,3,4-thiadiazole derivatives were determined. Detailed description of the five-membered heteroring geometry is enabled thorough analysis of ring aromaticity. For this purpose the HOMA index was used as a quantitative measure of aromaticity. The calculated HOMA indices evidenced the role of substituents. In particular, increase in the substituent electrophilicity brings about increase in aromaticity.

Synthesis and antibacterial activity of some derivatives of 1,3,4-thia-dia-zol[3,2-a]pyrimidine

International Nuclear Information System (INIS)

Sangov, Z.G.

2004-01-01

The purpose of this work is direct synthesis of derivatives of 1,3,4-thia-dia-zol[3,2-a]pyrimidine containing functional groups in second and sixth position of cycle, studying antibacterial activity obtained compounds on culture fungus, typical for this region and searching for new high-effective biologically active matters with low toxicity which let wide assortment of medicinal preparations

ANALISIS PERBANDINGAN EVAPORATOR KULKAS (LEMARI ES DENGAN MENGUNAKAN REFRIGERANT R-22 DAN R-134A

Directory of Open Access Journals (Sweden)

Imam Faozan

2017-03-01

Full Text Available Tulisan ini bertujuan untuk mengetahui komponen mesin refrigerasi khususnya pembahasan evaporator. Dalam penelitian ini digunakan lemari pendingin (kulkas sederhana untuk pengawetan dan pendinginan bahan makanan dalam rumah tangga. Untuk refrigerant yang digunakan adalah Refrigerant Freon  R – 22 dan  Freon R - 134a sebagai perbandingan dan untuk mengetahui performance evaporator ( COP pada mesin refrigerasi untuk rumah tangga. Lemari pendingin yang dianalisa berukuran tinggi  = 1 m, panjang  = 0,55 m  dan lebar 0,5 m. Temperatur evaporasi = -5°C dan temperature kondensasi = 40°C.

Cesium-134 and cesium-137 in honey bees and cheese samples collected in the U. S. after the Chernobyl accident

Energy Technology Data Exchange (ETDEWEB)

Ford, B C; Jester, W A; Griffith, S M; Morse, R A; Zall, R R; Lisk, D J; Burgett, D M; Bodyfelt, F W

1988-01-01

As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence.

Synthesis of carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinolinium derivatives as new potential PET SK{sub Ca} channel imaging agents

Energy Technology Data Exchange (ETDEWEB)

Gao Mingzhang; Wang Min [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States); Zheng Qihuang [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States)], E-mail: qzheng@iupui.edu

2008-02-15

Small conductance Ca{sup 2+}-activated K{sup +} (SK{sub Ca}) channels play an important role in many functions such as neuronal communication and behavioral plasticity, secretion, and cell proliferation. SK{sub Ca} channel modulation is associated with various brain, heart, and cancer diseases. N-methyl-laudanosine and its structurally related derivatives, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums, are reversible and selective SK{sub Ca} channel blockers. Carbon-11 labeled N-methyl-laudanosine and its tetrahydroisoquinolinium derivatives may serve as new probes for positron emission tomography (PET) to image SK{sub Ca} channels in the brain, heart, and cancer. The key intermediates, substituted isoquinolines (3a-c), were synthesized using a modification of the Pomeranz-Fritsch procedure. The precursors, substituted 1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinolines (8a-c), and their corresponding reference standards, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums (9a-c), were synthesized from compounds 3a-c with 3,4-dimethoxybenzyl chloride (2) in multiple steps with moderate to excellent chemical yields. The precursor 6,7-dimethoxy-1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3, 4-tetrahydroisoquinoline (10) was commercially available, and the methylation of compound 10 with methyl iodide provided N-methyl-laudanosine (11). The target quaternary ammonium tracers, carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums ([{sup 11}C]9a-c and [{sup 11}C]11), were prepared by N-[{sup 11}C]methylation of the tertiary amine precursors (8a-c and 10) with [{sup 11}C]methyl triflate and isolated by a simplified solid-phase extraction (SPE) purification using a SiO{sub 2} or cation-exchange CM Sep-Pak cartridge in 40-65% radiochemical yields.

A Novel 2.3 Mb Microduplication of 9q34.3 Inserted into 19q13.4 in a Patient with Learning Disabilities

Directory of Open Access Journals (Sweden)

Shalinder Singh

2012-01-01

Full Text Available Insertional translocations in which a duplicated region of one chromosome is inserted into another chromosome are very rare. We report a 16.5-year-old girl with a terminal duplication at 9q34.3 of paternal origin inserted into 19q13.4. Chromosomal analysis revealed the karyotype 46,XX,der(19ins(19;9(q13.4;q34.3q34.3pat. Cytogenetic microarray analysis (CMA identified a ~2.3Mb duplication of 9q, which was confirmed by Fluorescence in situ hybridisation (FISH. The duplication at 9q34.3 is the smallest among the cases reported so far. The proband exhibits similar clinical features to those previously reported cases with larger duplication events.

A simple preparation of calibration curve standards of 134Cs and 137Cs by serial dilution of a standard reference material

International Nuclear Information System (INIS)

Labrecque, J.J.; Rosales, P.A.

1990-01-01

Two sets of calibration standards for 134 Cs and 137 Cs were prepared by small serial dilution of a natural matrix standard reference material, IAEA-154 whey powder. The first set was intended to screen imported milk powders which were suspected to be contaminated with 134 Cs and 137 Cs. Their concentration ranged from 40 to 400 Bq/kg. The other set of calibration standards was prepared to measure the environmental levels of 137 Cs in commercial Venezuelan milk powders. Their concentration ranged from 3 to 10 Bq/kg of 137 Cs. The accuracy of these calibration curves was checked by IAEA-152 and A-14 milk powders. Their measured values were in good agreement with their certified values. Finally, it is shown that these preparation techniques using serial dilution of a standard reference material were simple, rapid, precise, accurate and cost-effective. (author) 5 refs.; 5 figs.; 3 tabs

Investigations on caesium 134 and 137 contamination of game hunted for food in Hessia

International Nuclear Information System (INIS)

Hadlock, R.M.; Harju, H.; Sattler, E.L.; Wagner, G.

1990-01-01

The amount of caesium 134 and 137 in Hessian game hunted for food (556 animals) after the reactor accident at Chernobyl was investigated. Comparisons have been made before and after the accident. Although there was only a very low level of contamination, the contamination rate of different species varied; on average, the Red Deer showed the highest activity (130 Bq/kg). The level of caesium contamination was mostly influenced by the permanent habitat of the animals. The main influence was due to regional, geographical and meteorological conditions. The influence of age or sex could not be determined. The contamination rate was shown to decrease with time [de

Bis{N-[5-(4-methoxyphenyl-1,3,4-oxadiazol-2-yl]ethanimidamidato}copper(II

Directory of Open Access Journals (Sweden)

Yacine Djebli

2010-04-01

Full Text Available The title compound, [Cu(C11H11N4O22], was prepared by solvothermal synthesis using 2-amino-5-(4-methoxyphenyl-1,3,4-oxadiazole and copper sulfate pentahydrate in an acetonitrile solution. The CuII atom lies on an inversion center and is four-coordinated in a slightly distorted square-planar geometry by four N atoms of the ligands obtained from the formation of a bond between the amine N atom of the oxadiazole molecule and the nitrile C atom of the solvent. In the crystal structure an intermolecular N—H...N hydrogen bond links inversion-related molecules.

Viscosity measurements and correlations of binary mixtures: 1,1,1,2-tetrafluoroethane (HFC-134a)+tetraethylene glycol dimethylether (TEGDME)

DEFF Research Database (Denmark)

Monsalvo, Matias Alfonso; Baylaucq, A.; Reghem, P.

2005-01-01

.15-373.15 K. The measurements have been carried out with a failing body viscometer for four molar fractions x(1) =(0.28, 0.44, 0.63 and 0.88). The density values of this system were interpolated from previous results obtained at the laboratory. All of the available viscosity data, including pure HFC-134a...

Results of radiofrequency ablation of liver tumors: experience of 134 cases

Directory of Open Access Journals (Sweden)

Marcelo Augusto Fontenelle Ribeiro Junior

2008-12-01

Full Text Available Objective: To study radiofrequency ablation of primary and metastatic livertumors. Methods: The authors present a series of 134 cases, 63 femalesand 71 males with a mean age of 61.2 years, in whom radiofrequencyablation was used either by laparotomy or percutaneously to treat 203lesions. The group was composed of 51 cases of hepatocellular carcinoma,four cases of cholangiocarcinoma, and cases of hepatic metastases, asfollows: 64 of colorectal cancer, 6 of neuroendocrine tumors, 5 of breastcancer, 1 case of pancreas cancer, 1 of kidney cancer, 1 of endometrialcancer and 1 of leiomyosarcoma. Results: Procedure-associatedmorbidity/mortality was 24.8 and 3.7%, respectively. Recurrence wasobserved in 12.7% within a mean time of 10.5 months. Conclusions:Radiofrequency ablation is a safe procedure and can be used in patientswith impaired hepatic function. For metastatic diseases, it does notreplace surgery but it can be associated with other procedures, such assurgery and transarterial chemoembolization, or after recurrence, leadingto greater probability of remaining disease-free.

Deletion of hepatic FoxO1/3/4 genes in mice significantly impacts on glucose metabolism through downregulation of gluconeogenesis and upregulation of glycolysis.

Directory of Open Access Journals (Sweden)

Xiwen Xiong

Full Text Available Forkhead transcription factors FoxO1/3/4 have pleiotrophic functions including anti-oxidative stress and metabolism. With regard to glucose metabolism, most studies have been focused on FoxO1. To further investigate their hepatic functions, we generated liver-specific FoxO1/3/4 knockout mice (LTKO and examined their collective impacts on glucose homeostasis under physiological and pathological conditions. As compared to wild-type mice, LTKO mice had lower blood glucose levels under both fasting and non-fasting conditions and they manifested better glucose and pyruvate tolerance on regular chow diet. After challenged by a high-fat diet, wild-type mice developed type 2 diabetes, but LTKO mice remained euglycemic and insulin-sensitive. To understand the underlying mechanisms, we examined the roles of SIRT6 (Sirtuin 6 and Gck (glucokinase in the FoxO-mediated glucose metabolism. Interestingly, ectopic expression of SIRT6 in the liver only reduced gluconeogenesis in wild-type but not LTKO mice whereas knockdown of Gck caused glucose intolerance in both wild-type and LTKO mice. The data suggest that both decreased gluconeogenesis and increased glycolysis may contribute to the overall glucose phenotype in the LTKO mice. Collectively, FoxO1/3/4 transcription factors play important roles in hepatic glucose homeostasis.

Novel histone deacetylase 8-selective inhibitor 1,3,4-oxadiazole-alanine hybrid induces apoptosis in breast cancer cells.

Science.gov (United States)

Pidugu, Vijaya Rao; Yarla, Nagendra Sastry; Bishayee, Anupam; Kalle, Arunasree M; Satya, Alapati Krishna

2017-11-01

Identification of isoform-specific histone deacetylase inhibitors (HDACi) is a significant advantage to overcome the adverse side effects of pan-HDACi for the treatment of various diseases, including cancer. We have designed, and synthesized novel 1,3,4 oxadiazole with glycine/alanine hybrids as HDAC8-specific inhibitors and preliminary evaluation has indicated that 1,3,4 oxadiazole with alanine hybrid [(R)-2-amino-N-((5-phenyl-1,3,4-oxadiazol-2-yl)methyl)propanamide (10b)] to be a potent HDAC8 inhibitor. In the present study, the in vitro efficacy of the molecule in inhibiting the cancer cell proliferation and the underlying molecular mechanism was studied. 10b inhibited the growth of MDA-MB-231 and MCF7 breast cancer cells, with a lower IC 50 of 230 and 1000 nM, respectively, compared to K562, COLO-205 and HepG2 cells and was not cytotoxic to normal breast epithelial cells, MCF10A. 10b was specific to HDAC8 and did not affect the expression of other class I HDACs. Further, a dose-dependent increase in H3K9 acetylation levels demonstrated the HDAC-inhibitory activity of 10b in MDA-MB-231 cells. Flow cytometric analysis indicated a dose-dependent increase and decrease in the percent apoptotic cells and mitochondrial membrane potential, respectively, when treated with 10b. Immunoblot analysis showed a modulation of Bax/Bcl2 ratio with a decrease in Bcl2 expression and no change in Bax expression. 10b treatment resulted in induction of p21 and inhibition of CDK1 proteins along with cytochrome c release from mitochondria, activation of caspases-3 and -9 and cleavage of poly ADP-ribose polymerase leading to apoptotic death of MDA-MB-231 and MCF7 cells. In conclusion, our results clearly demonstrated the efficacy of 10b as an anticancer agent against breast cancer.

Energy savings with the effect of magnetic field using R290/600a mixture as substitute for CFC12 and HFC134a

Directory of Open Access Journals (Sweden)

Mani Kolandavel

2008-01-01

Full Text Available This paper presents an experimental study on the replacement of CFC12 and HFC134a by the new R290/R600a refrigerant mixture as drop-in replacement refrigerant with and without the effect of magnetic field. Without any modification to the system components drop-in experimental tests were performed on a vapour compression refrigeration system with a reciprocating compressor, which was originally designed to operate with CFC12.The test results with no magnets showed that the refrigerant R290/R600a had 19.9-50.1% higher refrigerating capacity than R12 and 28.6-87.2% than R134a. The mixture R290/R600a consumed 6.8- -17.4% more energy than R12. The coefficient of performance of R290/R600a mixture increases from 3.9-25.1% than R12 at lower evaporating temperatures and 11.8-17.6% at higher evaporating temperatures. The effect of magnetic field force reduced the compressor energy consumption by 1.5-2.5% than with no magnets. The coefficient of performance of the system was higher in the range 1.5-2.4% with the effect of magnetic field force. The R290/600a (68/32 by wt.% mixture can be considered as an excellent alternative refrigerant for CFC12 and HFC134a systems.

Stable isotope tracer marking of individual boll weevils

International Nuclear Information System (INIS)

James, W.D.; Showler, A.T.; Armstrong, J.S.; Westbrook, J.K.

2006-01-01

Stable isotope markers have been used to study animal nutrition for several decades and more recently to study the foraging and cultural habits of imported fire ants. In this work, we have extended that effort to evaluate the potential for marking boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), with the rare earth element samarium to aid in studies of insect invasion and pest eradication protocols. Neutron activation analysis (NAA) was performed on the marked boll weevils as well as plant material from the cotton squares on which the insects were fed. Samarium levels in non-dosed insects average about 20 ng/g or about 100 pg total element per insect. Our computed average determination limit was 36 pg samarium/weevil. The determination limit for cotton plant squares and leaves averaged 3.5 ng/g and 8.2 ng/g, respectively. These initial results indicate the NAA method is capable of identifying individual marked insects which have assimilated 1 ng of samarium, a ten-fold increase in content over average blank values. (author)

Synthesis, crystal structures, computational studies and antimicrobial activity of new designed bis((5-aryl-1,3,4-oxadiazol-2-yl)thio)alkanes

Science.gov (United States)

Ahmed, Muhammad Naeem; Sadiq, Beenish; Al-Masoudi, Najim A.; Yasin, Khawaja Ansar; Hameed, Shahid; Mahmood, Tariq; Ayub, Khurshid; Tahir, Muhammad Nawaz

2018-03-01

A new series of bis((5-aryl-1,3,4-oxadiazol-2-yl)thio)alkanes 4-14 have been synthesized via nucleophilic substitution reaction of dihaloalkanes with respective 1,3,4-oxadiazole-2-thiols 3a-f, and characterized by spectroscopic techniques. The structures of 4 and 12 were unambiguously confirmed by single-crystal X-ray diffraction analysis. Density functional theory calculations at B3LYP/6-31 + G(d) level of theory were performed for comparison of X-ray geometric parameters, molecular electrostatic potential (MEP) and frontier molecular orbital analyses of synthesized compounds. MEP analysis revealed that these compounds are nucleophilic in nature. Frontier molecular orbitals (FMOs) analysis of 4-14 was performed for evaluation of kinetic stability. All synthesized compounds were screened in vitro for antimicrobial activity against three bacterial and three fungal strains and showed promising results.

Measurement of metabolism of worker ants by using the elimination of caesium-134

International Nuclear Information System (INIS)

Nielsen, M.G.; Jensen, T.F.

1977-01-01

In order to find a method for measuring field metabolism of worker ants the elimination of 134 Cs by two ant species has been investigated. Equations relating temperature to radiocaesium elimination and metabolism have been found. From these equations the relationship between elimination and metabolism is calculated. Consequently, the elimination of the isotope can be used for measuring metabolism. A pilot field experiment with Lasius alienus (Foerst.) reveals that the traditional methods of estimating field metabolism give values which are considerably lower than the value based on caesium elimination rate. This difference is supposed to be mainly due to greater motor activity of the animals in the field. Consequently, the value of the caesium elimination method is closer to the 'true' value of field metabolism. (orig.) [de

Verandering van die moreel-etiese situasie in Suid-Afrika in die lig van die kenmotief in 2 Petrus 1:3-4

Directory of Open Access Journals (Sweden)

D.G. Breed

2000-08-01

Full Text Available The change in the moral-ethical situation in South Africa, in the light of the motif of knowing in 2 Peter 1:3-4 In this article it is argued that in 2 Peter 1:3-4 a motif of knowing is present as a clearly repeated and meaningful semantic unit. An attempt is made to indicate that a profound knowledge of Jesus Christ was instrumental in giving the apostles accepted religious beliefs. These accepted beliefs enabled the apostles to act in such a manner that their behaviour reflected correct religious beliefs and attitudes. The profound knowledge of Jesus Christ also played an important role in the establishment of a covenantal relationship between God and the first readers of 2 Peter. This knowledge also enabled these readers to withstand the moral corruption in the world. In conclusion the possible significance of the motif of knowing in 2 Peter in changing the present South African moral-ethical situation is highlighted.

Structural and superconducting properties of (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} grown by MOCVD on samarium zirconate buffered IBAD-MgO

Energy Technology Data Exchange (ETDEWEB)

Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X [Los Alamos National Laboratory, PO Box 1663, Los Alamos, NM 87545 (United States); Chen, Y; Selvamanickam, V [SuperPower, Incorporated, 450 Duane Avenue, Schenectady, NY 12304 (United States)

2008-10-01

Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 {mu}m thick (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9{sup 0} and 3.4{sup 0} for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J{sub c}) of over 2 MA cm{sup -2} at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J{sub c} and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd){sub 2}O{sub 3} particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes.