WorldWideScience

Sample records for salmon trypsin stimulates

  1. Salmon trypsin stimulates the expression of interleukin-8 via protease-activated receptor-2

    International Nuclear Information System (INIS)

    Larsen, Anett K.; Seternes, Ole-Morten; Larsen, Merethe; Aasmoe, Lisbeth; Bang, Berit

    2008-01-01

    In this study, we focus on salmon trypsin as an activator of inflammatory responses in airway cells in vitro. The rationale behind the investigation is that salmon industry workers are exposed to aerosols containing enzymes, which are generated during industrial processing of the fish. Knowing that serine proteases such as trypsin are highly active mediators with diverse biological activities, the stimulation of nuclear factor-kappa B (NF-κB) and interleukin (IL)-8 and the role of protease-activated receptors (PAR) in inflammatory signal mediation were investigated. Protease-activated receptors are considered important under pathological situations in the human airways, and a thorough understanding of PAR-induced cellular events and their consequences in airway inflammation is necessary. Human airway epithelial cells (A549) were exposed to trypsin isolated from fish (Salmo salar), and we observed that purified salmon trypsin could generate secretion of IL-8 in a concentration-dependent manner. Furthermore, we demonstrate that PAR-2 activation by salmon trypsin is coupled to an induction of NF-κB-mediated transcription using a PAR-2 transfected HeLa cell model. Finally, we show that the release of IL-8 from A549 following stimulation with purified salmon trypsin is mediated through activation of PAR-2 using specific small interfering RNAs (siRNAs). The results presented suggest that salmon trypsin, via activation of PAR-2, might influence inflammation processes in the airways if inhaled in sufficient amounts

  2. Extraction of gelatin from salmon (Salmo salar) fish skin using trypsin-aided process: optimization by Plackett-Burman and response surface methodological approaches.

    Science.gov (United States)

    Fan, HuiYin; Dumont, Marie-Josée; Simpson, Benjamin K

    2017-11-01

    Gelatin from salmon ( Salmo salar ) skin with high molecular weight protein chains ( α -chains) was extracted using trypsin-aided process. Response surface methodology was used to optimise the extraction parameters. Yield, hydroxyproline content and protein electrophoretic profile via sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis of gelatin were used as responses in the optimization study. The optimum conditions were determined as: trypsin concentration at 1.49 U/g; extraction temperature at 45 °C; and extraction time at 6 h 16 min. This response surface optimized model was significant and produced an experimental value (202.04 ± 8.64%) in good agreement with the predicted value (204.19%). Twofold higher yields of gelatin with high molecular weight protein chains were achieved in the optimized process with trypsin treatment when compared to the process without trypsin.

  3. Trypsin radioimmunoassay

    International Nuclear Information System (INIS)

    Scheithauer, R.; Wolf, F.; Tympner, F.

    1981-01-01

    In 29 patients with suspicion of pancreatic disease standard secretin-pancreozymin-test was performed parallel to trypsin determination by radioimmunoassay before and after stimulation with secretin. Mean serum trypsin in normal subjects was 175 ng BIT/ml (range 90-250), the maximum after stimulation being 20 minutes after secreting injection (range 110-550). Preliminary normal values are 270 ng BIT/ml for basal concentration and 650 ng BIT/ml for 20 min after secretin stimulation. In the group of normals there was no case of misinterpretation. In patients with several pathological parameters (n = 10) basal trypsin concentration was increased in 7 cases, the stimulated value was concordant with the definite diagnosis in every case. Significant advantage for diagnostics was derived in patients having had pancreatic diseases before, however being actually normal with respect to standard diagnostic parameters. All these patients revealed increased trypsin concentrations after stimulation and 50% of them showed increased basal values. Equivocal results were seen in patients with endstage pancreatitis as well as in case of obstruction during reduced secretion. (orig.) [de

  4. Aggregation of trypsin and trypsin inhibitor by Al cation.

    Science.gov (United States)

    Chanphai, P; Kreplak, L; Tajmir-Riahi, H A

    2017-04-01

    Al cation may trigger protein structural changes such as aggregation and fibrillation, causing neurodegenerative diseases. We report the effect of Al cation on the solution structures of trypsin (try) and trypsin inhibitor (tryi), using thermodynamic analysis, UV-Visible, Fourier transform infrared (FTIR) spectroscopic methods and atomic force microscopy (AFM). Thermodynamic parameters showed Al-protein bindings occur via H-bonding and van der Waals contacts for trypsin and trypsin inhibitor. AFM showed that Al cations are able to force trypsin into larger or more robust aggregates than trypsin inhibitor, with trypsin 5±1 SE (n=52) proteins per aggregate and for trypsin inhibitor 8.3±0.7 SE (n=118). Thioflavin T test showed no major protein fibrillation in the presence of Al cation. Al complexation induced more alterations of trypsin inhibitor conformation than trypsin. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. The kinetics of interaction of porcine - alpha-, and porcine - beta -trypsin with intact and modified soybean trypsin inhibitor (kunitz)

    International Nuclear Information System (INIS)

    Hamid, M.A.

    1994-01-01

    The association of porcine trypsin with soybean trypsin inhibitor (Kunitz) resulted in characteristic changes in absorption spectrum, indicating an alteration of the micro environments of the enzyme chromophores as a consequence of the interaction. The rates of formation of the stable trypsin - inhibitor complexes from porcine - alpha - trypsin and soybean trypsin inhibitor and from porcine - beta - trypsin and either intact or modified soybean trypsin inhibitor were measured by mixing the equimolar concentration of the reactants in a Stopped - Flow apparatus at pH (4.5 to 10.0). The reaction of trypsin with soybean trypsin inhibitor was of first order with respect to the concentration of the reactants used. The rates of dissociation of the stable complexes, alpha - trypsin - soybean trypsin inhibitor, beta -trypsin - soybean trypsin inhibitor and beta -trypsin modified soybean trypsin inhibitor were also measured at pH (1.92 to 3.58). The values of first order rate constant, k/sub D/ obtained for the dissociation of all the three complexes were identical with one another. The kinetics results obtained for the porcine trypsin were compared with those of bovine trypsin system and it was suggested that the reaction mechanisms in both these systems were identical. (author)

  6. Bovine Pancreatic Trypsin Inhibitor-Trypsin Complex as a Detection System for Recombinant Proteins

    Science.gov (United States)

    Borjigin, Jimo; Nathans, Jeremy

    1993-01-01

    Bovine pancreatic trypsin inhibitor (BPTI) binds to trypsin and anhydrotrypsin (an enzymatically inactive derivative of trypsin) with affinities of 6 x 10-14 and 1.1 x 10-13 M, respectively. We have taken advantage of the high affinity and specificity of this binding reaction to develop a protein tagging system in which biotinylated trypsin or biotinylated anhydrotrypsin is used as the reagent to detect recombinant fusion proteins into which BPTI has been inserted. Two proteins, opsin and growth hormone, were used as targets for insertional mutagenesis with BPTI. In each case, both domains of the fusion protein appear to be correctly folded. The fusion proteins can be specifically and efficiently detected by biotinylated trypsin or biotinylated anhydrotrypsin, as demonstrated by staining of transfected cells, protein blotting, affinity purification, and a mobility shift assay in SDS/polyacrylamide gels.

  7. Inga laurina trypsin inhibitor (ILTI) obstructs Spodoptera frugiperda trypsins expressed during adaptive mechanisms against plant protease inhibitors.

    Science.gov (United States)

    Machado, Suzy Wider; de Oliveira, Caio Fernando Ramalho; Zério, Neide Graciano; Parra, José Roberto Postali; Macedo, Maria Lígia Rodrigues

    2017-08-01

    Plant protease inhibitors (PIs) are elements of a common plant defense mechanism induced in response to herbivores. The fall armyworm, Spodoptera frugiperda, a highly polyphagous lepidopteran pest, responds to various PIs in its diet by expressing genes encoding trypsins. This raises the question of whether the PI-induced trypsins are also inhibited by other PIs, which we posed as the hypothesis that Inga laurina trypsin inhibitor (ILTI) inhibits PI-induced trypsins in S. frugiperda. In the process of testing our hypothesis, we compared its properties with those of selected PIs, soybean Kunitz trypsin inhibitor (SKTI), Inga vera trypsin inhibitor (IVTI), Adenanthera pavonina trypsin inhibitor (ApTI), and Entada acaciifolia trypsin inhibitor (EATI). We report that ILTI is more effective in inhibiting the induced S. frugiperda trypsins than SKTI and the other PIs, which supports our hypothesis. ILTI may be more appropriate than SKTI for studies regarding adaptive mechanisms to dietary PIs. © 2017 Wiley Periodicals, Inc.

  8. Free radical inactivation of trypsin

    International Nuclear Information System (INIS)

    Cudina, Ivana; Jovanovic, S.V.

    1988-01-01

    Reactivities of free radical oxidants, radical OH, Br2-anion radical and Cl 3 COO radical and a reductant, CO2-anion radical, with trypsin and reactive protein components were determined by pulse radiolysis of aqueous solutions at pH 7, 20 0 C. Highly reactive free radicals, radical OH, Br2-anion radical and CO2-anion radical, react with trypsin at diffusion controlled rates. Moderately reactive trichloroperoxy radical, k(Cl 3 COO radical + trypsin) preferentially oxidizes histidine residues. The efficiency of inactivation of trypsin by free radicals is inversely proportional to their reactivity. The yields of inactivation of trypsin by radical OH, Br2-anion radical and CO2-anion radical are low, G(inactivation) = 0.6-0.8, which corresponds to ∼ 10% of the initially produced radicals. In contrast, Cl 3 COO radical inactivates trypsin with ∼ 50% efficiency, i.e. G(inactivation) = 3.2. (author)

  9. Hormonal regulation of lipid metabolism in developing coho salmon, Oncorhynchus kisutch

    International Nuclear Information System (INIS)

    Sheridan, M.A.

    1985-01-01

    Lipid metabolism in juvenile coho salmon is characterized, and adaptive changes in lipid mobilization are described in relation to development and hormonal influences. The rates of lipogenesis and lipolysis were determined in selected tissues of juvenile salmon during the period of seawater preadaptive development (smoltification). Neutral lipid (sterol) and fatty acid synthesis in the liver and mesenteric fat was measured by tritium incorporation. Fatty acid synthesis in the liver and mesenteric fat decreased by 88% and 81%, respectively, between late February (parr) and early June (smolt). To assess the role of hormones in smoltification-associated lipid depletion, growth hormone, prolactin, thyroxin and cortisol were administered in vivo early in development (parr) to determine if any of these factors could initiate the metabolic responses normally seen later in development (smolt). Growth hormone stimulated lipid mobilization from coho salmon parr. Prolactin strongly stimulated lipid mobilization in coho parr. Thyroxin and cortisol also stimulated lipid mobilization for coho salmon parr. The direct effect of hormones was studied by in vitro pH-stat incubation of liver slices. These data suggest that norepinephrine stimulates fatty acid release via β-adrenergic pathways. Somatostatin and its partial analogue from the fish caudal neurosecretory system, urotensin II, also affect lipid mobilization. These results establish the presence of hormone-sensitive lipase in salmon liver and suggest that the regulation of lipid metabolism in salmon involves both long-acting and short-acting hormonal agents

  10. Hydrogen exchange kinetics changes upon formation of the soybean trypsin inhibitor: trypsin complex

    International Nuclear Information System (INIS)

    Woodward, C.K.; Ellis, L.M.

    1975-01-01

    The hydrogen exchange kinetics of the complex of trypsin--soybean trypsin inhibitor (Kunitz) have been compared to the calculated sum of the exchange kinetics for the inhibitor and trypsin measured separately. The exchange rates observed for the complex are substantially less than the sum of the exchange rates in the two individual proteins. These results cannot be accounted for by changes in intermolecular or intramolecular hydrogen bonding. The decrease in exchange rates in the complex are ascribed to changes in solvent accessibility in the component proteins. (U.S.)

  11. Smart PEGylation of trypsin.

    Science.gov (United States)

    Zarafshani, Zoya; Obata, Toshihiro; Lutz, Jean-François

    2010-08-09

    Thermoresponsive oligo(ethylene glycol)-based copolymers were investigated for trypsin conjugation. These copolymers have been synthesized by atom transfer radical polymerization of 2-(2-methoxyethoxy)ethyl methacrylate (MEO(2)MA) with oligo(ethylene glycol) methyl ether methacrylate (OEGMA(475), M(n) = 475 g.mol(-1)) at 60 degrees C in the presence of copper(I) chloride and 2,2'-bipyridyl. Two different ATRP initiators, containing succinimidyl ester moieties, were tested, namely, N-succinimidyl-2-bromopropionate and N-succinimidyl-2-bromoisobutyrate. In both cases, ATRP afforded well-defined polymers with a narrow molecular weight distribution and controlled chain-ends. However, the efficiency of initiation of the two initiators was lower than 1 and therefore the formed polymers exhibited a higher than expected mean degree of polymerization. Nevertheless, all types of polymers could be conjugated to trypsin. The conjugation reaction was performed in borax-HCl buffer. Sodium dodecyl sulfate poly(acrylamide) gel electrophoresis (SDS-PAGE) indicated that polymer/enzyme conjugates were obtained in all cases. However, (co)polymers initiated by N-succinimidyl-2-bromopropionate led to the best conjugation results. The formed P(MEO(2)MA-co-OEGMA(475))-trypsin conjugates were found to be thermoresponsive and moreover exhibited a higher enzymatic activity than unmodified trypsin.

  12. HYDROLYSIS OF CHEESEWHEY PROTEINSWITH TRYPSIN, CHYMOTRYPSINAND CARBOXYPEPTIDASEA

    Directory of Open Access Journals (Sweden)

    M. F. CUSTÓDIO

    2009-01-01

    Full Text Available

    This work presents a method for adding value to cheese whey residues by whey proteins hydrolysis, using trypsin, chymotrypsin and carboxypeptidase A as catalysts. Sweet cheese whey was dialyzed and filtered in kaolin. Lactose and protein contents were analyzed after each step. The activities of bovine pancreas trypsin and chymotrypsin were measured at different pHs and temperatures. The optimal pH for the hydrolysis of whey proteins was 9.0 for both enzymes. Optima temperatures were 60ºC for trypsin, and 50ºC for chymotrypsin. Trypsin exhibited typical Michaelis-Menten behavior, but chymotrypsin did not. Electrophoretic analysis showed that neither trypsin nor chymotrypsin alone hydrolyzed whey proteins in less than three hours. Hydrolysis rates of -lactalbumin by trypsin, and of bovine serum albumin by chymotrypsin were low. When these enzymes were combined, however, all protein fractions were attacked and rates of hydrolysis were enhanced by one order of magnitude. The addition of carboxypeptidase A to the others enzymes did not improve the process yield.

  13. Radioimmunoassay of trypsin

    International Nuclear Information System (INIS)

    Stagg, B.H.; Wood, T.P.

    1979-01-01

    This review describes the development and application of a novel test to determine levels of human immunoreactive trypsin, an enzyme produced solely by the pancreas, in biological fluids. Being organ-specific, the assay of immunoreactive trypsin should be an ideal marker of pancreatic function, and this is supported by the results of a number of clinical and research investigations. Use of this assay in studies of chronic pancreatitis, juvenile-onset diabetes, and cystic fibrosis, has yielded much valuable data, and it is expected that further research will lead to and improved understanding of these and other conditions associated with the pancreas in health and disease. (author)

  14. Trypsin from the pyloric caeca of bluefish (Pomatomus saltatrix).

    Science.gov (United States)

    Klomklao, Sappasith; Benjakul, Soottawat; Visessanguan, Wonnop; Kishimura, Hideki; Simpson, Benjamin K

    2007-12-01

    Trypsin was purified from the pyloric caeca of bluefish (Pomatomus saltatrix) by ammonium sulfate precipitation, acetone precipitation and soybean trypsin inhibitor-Sepharose 4B affinity chromatography. Bluefish trypsin migrated as a single band using both sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and native-PAGE and had a molecular mass of 28 kDa. The optima pH and temperature for the hydrolysis of benzoyl-dl-arginine-p-nitroanilide (BAPNA) were 9.5 and 55 degrees C, respectively. The enzyme was stable over a broad pH range (7 to 12), but was unstable at acidic pH, and at temperatures greater than 40 degrees C. The enzyme was inhibited by specific trypsin inhibitors: soybean trypsin inhibitor (SBTI), N-p-tosyl-l-lysine chloromethyl ketone (TLCK) and the serine protease inhibitor phenylmethyl sulfonylfluoride (PMSF). CaCl2 partially protected trypsin against activity loss at 40 degrees C, but NaCl (0 to 30%) decreased the activity in a concentration dependent manner. The N-terminal amino acid sequence of trypsin was determined as IVGGYECKPKSAPVQVSLNL and was highly homologous to other known vertebrate trypsins.

  15. Laura: Soybean variety lacking Kunitz trypsin inhibitor

    Directory of Open Access Journals (Sweden)

    Srebrić Mirjana

    2010-01-01

    Full Text Available Grain of conventional soybean varieties requires heat processing to break down trypsin inhibitor's activity before using as food or animal feed. At the same time, protein denaturation and other qualitative changes occur in soybean grain, especially if the temperature of heating is not controlled. Two types of trypsin inhibitor were found in soybean grain the Kunitz trypsin inhibitor and the Bowman-Birk inhibitor. Mature grain of soybean Laura is lacking Kunitz trypsin inhibitor. Grain yield of variety Laura is equal to high yielding varieties from the maturity group I, where it belongs. Lacking of Kunitz-trypsin inhibitor makes soybean grain suitable for direct feeding in adult non ruminant animals without previous thermal processing. Grain of variety Laura can be processed for a shorter period of time than conventional soybeans. This way we save energy, and preserve valuable nutritional composition of soybean grain, which is of interest in industrial processing.

  16. Digestive efficiency, free amino acid pools and quality of growth performance in Atlantic salmon (Salmo salar L.) affected by light regimes and vaccine types.

    Science.gov (United States)

    Rungruangsak-Torrissen, Krisna; Sunde, Jan; Berg, Arne Erik; Nordgarden, Ulla; Fjelldal, Per Gunnar; Oppedal, Frode

    2009-06-01

    This study comprised the results of three different seawater trials using unique combination of techniques to study protease digestive efficiency and growth performance quality to illustrate the effects of light regimes and vaccine types in Atlantic salmon (Salmo salar L.). Fish with higher growth had higher trypsin (T) and chymotrypsin (C) specific activities with higher T/C ratio or slope T/C ratio [calculated from the regression between trypsin (y) and chymotrypsin (x) specific activities] in the pyloric caeca. The T/C ratios indicated fish growth rates over a period of 1-2 months, while the slope T/C ratios indicated fish growth rates at sampling. Adaptation period for adjustment to the new environment of continuous light was 70 days, indicated by the differences in trypsin specific activities and the crossing of slope T/C ratio regressions following with the changes in growth rate directions between the control and the treated group. Vaccine types affected fish vertebral growth, and additional continuous light enhanced the impact of vaccines on fish growth during springtime, indicated by differences in slope T/C ratios. Continuous light stimulated fish growth during winter to spring, when the natural day length was short, without significantly changing white muscle and oocyte qualities in the fish of about 500 g, except for significantly increased white muscle RNA concentration. Continuous light also reduced fish growth rate later during summer, when the natural day length was long, by precedently decreasing the T/C ratio in late spring. Interestingly, plasma levels of free lysine related to tryptic digestion were correlated with trypsin specific activity levels. Continuous light caused higher levels of most free amino acids (FAA) involved in nitrogen metabolism, higher incorporation of essential FAA for protein synthesis, and higher protein turnover rate (free hydroxyproline levels) in both plasma and white muscle. However, continuous light did not affect

  17. Fish trypsins: potential applications in biomedicine and prospects for production.

    Science.gov (United States)

    Jesús-de la Cruz, Kristal; Álvarez-González, Carlos Alfonso; Peña, Emyr; Morales-Contreras, José Antonio; Ávila-Fernández, Ángela

    2018-04-01

    In fishes, trypsins are adapted to different environmental conditions, and the biochemical and kinetic properties of a broad variety of native isoforms have been studied. Proteolytic enzymes remain in high demand in the detergent, food, and feed industries; however, our analysis of the literature showed that, in the last decade, some fish trypsins have been studied for the synthesis of industrial peptides and for specific biomedical uses as antipathogenic agents against viruses and bacteria, which have been recently patented. In addition, innovative strategies of trypsin administration have been studied to ensure that trypsins retain their properties until they exert their action. Biomedical uses require the production of high-quality enzymes. In this context, the production of recombinant trypsins is an alternative. For this purpose, E. coli -based systems have been tested for the production of fish trypsins; however, P. pastoris -based systems also seem to show great potential in the production of fish trypsins with higher production quality. On the other hand, there is a lack of information regarding the specific structures, biochemical and kinetic properties, and characteristics of trypsins produced using heterologous systems. This review describes the potential uses of fish trypsins in biomedicine and the enzymatic and structural properties of native and recombinant fish trypsins obtained to date, outlining some prospects for their study.

  18. Interaction of gallic acid with trypsin analyzed by spectroscopy

    Directory of Open Access Journals (Sweden)

    Hao Song

    2015-06-01

    Full Text Available The interactions between trypsin and gallic acid (GA were investigated by means of fluorescence spectroscopy, UV-vis absorption spectroscopy, resonance light scattering (RLS spectroscopy, synchronous fluorescence spectroscopy, and enzymatic inhibition assay. It was found that GA can cause the fluorescence quenching of trypsin during the process of formation of GA-trypsin complex, resulting in inhibition of trypsin activity (IC50 = 3.9 × 10−6 mol/L. The fluorescence spectroscopic data showed that the quenching efficiency can reach about 80%. The binding constants were 1.9371 × 104 L/mol, 1.8192 × 104 L/mol, and 1.7465 × 104 L/mol at three temperatures, respectively. The thermodynamic parameters revealed that hydrogen bonds, van der Waals, hydrophobic, and electrostatic interactions were involved in the binding process of GA to trypsin. Molecular modeling studies illustrated a specific display of binding information and explained most of the experiment phenomena. The microenvironments of tryptophan and tyrosine residue in trypsin were changed by the GA. Results indicated that GA was a strong quencher and inhibitor of trypsin.

  19. Enzymatic synthesis of gold nanoflowers with trypsin

    International Nuclear Information System (INIS)

    Li Linmei; Weng Jian

    2010-01-01

    A one-step and eco-friendly approach for the room-temperature synthesis of trypsin-mediated three-dimensional (3D) gold nanoflowers (AuNFs) with high colloidal stability is demonstrated. To prepare AuNFs, ascorbic acid (AA) was quickly added into the premixed solution of HAuCl 4 and trypsin at pH = 5.0. The results show that the molar ratio and feeding order of reactant agents, pH and reaction time play important roles in the formation of NFs. The growth mechanism of AuNFs is suggested as three steps: (1) immobilization of AuCl 4 - ions with a positively charged trypsin template, (2) spontaneous reduction of AuCl 4 - ions with AA in situ and capping Au 0 by 12 cysteines of trypsin, (3) reduction of more AuCl 4 - ions on the Au nuclei formed in the initial stages and anisotropic growth into AuNFs.

  20. Identifying salmon lice transmission characteristics between Faroese salmon farms

    DEFF Research Database (Denmark)

    Kragesteen, Trondur J.; Simonsen, Knud; Visser, AW

    2018-01-01

    Sea lice infestations are an increasing challenge in the ever-growing salmon aquaculture sector and cause large economic losses. The high salmon production in a small area creates a perfect habitat for parasites. Knowledge of how salmon lice planktonic larvae disperse and spread the infection...... between farms is of vital importance in developing treatment management plans to combat salmon lice infestations. Using a particle tracking model forced by tidal currents, we show that Faroese aquaculture farms form a complex network. In some cases as high as 10% of infectious salmon lice released at one...... for the entire Faroese salmon industry...

  1. Salmon lice – impact on wild salmonids and salmon aquaculture

    Science.gov (United States)

    Torrissen, O; Jones, S; Asche, F; Guttormsen, A; Skilbrei, O T; Nilsen, F; Horsberg, T E; Jackson, D

    2013-01-01

    Salmon lice, Lepeophtheirus salmonis, are naturally occurring parasites of salmon in sea water. Intensive salmon farming provides better conditions for parasite growth and transmission compared with natural conditions, creating problems for both the salmon farming industry and, under certain conditions, wild salmonids. Salmon lice originating from farms negatively impact wild stocks of salmonids, although the extent of the impact is a matter of debate. Estimates from Ireland and Norway indicate an odds ratio of 1.1:1-1.2:1 for sea lice treated Atlantic salmon smolt to survive sea migration compared to untreated smolts. This is considered to have a moderate population regulatory effect. The development of resistance against drugs most commonly used to treat salmon lice is a serious concern for both wild and farmed fish. Several large initiatives have been taken to encourage the development of new strategies, such as vaccines and novel drugs, for the treatment or removal of salmon lice from farmed fish. The newly sequenced salmon louse genome will be an important tool in this work. The use of cleaner fish has emerged as a robust method for controlling salmon lice, and aquaculture production of wrasse is important towards this aim. Salmon lice have large economic consequences for the salmon industry, both as direct costs for the prevention and treatment, but also indirectly through negative public opinion. PMID:23311858

  2. Design, chemical synthesis and kinetic studies of trypsin chromogenic substrates based on the proteinase binding loop of Cucurbita maxima trypsin inhibitor (CMTI-III).

    Science.gov (United States)

    Lesner, A; Brzozowski, K; Kupryszewski, G; Rolka, K

    2000-03-05

    A series of trypsin chromogenic substrates with formula: Y-Ala-X-Abu-Pro-Lys-pNA, where X = Gly, Ala, Abu, Val, Leu, Phe, Ser, Glu and Y = Ac, H; pNA = p-nitroanilide was synthesized. The Cucurbita maxima trypsin inhibitor CMTI-III molecule was used as a vehicle to design the trypsin substrates. To evaluate the influence of position P(4) on the substrate-enzyme interaction, kinetic parameters of newly synthesized substrates with bovine beta-trypsin were determined. The increasing hydrophobicity of the amino acid residue (Gly, Ala, Abu, Val) introduced in position P(4) significantly enhanced the substrate specificity (k(cat)/K(m)) which was over 8 times higher for the last residue than that for the first one. The introduction of residues with more hydrophilic side chain (Glu, Ser) in this position reduced the value of this parameter. These results correspond well with those obtained using molecular dynamics of bovine beta-trypsin with monosubstituted CMTI-I analogues, indicating that in both trypsin substrate and inhibitor position 4 plays an important role in the interaction with the enzyme. Copyright 2000 Academic Press.

  3. Poached Salmon

    Science.gov (United States)

    ... page: https://medlineplus.gov/recipe/poachedsalmon.html Poached Salmon To use the sharing features on this page, ... olive oil Ground black pepper, to taste For salmon: 4 salmon steaks, 5 oz each 3 cups ...

  4. Highly Stable Trypsin-Aggregate Coatings on Polymer Nanofibers for Repeated Protein Digestion

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Byoung Chan; Lopez-Ferrer, Daniel; Lee, Sang-mok; Ahn, Hye-kyung; Nair, Sujith; Kim, Seong H.; Kim, Beom S.; Petritis, Konstantinos; Camp, David G.; Grate, Jay W.; Smith, Richard D.; Koo, Yoon-mo; Gu, Man Bock; Kim, Jungbae

    2009-04-01

    A stable and robust trypsin-based biocatalytic system was developed and demonstrated for proteomic applications. The system utilizes polymer nanofibers coated with trypsin aggregates for immobilized protease digestions. After covalently attaching an initial layer of trypsin to the polymer nanofibers, highly concentrated trypsin molecules are crosslinked to the layered trypsin by way of a glutaraldehyde treatment. This new process produced a 300-fold increase in trypsin activity compared with a conventional method for covalent trypsin immobilization and proved to be robust in that it still maintained a high level of activity after a year of repeated recycling. This highly stable form of immobilized trypsin was also resistant to autolysis, enabling repeated digestions of bovine serum albumin over 40 days and successful peptide identification by LC-MS/MS. Finally, the immobilized trypsin was resistant to proteolysis when exposed to other enzymes (i.e. chymotrypsin), which makes it suitable for use in “real-world” proteomic applications. Overall, the biocatalytic nanofibers with enzyme aggregate coatings proved to be an effective approach for repeated and automated protein digestion in proteomic analyses.

  5. Chitosan nanoparticles-trypsin interactions: Bio-physicochemical and molecular dynamics simulation studies.

    Science.gov (United States)

    Salar, Safoura; Mehrnejad, Faramarz; Sajedi, Reza H; Arough, Javad Mohammadnejad

    2017-10-01

    Herein, we investigated the effect of the chitosan nanoparticles (CsNP) on the structure, dynamics, and activity of trypsin. The enzyme activity in complex with the nanoparticles slightly increased, which represents the interactions between the nanoparticles and the enzyme. The kinetic parameters of the enzyme, K m and k cat , increased after adding the nanoparticles, resulting in a slight increase in the catalytic efficiency (k cat /K m ). However, the effect of the nanoparticles on the kinetic stability of trypsin has not exhibited significant variations. Fluorescence spectroscopy did not show remarkable changes in the trypsin conformation in the presence of the nanoparticles. The circular dichroism (CD) spectroscopy results also revealed the secondary structure of trypsin attached to the nanoparticles slightly changed. Furthermore, we used molecular dynamics (MD) simulation to find more information about the interaction mechanisms between the nanoparticles and trypsin. The root mean square deviation (RMSD) of Cα atoms results have shown that in the presence of the nanoparticles, trypsin was stable. The simulation and the calculation of the binding free energy demonstrate that the nonpolar interactions are the most important forces for the formation of stable nanoparticle-trypsin complex. This study has explicitly elucidated that the nanoparticles have not considerable effect on the trypsin. Copyright © 2017. Published by Elsevier B.V.

  6. Effects of salmon lice infection and salmon lice protection on fjord migrating Atlantic salmon and brown trout post-smolts

    DEFF Research Database (Denmark)

    Sivertsgard, Rolf; Thorstad, Eva B.; Okland, Finn

    2007-01-01

    Effects of artificial salmon lice infection and pharmaceutical salmon lice prophylaxis on survival and rate of progression of Atlantic salmon (n = 72) and brown trout post-smolts (n = 72) during their fjord migration, were studied by telemetry. The infected groups were artificially exposed...... to infective salmon lice larvae in the laboratory immediately before release in the inner part of the fjord to simulate a naturally high infection pressure. Groups of infected Atlantic salmon (n = 20) and brown trout (n = 12) were also retained in the hatchery to control the infection intensity and lice...... development during the study period. Neither salmon lice infection nor pharmaceutical prophylaxis had any effects on survival and rate of progression of fjord migrating Atlantic salmon post-smolts compared to control fish. Atlantic salmon spent on average only 151.2 h (maximum 207.3 h) in passing the 80 km...

  7. Chemical repair of trypsin-histidinyl radical

    International Nuclear Information System (INIS)

    Jovanovic, S.V.; Ruvarac, I.; Jankovic, I.; Josimovic, L.

    1991-01-01

    Oxyl radicals, such as hydroxyl, alkoxyl and peroxyl, react with biomolecules to produce bioradicals. Unless chemically repaired by suitable antioxidants, these bioradicals form stable products. This leads to loss of biological function of parent biomolecules with deleterious biological results, such as mutagenesis and cancer. Consequently, the understanding of the mechanisms of oxyl radical damage to biomolecules and chemical repair of such damage is crucial for the development of strategies for anticarcinogenesis and radioprotection. In this study the chemical repair of the histidinyl radical generated upon the trichloromethylperoxyl radical reaction with trypsin vas investigated by gamma radiolysis. The trypsin histidinyl radical is a resonance-stabilized heterocyclic free radical which was found to be unreactive with oxygen. The efficacy of the chemical repair of the trypsin-histidinyl radical by endogenous antioxidants which are electron donors (e.g. 5-hydroxytryptophan, uric acid) is compared to that of antioxidants which are H-atom donors (e. g. glutathione). 9 refs., 2 figs., 1 tab

  8. Chitosan nanoencapsulated exogenous trypsin biomimics zymogen-like enzyme in fish gastrointestinal tract.

    Science.gov (United States)

    Kumari, Rakhi; Gupta, Subodh; Singh, Arvind R; Ferosekhan, S; Kothari, Dushyant C; Pal, Asim Kumar; Jadhao, Sanjay Balkrishna

    2013-01-01

    Exogenous proteolytic enzyme supplementation is required in certain disease conditions in humans and animals and due to compelling reasons on use of more plant protein ingredients and profitability in animal feed industry. However, limitations on their utility in diet are imposed by their pH specificity, thermolabile nature, inhibition due to a variety of factors and the possibility of intestinal damage. For enhancing the efficacy and safety of exogenous trypsin, an efficient chitosan (0.04%) nanoencapsulation-based controlled delivery system was developed. An experiment was conducted for 45 days to evaluate nanoencapsulated trypsin (0.01% and 0.02%) along with 0.02% bare trypsin and 0.4% chitosan nanoparticles against a control diet on productive efficiency (growth rate, feed conversion and protein efficiency ratio), organo-somatic indices, nutrient digestibility, tissue enzyme activities, hematic parameters and intestinal histology of the fish Labeo rohita. All the synthesized nanoparticles were of desired characteristics. Enhanced fish productive efficiency using nanoencapsulated trypsin over its bare form was noticed, which corresponded with enhanced (P<0.01) nutrient digestibility, activity of intestinal protease, liver and muscle tissue transaminases (alanine and aspartate) and dehydrogenases (lactate and malate), serum blood urea nitrogen and serum protein profile. Intestinal tissues of fish fed with 0.02% bare trypsin showed broadened, marked foamy cells with lipid vacuoles. However, villi were healthier in appearance with improved morphological features in fish fed with nanoencapsulated trypsin than with bare trypsin, and the villi were longer in fish fed with 0.01% nanoencapsulated trypsin than with 0.02% nanoencapsulated trypsin. The result of this premier experiment shows that nanoencapsulated trypsin mimics zymogen-like proteolytic activity via controlled release, and hence the use of 0.01% nanoencapsulated trypsin (in chitosan nanoparticles) over bare

  9. Chitosan nanoencapsulated exogenous trypsin biomimics zymogen-like enzyme in fish gastrointestinal tract.

    Directory of Open Access Journals (Sweden)

    Rakhi Kumari

    Full Text Available Exogenous proteolytic enzyme supplementation is required in certain disease conditions in humans and animals and due to compelling reasons on use of more plant protein ingredients and profitability in animal feed industry. However, limitations on their utility in diet are imposed by their pH specificity, thermolabile nature, inhibition due to a variety of factors and the possibility of intestinal damage. For enhancing the efficacy and safety of exogenous trypsin, an efficient chitosan (0.04% nanoencapsulation-based controlled delivery system was developed. An experiment was conducted for 45 days to evaluate nanoencapsulated trypsin (0.01% and 0.02% along with 0.02% bare trypsin and 0.4% chitosan nanoparticles against a control diet on productive efficiency (growth rate, feed conversion and protein efficiency ratio, organo-somatic indices, nutrient digestibility, tissue enzyme activities, hematic parameters and intestinal histology of the fish Labeo rohita. All the synthesized nanoparticles were of desired characteristics. Enhanced fish productive efficiency using nanoencapsulated trypsin over its bare form was noticed, which corresponded with enhanced (P<0.01 nutrient digestibility, activity of intestinal protease, liver and muscle tissue transaminases (alanine and aspartate and dehydrogenases (lactate and malate, serum blood urea nitrogen and serum protein profile. Intestinal tissues of fish fed with 0.02% bare trypsin showed broadened, marked foamy cells with lipid vacuoles. However, villi were healthier in appearance with improved morphological features in fish fed with nanoencapsulated trypsin than with bare trypsin, and the villi were longer in fish fed with 0.01% nanoencapsulated trypsin than with 0.02% nanoencapsulated trypsin. The result of this premier experiment shows that nanoencapsulated trypsin mimics zymogen-like proteolytic activity via controlled release, and hence the use of 0.01% nanoencapsulated trypsin (in chitosan

  10. Trypsin Binding with Copper Ions Scavenges Superoxide: Molecular Dynamics-Based Mechanism Investigation

    Directory of Open Access Journals (Sweden)

    Xin Li

    2018-01-01

    Full Text Available Trypsin is a serine protease, which has been proved to be a novel superoxide scavenger. The burst of superoxide induced by polychlorinated biphenyls can be impeded by trypsin in both wild type and sod knockout mutants of Escherichia coli. The experimental results demonstrated that the activities of superoxide scavenging of trypsin were significantly accelerated by Cu ions. Also, with the addition of Cu ions, a new β-sheet (β7 transited from a random coil in the Cu(II-trypsin (TP system, which was favorable for the formation of more contacts with other sheets of trypsin. Residue–residue network analysis and the porcupine plots proved that the Cu ion in trypsin strengthened some native interactions among residues, which ultimately resulted in much greater stability of the Cu(II-TP system. Moreover, compact and stable trypsin structures with Cu ions might be responsible for significantly provoking the activity of superoxide scavenging.

  11. FRET-based modified graphene quantum dots for direct trypsin quantification in urine

    Energy Technology Data Exchange (ETDEWEB)

    Poon, Chung-Yan; Li, Qinghua [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong); Zhang, Jiali; Li, Zhongping [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong); Research Center of Environmental Science and Engineering, School of Chemistry and Chemical Engineering, Shanxi University, Taiyuan 030006 (China); Dong, Chuan [Research Center of Environmental Science and Engineering, School of Chemistry and Chemical Engineering, Shanxi University, Taiyuan 030006 (China); Lee, Albert Wai-Ming; Chan, Wing-Hong [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong); Li, Hung-Wing, E-mail: hwli@hkbu.edu.hk [Department of Chemistry, Hong Kong Baptist University, Kowloon Tong, Hong Kong Special Administrative Region (Hong Kong)

    2016-04-21

    A versatile nanoprobe was developed for trypsin quantification with fluorescence resonance energy transfer (FRET). Here, fluorescence graphene quantum dot is utilized as a donor while a well-designed coumarin derivative, CMR2, as an acceptor. Moreover, bovine serum albumin (BSA), as a protein model, is not only served as a linker for the FRET pair, but also a fluorescence enhancer of the quantum dots and CMR2. In the presence of trypsin, the FRET system would be destroyed when the BSA is digested by trypsin. Thus, the emission peak of the donor is regenerated and the ratio of emission peak of donor/emission peak of acceptor increased. By the ratiometric measurement of these two emission peaks, trypsin content could be determined. The detection limit of trypsin was found to be 0.7 μg/mL, which is 0.008-fold of the average trypsin level in acute pancreatitis patient's urine suggesting a high potential for fast and low cost clinical screening. - Highlights: • A FRET-based biosensor was developed for direct quantification of trypsin. • Fast and sensitive screening of pancreatic disease was facilitated. • The direct quantification of trypsin in urine samples was demonstrated.

  12. In vitro assessment of phthalate acid esters-trypsin complex formation.

    Science.gov (United States)

    Chi, Zhenxing; Zhao, Jing; Li, Weiguo; Araghi, Arash; Tan, Songwen

    2017-10-01

    In this work, interactions of three phthalate acid esters (PAEs), including dimethyl phthalate (DMP), diethyl phthalate (DEP) and dibutyl phthalate (DBP), with trypsin have been studied in vitro, under simulated physiological conditions using multi-spectroscopic techniques and molecular modeling. The results show that these PAEs can bind to the trypsin, forming trypsin-PAEs complexes, mainly via hydrophobic interactions, with the affinity order of DMP > DEP > DBP. Binding to the PAEs is found to result in molecular deformation of trypsin. The modeling results suggest that only DBP can bind with the amino acid residues of the catalytic triad and S1 binding pocket of trypsin, leading to potential competitive enzyme inhibition. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Interaction of methotrexate with trypsin analyzed by spectroscopic and molecular modeling methods

    Science.gov (United States)

    Wang, Yanqing; Zhang, Hongmei; Cao, Jian; Zhou, Qiuhua

    2013-11-01

    Trypsin is one of important digestive enzymes that have intimate correlation with human health and illness. In this work, the interaction of trypsin with methotrexate was investigated by spectroscopic and molecular modeling methods. The results revealed that methotrexate could interact with trypsin with about one binding site. Methotrexate molecule could enter into the primary substrate-binding pocket, resulting in inhibition of trypsin activity. Furthermore, the thermodynamic analysis implied that electrostatic force, hydrogen bonding, van der Waals and hydrophobic interactions were the main interactions for stabilizing the trypsin-methotrexate system, which agreed well with the results from the molecular modeling study.

  14. Comparative study of the binding of trypsin to caffeine and theophylline by spectrofluorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ruiyong, E-mail: wangry@zzu.edu.cn [Department of Chemistry, Zhengzhou University, Zhengzhou 450001 (China); Kang, Xiaohui [Department of Chemistry, Zhengzhou University, Zhengzhou 450001 (China); Wang, Ruiqiang [The First Affiliated Hospital of Zhengzhou University, Zhengzhou 450052 (China); Wang, Rui; Dou, Huanjing; Wu, Jing; Song, Chuanjun [Department of Chemistry, Zhengzhou University, Zhengzhou 450001 (China); Chang, Junbiao, E-mail: changjunbiao@zzu.edu.cn [Department of Chemistry, Zhengzhou University, Zhengzhou 450001 (China)

    2013-06-15

    The interactions between trypsin and caffeine/theophylline were investigated by fluorescence spectroscopy, UV–visible absorption spectroscopy, resonance light scattering and synchronous fluorescence spectroscopy under mimic physiological conditions. The results revealed that the fluorescence quenching of trypsin by caffeine and theophylline was the result of the formed complex of caffeine–trypsin and theophylline–trypsin. The binding constants and thermodynamic parameters at three different temperatures were obtained. The hydrophobic interaction was the predominant intermolecular forces to stabilize the complex. Results showed that caffeine was the stronger quencher and bound to trypsin with higher affinity than theophylline. -- Highlights: ► The fluorescence of trypsin can be quenched by caffeine or theophylline via hydrophobic contacts. ► Caffeine binds to trypsin with higher affinity than theophylline. ► The influence of molecular structure on the binding aspects is reported.

  15. Comparative study of the binding of trypsin to caffeine and theophylline by spectrofluorimetry

    International Nuclear Information System (INIS)

    Wang, Ruiyong; Kang, Xiaohui; Wang, Ruiqiang; Wang, Rui; Dou, Huanjing; Wu, Jing; Song, Chuanjun; Chang, Junbiao

    2013-01-01

    The interactions between trypsin and caffeine/theophylline were investigated by fluorescence spectroscopy, UV–visible absorption spectroscopy, resonance light scattering and synchronous fluorescence spectroscopy under mimic physiological conditions. The results revealed that the fluorescence quenching of trypsin by caffeine and theophylline was the result of the formed complex of caffeine–trypsin and theophylline–trypsin. The binding constants and thermodynamic parameters at three different temperatures were obtained. The hydrophobic interaction was the predominant intermolecular forces to stabilize the complex. Results showed that caffeine was the stronger quencher and bound to trypsin with higher affinity than theophylline. -- Highlights: ► The fluorescence of trypsin can be quenched by caffeine or theophylline via hydrophobic contacts. ► Caffeine binds to trypsin with higher affinity than theophylline. ► The influence of molecular structure on the binding aspects is reported

  16. The trypsin-catalyzed hydrolysis of monomolecular films of lysylphosphatidylglycerol

    NARCIS (Netherlands)

    Gould, R.M.; Dawson, R.M.C.

    1972-01-01

    The hydrolysis by trypsin of the bacterial phospholipid, lysylphosphatidyl-glycerol has been studied at the air-water interface. High specific activity [14C]-lysylphosphatidylglycerol was prepared biosynthetically and the trypsin action followed by measuring the loss of surface radioactivity from a

  17. 21 CFR 524.2620 - Liquid crystalline trypsin, Peru balsam, castor oil.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Liquid crystalline trypsin, Peru balsam, castor... NEW ANIMAL DRUGS § 524.2620 Liquid crystalline trypsin, Peru balsam, castor oil. (a)(1) Specifications... delivered to the wound site contains 0.12 milligram of crystalline trypsin, 87.0 milligrams of Peru balsam...

  18. Lectins as carriers: preparation and purification of a concanavalin A-trypsin conjugate

    International Nuclear Information System (INIS)

    Shier, W.T.

    1985-01-01

    The scheme for the preparation and purification of Con A-trypsin demonstrates the presence of Con A in the conjugate by affinity purification and by hemagglutination. The presence of Con A was demonstrated in two additional ways. The conjugate was prepared using trypsin labeled with iodine 125 and unlabeled Con A. The resulting conjugate containing 42,800 cpm/mg protein was used to demonstrate prolonged retention of the conjugated trypsin in mouse footpads. The presence of trypsin was also demonstrated in the conjugate by affinity chromatography and by the esterase activity characteristic of trypsin with tosyl-L-arginine methyl ester as substrate. Con A-trypsin was also assayed for proteolytic activity with a macromolecular substrate azocasein. A comparison of proteolytic activities with these two substrates indicated that 50-80% of the proteolytic activity observed with the small substrate is retained with macromolecular substrates

  19. Performance comparison of three trypsin columns used in liquid chromatography?

    OpenAIRE

    ?lechtov?, Tereza; Gilar, Martin; Kal?kov?, Kv?ta; Moore, Stephanie M.; Jorgenson, James W.; Tesa?ov?, Eva

    2017-01-01

    Trypsin is the most widely used enzyme in proteomic research due to its high specificity. Although the in-solution digestion is predominantly used, it has several drawbacks, such as long digestion times, autolysis, and intolerance to high temperatures or organic solvents. To overcome these shortcomings trypsin was covalently immobilized on solid support and tested for its proteolytic activity. Trypsin was immobilized on bridge-ethyl hybrid silica sorbent with 300 ? pores, packed in 2.1 ? 30 m...

  20. Effects of bisphenol S on the structures and activities of trypsin and pepsin.

    Science.gov (United States)

    Wang, Yan-Qing; Zhang, Hong-Mei

    2014-11-19

    The effects of bisphenol S on the structures and activities of trypsin and pepsin were investigated by various methods like UV-visible absorbance, fluorescence, circular dichroism, and molecular docking. The secondary and tertiary structures of trypsin and pepsin were altered by bisphenol S binding, which resulted in the loosening of the skeletons of trypsin and pepsin. In addition, bisphenol S induced microenvironmental changes around tyrosine and tryptophan residues of trypsin and pepsin. The activity experimental results showed that the activity of pepsin decreases obviously with the increasing concentration of BPS, while the activity of trypsin does not change remarkably. The binding and thermodynamic parameters obtained by molecular docking and fluorescence spectroscopy showed that the bindings of bisphenol S to trypsin and pepsin were spontaneous processes and hydrogen bonding and hydrophobic interactions played a vital role in stabilizing the bisphenol S-trypsin and bisphenol S-pepsin complexes. The binding constants (K(A)) of bisphenol S with trypsin were 7.42 × 10(4) (298 K) and 5.91 × 10(4) L/mol (310 K), and those of pepsin were 5.78 × 10(4) (298 K) and 4.44 × 10(4) L/mol (310 K). Moreover, there was one main kind of binding site for bisphenol S on trypsin or pepsin.

  1. A critical assessment of the ecological assumptions underpinning compensatory mitigation of salmon-derived nutrients

    Science.gov (United States)

    Collins, Scott F.; Marcarelli, Amy M.; Baxter, Colden V.; Wipfli, Mark S.

    2015-01-01

    We critically evaluate some of the key ecological assumptions underpinning the use of nutrient replacement as a means of recovering salmon populations and a range of other organisms thought to be linked to productive salmon runs. These assumptions include: (1) nutrient mitigation mimics the ecological roles of salmon, (2) mitigation is needed to replace salmon-derived nutrients and stimulate primary and invertebrate production in streams, and (3) food resources in rearing habitats limit populations of salmon and resident fishes. First, we call into question assumption one because an array of evidence points to the multi-faceted role played by spawning salmon, including disturbance via redd-building, nutrient recycling by live fish, and consumption by terrestrial consumers. Second, we show that assumption two may require qualification based upon a more complete understanding of nutrient cycling and productivity in streams. Third, we evaluate the empirical evidence supporting food limitation of fish populations and conclude it has been only weakly tested. On the basis of this assessment, we urge caution in the application of nutrient mitigation as a management tool. Although applications of nutrients and other materials intended to mitigate for lost or diminished runs of Pacific salmon may trigger ecological responses within treated ecosystems, contributions of these activities toward actual mitigation may be limited.

  2. Inhibition of trypsin by condensed tannins and wine.

    Science.gov (United States)

    Gonçalves, Rui; Soares, Susana; Mateus, Nuno; de Freitas, Victor

    2007-09-05

    Phenolic compounds are abundant vegetable secondary metabolites in the human diet. The ability of procyanidin oligomers and wine polyphenols to inhibit trypsin activity was studied using a versatile and reliable in vitro method. The hydrolysis of the chromogenic substrate N-benzoyl-d,l-arginine-p-nitroanilide (BApNA) by trypsin was followed by spectrophotometry in the presence and absence of condensed tannins and wine. A clear relationship between the degree of polymerization of procyanidins and enzymatic inhibition was observed. Trypsin activity inhibition was also detected in several types of wine. In general, the inhibition increased with the concentration of phenolic compounds in wines. These results may be relevant when considering these compounds as antinutritional factors, thereby contributing to a reduced absorption of nutrients.

  3. Oligodeoxyribonucleotides derived from salmon sperm DNA: an alternative to defibrotide.

    Science.gov (United States)

    Hui, Chang-Ye; Guo, Yan; Zhang, Xi; Shao, Jian-Hua; Yang, Xue-Qin; Zhang, Wen

    2013-05-01

    Defibrotide is a single-stranded nucleic acid polymer originally derived from porcine mucosa. Cheap salmon sperm DNA is commercially available and widely used in drug production. In this study, oligodeoxyribonucleotides were successfully obtained from the controlled depolymerization of salmon sperm DNA. The obtained product shared similar chemical and biological properties with defibrotide produced by Gentium SpA, Italy. It was also found that oligodeoxyribonucleotides derived from non-mammalian origins could also directly stimulate tissue plasminogen activator (t-PA) release from cultured human endothelial cells, and enhance fibrinolytic activity in the rabbit. Copyright © 2013 The International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  4. The sequence and X-ray structure of the trypsin from Fusarium oxysporum.

    Science.gov (United States)

    Rypniewski, W R; Hastrup, S; Betzel, C; Dauter, M; Dauter, Z; Papendorf, G; Branner, S; Wilson, K S

    1993-06-01

    The trypsin from Fusarium oxysporum is equally homologous to trypsins from Streptomyces griseus, Streptomyces erythraeus and to bovine trypsin. A DFP (diisopropylfluorophosphate) inhibited form of the enzyme has been crystallized from 1.4 M Na2SO4, buffered with citrate at pH 5.0-5.5. The crystals belong to space group P2(1) with cell parameters a = 33.43 A, b = 67.65 A, c = 39.85 A and beta = 107.6 degrees. There is one protein molecule in the asymmetric unit. X-ray diffraction data to a resolution of 1.8 A were collected on film using synchrotron radiation. The structure was solved by molecular replacement using models of bovine and S. griseus trypsins and refined to an R-factor of 0.141. The overall fold is similar to other trypsins, with some insertions and deletions. There is no evidence of the divalent cation binding sites seen in other trypsins. The covalently bound inhibitor molecule is clearly visible.

  5. SALMON SOFT ROE DNA ON BLOOD CELLS SECRETION OF CYTOKINES IN HEALTHY DONORS

    Directory of Open Access Journals (Sweden)

    L. N. Fedjanina

    2005-01-01

    Full Text Available Abstract. Salmon soft roe DNA influence on healthy donors blood cells secretion of early hemopoietic factors (IL-3, GM-CSF, TNFα as well as biologically active substance influence on cytokine balance of Тh1 and Тh2 responses (IFNγ, IL-10 in vitro was studied. It is established, that DNA has modulatory effect on secretion of all investigated cytokines - IL-3, GM-CSF, TNFα, INFγ and IL-10 by blood cells of healthy donors, increases their initially low concentration, reduces initially high and does not have essential influence at an average level of their secretion. Under action of DNA IFNγ level (stimulation index=3,3 increases more significantly than IL-10 level (stimulation index =1,9. Thus, salmon soft roe DNA possesses immunomodulatory properties.

  6. Organic salmon

    DEFF Research Database (Denmark)

    Ankamah Yeboah, Isaac; Nielsen, Max; Nielsen, Rasmus

    . This study identifies the price premium on organic salmon in the Danish retail sale sector using consumer panel scanner data for households by applying the hedonic price model while permitting unobserved heterogeneity between households. A premium of 20% for organic salmon is found. Since this premium...... is closer to organic labeled agriculture products than to ecolabelled capture fisheries products, it indicates that consumers value organic salmon as an agriculture product more than fisheries product....

  7. Modeling Parasite Dynamics on Farmed Salmon for Precautionary Conservation Management of Wild Salmon

    Science.gov (United States)

    Rogers, Luke A.; Peacock, Stephanie J.; McKenzie, Peter; DeDominicis, Sharon; Jones, Simon R. M.; Chandler, Peter; Foreman, Michael G. G.; Revie, Crawford W.; Krkošek, Martin

    2013-01-01

    Conservation management of wild fish may include fish health management in sympatric populations of domesticated fish in aquaculture. We developed a mathematical model for the population dynamics of parasitic sea lice (Lepeophtheirus salmonis) on domesticated populations of Atlantic salmon (Salmo salar) in the Broughton Archipelago region of British Columbia. The model was fit to a seven-year dataset of monthly sea louse counts on farms in the area to estimate population growth rates in relation to abiotic factors (temperature and salinity), local host density (measured as cohort surface area), and the use of a parasiticide, emamectin benzoate, on farms. We then used the model to evaluate management scenarios in relation to policy guidelines that seek to keep motile louse abundance below an average three per farmed salmon during the March–June juvenile wild Pacific salmon (Oncorhynchus spp.) migration. Abiotic factors mediated the duration of effectiveness of parasiticide treatments, and results suggest treatment of farmed salmon conducted in January or early February minimized average louse abundance per farmed salmon during the juvenile wild salmon migration. Adapting the management of parasites on farmed salmon according to migrations of wild salmon may therefore provide a precautionary approach to conserving wild salmon populations in salmon farming regions. PMID:23577082

  8. Modeling parasite dynamics on farmed salmon for precautionary conservation management of wild salmon.

    Directory of Open Access Journals (Sweden)

    Luke A Rogers

    Full Text Available Conservation management of wild fish may include fish health management in sympatric populations of domesticated fish in aquaculture. We developed a mathematical model for the population dynamics of parasitic sea lice (Lepeophtheirus salmonis on domesticated populations of Atlantic salmon (Salmo salar in the Broughton Archipelago region of British Columbia. The model was fit to a seven-year dataset of monthly sea louse counts on farms in the area to estimate population growth rates in relation to abiotic factors (temperature and salinity, local host density (measured as cohort surface area, and the use of a parasiticide, emamectin benzoate, on farms. We then used the model to evaluate management scenarios in relation to policy guidelines that seek to keep motile louse abundance below an average three per farmed salmon during the March-June juvenile wild Pacific salmon (Oncorhynchus spp. migration. Abiotic factors mediated the duration of effectiveness of parasiticide treatments, and results suggest treatment of farmed salmon conducted in January or early February minimized average louse abundance per farmed salmon during the juvenile wild salmon migration. Adapting the management of parasites on farmed salmon according to migrations of wild salmon may therefore provide a precautionary approach to conserving wild salmon populations in salmon farming regions.

  9. Bioconjugation of trypsin onto gold nanoparticles: Effect of surface chemistry on bioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Hinterwirth, Helmut; Lindner, Wolfgang [Department of Analytical Chemistry, University of Vienna, Waehringerstrasse 38, 1090 Vienna (Austria); Laemmerhofer, Michael, E-mail: michael.laemmerhofer@uni-tuebingen.de [Department of Analytical Chemistry, University of Vienna, Waehringerstrasse 38, 1090 Vienna (Austria)

    2012-07-06

    Highlights: Black-Right-Pointing-Pointer Size and spacer affect bioactivity of nanoparticulate trypsin reactor. Black-Right-Pointing-Pointer Increase of GNP's size increases activity of bound trypsin. Black-Right-Pointing-Pointer Increase of spacer length increases amount and activity of immobilized enzyme by factor 6. Black-Right-Pointing-Pointer Decrease of digestion time up to less than 1 h when trypsin immobilized onto GNPs. Black-Right-Pointing-Pointer Reduced auto-digestion compared to trypsin in-solution. - Abstract: The systematic study of activity, long-time stability and auto-digestion of trypsin immobilized onto gold nanoparticles (GNPs) is described in this paper and compared to trypsin in-solution. Thereby, the influence of GNP's size and immobilization chemistry by various linkers differing in lipophilicity/hydrophilicity and spacer lengths was investigated with regard to the bioactivity of the conjugated enzyme. GNPs with different sizes were prepared by reduction and simultaneous stabilization with trisodium citrate and characterized by UV/vis spectra, dynamic light scattering (DLS), {zeta}-potential measurements and transmission electron microscopy (TEM). GNPs were derivatized by self-assembling of bifunctional thiol reagents on the nanoparticle (NP) surface via dative thiol-gold bond yielding a carboxylic acid functionalized surface. Trypsin was either attached directly via hydrophobic and ionic interactions onto the citrate stabilized GNPs or immobilized via EDC/NHS bioconjugation onto the carboxylic functionalized GNPs, respectively. The amount of bound trypsin was quantified by measuring the absorbance at 280 nm. The activity of bound enzyme and its Michaelis Menten kinetic parameter K{sub m} and v{sub max} were measured by the standard chromogenic substrate N{sub {alpha}}-Benzoyl-DL-arginine 4-nitroanilide hydrochloride (BApNA). Finally, digestion of a standard protein mixture with the trypsin-conjugated NPs followed by analysis with

  10. Bioconjugation of trypsin onto gold nanoparticles: Effect of surface chemistry on bioactivity

    International Nuclear Information System (INIS)

    Hinterwirth, Helmut; Lindner, Wolfgang; Lämmerhofer, Michael

    2012-01-01

    Highlights: ► Size and spacer affect bioactivity of nanoparticulate trypsin reactor. ► Increase of GNP's size increases activity of bound trypsin. ► Increase of spacer length increases amount and activity of immobilized enzyme by factor 6. ► Decrease of digestion time up to less than 1 h when trypsin immobilized onto GNPs. ► Reduced auto-digestion compared to trypsin in-solution. - Abstract: The systematic study of activity, long-time stability and auto-digestion of trypsin immobilized onto gold nanoparticles (GNPs) is described in this paper and compared to trypsin in-solution. Thereby, the influence of GNP's size and immobilization chemistry by various linkers differing in lipophilicity/hydrophilicity and spacer lengths was investigated with regard to the bioactivity of the conjugated enzyme. GNPs with different sizes were prepared by reduction and simultaneous stabilization with trisodium citrate and characterized by UV/vis spectra, dynamic light scattering (DLS), ζ-potential measurements and transmission electron microscopy (TEM). GNPs were derivatized by self-assembling of bifunctional thiol reagents on the nanoparticle (NP) surface via dative thiol-gold bond yielding a carboxylic acid functionalized surface. Trypsin was either attached directly via hydrophobic and ionic interactions onto the citrate stabilized GNPs or immobilized via EDC/NHS bioconjugation onto the carboxylic functionalized GNPs, respectively. The amount of bound trypsin was quantified by measuring the absorbance at 280 nm. The activity of bound enzyme and its Michaelis Menten kinetic parameter K m and v max were measured by the standard chromogenic substrate N α -Benzoyl-DL-arginine 4-nitroanilide hydrochloride (BApNA). Finally, digestion of a standard protein mixture with the trypsin-conjugated NPs followed by analysis with LC–ESI-MS and successful MASCOT search demonstrated the applicability of the new heterogenous nano-structured biocatalyst. It could be shown that the

  11. Immobilization of trypsin on sub-micron skeletal polymer monolith

    Energy Technology Data Exchange (ETDEWEB)

    Yao Chunhe [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China); Qi Li, E-mail: qili@iccas.ac.cn [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Hu Wenbin [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Graduate School, Chinese Academy of Sciences, Beijing 100049 (China); Wang Fuyi [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Yang Gengliang [College of Pharmacy, Hebei University, Baoding 071002 (China)

    2011-04-29

    A new kind of immobilized trypsin reactor based on sub-micron skeletal polymer monolith has been developed. Covalent immobilization of trypsin on this support was performed using the epoxide functional groups in either a one- or a multi-step reaction. The proteolytic activity of the immobilized trypsin was measured by monitoring the formation of N-{alpha}-benzoyl-L-arginine (BA) which is the digestion product of a substrate N-{alpha}-benzoyl-L-arginine ethyl ester (BAEE). Results showed that the digestion speed was about 300 times faster than that performed in free solution. The performance of such an enzyme reactor was further demonstrated by digesting protein myoglobin. It has been found that the protein digestion could be achieved in 88 s at 30 deg. C, which is comparable to 24 h digestion in solution at 37 {sup o}C. Furthermore, the immobilized trypsin exhibits increased stability even after continuous use compared to that in free solution. The present monolithic enzyme-reactor provides a promising platform for the proteomic research.

  12. Discovering Alaska's Salmon: A Children's Activity Book.

    Science.gov (United States)

    Devaney, Laurel

    This children's activity book helps students discover Alaska's salmon. Information is provided about salmon and where they live. The salmon life cycle and food chains are also discussed. Different kinds of salmon such as Chum Salmon, Chinook Salmon, Coho Salmon, Sockeye Salmon, and Pink Salmon are introduced, and various activities on salmon are…

  13. Evidence for competition at sea between Norton Sound chum salmon and Asian hatchery chum salmon

    Science.gov (United States)

    Ruggerone, Gregory T.; Agler, B.A.; Nielsen, Jennifer L.

    2012-01-01

    Increasing production of hatchery salmon over the past four decades has led to concerns about possible density-dependent effects on wild Pacific salmon populations in the North Pacific Ocean. The concern arises because salmon from distant regions overlap in the ocean, and wild salmon populations having low productivity may compete for food with abundant hatchery populations. We tested the hypothesis that adult length-at-age, age-at-maturation, productivity, and abundance of a Norton Sound, Alaska, chum salmon population were influenced by Asian hatchery chum salmon, which have become exceptionally abundant and surpassed the abundance of wild chum salmon in the North Pacific beginning in the early 1980s. We found that smaller adult length-at-age, delayed age-at-maturation, and reduced productivity and abundance of the Norton Sound salmon population were associated with greater production of Asian hatchery chum salmon since 1965. Modeling of the density-dependent relationship, while controlling for other influential variables, indicated that an increase in adult hatchery chum salmon abundance from 10 million to 80 million adult fish led to a 72% reduction in the abundance of the wild chum salmon population. These findings indicate that competition with hatchery chum salmon contributed to the low productivity and abundance of Norton Sound chum salmon, which includes several stocks that are classified as Stocks of Concern by the State of Alaska. This study provides new evidence indicating that large-scale hatchery production may influence body size, age-at-maturation, productivity and abundance of a distant wild salmon population.

  14. Potential toxicity of phthalic acid esters plasticizer: interaction of dimethyl phthalate with trypsin in vitro.

    Science.gov (United States)

    Wang, Yaping; Zhang, Guowen; Wang, Langhong

    2015-01-14

    Dimethyl phthalate (DMP) is widely used as a plasticizer in industrial processes and has been reported to possess potential toxicity to the human body. In this study, the interaction between DMP and trypsin in vitro was investigated. The results of fluorescence, UV–vis, circular dichroism, and Fourier transform infrared spectra along with cyclic voltammetric measurements indicated that the remarkable fluorescence quenching and conformational changes of trypsin resulted from the formation of a DMP–trypsin complex, which was driven mainly by hydrophobic interactions. The molecular docking and trypsin activity assay showed that DMP primarily interacted with the catalytic triad of trypsin and led to the inhibition of trypsin activity. The dimensions of the individual trypsin molecules were found to become larger after binding with DMP by atomic force microscopy imaging. This study offers a comprehensive picture of DMP–trypsin interaction, which is expected to provide insights into the toxicological effect of DMP.

  15. Utilization of smoked salmon trim in extruded smoked salmon jerky.

    Science.gov (United States)

    Kong, J; Dougherty, M P; Perkins, L B; Camire, M E

    2012-06-01

    During smoked salmon processing, the dark meat along the lateral line is removed before packaging; this by-product currently has little economic value. In this study, the dark meat trim was incorporated into an extruded jerky. Three formulations were processed: 100% smoked trim, 75% : 25% smoked trim : fresh salmon fillet, and 50% : 50% smoked trim : fresh salmon blends (w/w basis). The base formulation contained salmon (approximately 83.5%), tapioca starch (8%), pregelatinized potato starch (3%), sucrose (4%), salt (1.5%), sodium nitrate (0.02%), and ascorbyl palmitate (0.02% of the lipid content). Blends were extruded in a laboratory-scale twin-screw extruder and then hot-smoked for 5 h. There were no significant differences among formulations in moisture, water activity, and pH. Protein was highest in the 50 : 50 blend jerky. Ash content was highest in the jerky made with 100% trim. Total lipids and salt were higher in the 100% trim jerky than in the 50 : 50 blend. Hot smoking did not adversely affect docosahexaenoic acid (DHA) and eicosapentaenoic acid (EPA) content in lipids from 100% smoked trim jerky. Servings of salmon jerky made with 75% and 100% smoked trim provided at least 500 mg of EPA and DHA. The 50 : 50 formulation had the highest Intl. Commission on Illumination (CIE) L*, a*, and b* color values. Seventy consumers rated all sensory attributes as between "like slightly" and "like moderately." With some formulation and processing refinements, lateral line trim from smoked salmon processors has potential to be incorporated into acceptable, healthful snack products. Dark meat along the lateral line is typically discarded by smoked salmon processors. This omega-3 fatty acid rich by-product can be used to make a smoked salmon jerky that provides a convenient source of these healthful lipids for consumers. © 2012 Institute of Food Technologists®

  16. Effects of sex steroids, sex, and sexual maturity on cortisol production: an in vitro comparison of chinook salmon and rainbow trout interrenals.

    Science.gov (United States)

    McQuillan, H James; Lokman, P Mark; Young, Graham

    2003-08-01

    Sex steroids appear to be responsible for hyperactivation of the hypothalamus-pituitary-interrenal (HPI) axis that occurs in mature semelparous Pacific salmon as a prelude to post-spawning (programmed) death. This study was undertaken to examine the direct effects of sex steroids on interrenal activity of semelparous (chinook salmon) and iteroparous (rainbow trout) salmonids using an in vitro incubation system. In addition, phenotypic sex differences in cortisol production by interrenals of sexually mature (spawning) rainbow trout and chinook salmon were investigated. Interrenal tissue from juvenile and sexually mature chinook salmon and rainbow trout was incubated for 48 h in culture medium containing either no steroid (controls), 1 microM estradiol (E2) or 1 microM 11-ketotestosterone (11-KT). This tissue was then challenged for 3h with either pregnenolone, dibutyryladenosine 3('):5(')-cyclic monophosphate (dbcAMP) or forskolin, or synthetic human adrenocorticotropic hormone (ACTH(1-24)). Sex differences in in vitro interrenal cortisol production were assessed using separate tissue pools challenged with the same agents. Cortisol in media was measured by radioimmunoassay. E2 suppressed the ability of juvenile chinook salmon interrenals to utilize pregnenolone as substrate for cortisol synthesis. In mature female chinook salmon the suppressive effect of E2 was less pronounced, but was observed as a reduced response of interrenals to both pregnenolone and dbcAMP. E2 did not affect ACTH(1-24) stimulated cortisol production. Immature and mature rainbow trout interrenals were both relatively insensitive to E2. 11-KT did not affect cortisol production by juvenile chinook salmon and juvenile or mature rainbow trout, and had only minor effects in male and female spawning chinook salmon. In mature chinook salmon and rainbow trout, the interrenals of females were more responsive to ACTH stimulation and showed a greater utilization of pregnenolone as a substrate than

  17. Orthosteric and Allosteric Regulation in Trypsin-Like Peptidases

    DEFF Research Database (Denmark)

    Kromann-Tofting, Tobias

    Trypsin-like serine peptidases play an important role in many physiological and pathophysiological processes, the latter including cardiovascular diseases and cancer. Binding of natural ligands to functional sites on the peptidase surface balances the level of activity and substrate specificity......-ray crystallography to determine crystal structures of active and inactive conformations of muPA, combined with biochemical analysis, elucidated an allosteric regulatory mechanism, which is now believed to be highly conserved in the trypsin-like serine peptidases. Targeting zymogen activation represents an attractive...

  18. Captive Rearing Initiative for Salmon River Chinook Salmon, 1999 Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hassemer, Peter F.

    2001-04-01

    During 1999, the Idaho Department of Fish and Game (IDFG) continued developing techniques for the captive rearing of chinook salmon Oncorhynchus tshawytscha. Techniques under development included protocols for rearing juveniles in freshwater and saltwater hatchery environments, and fieldwork to collect brood year 1998 and 1999 juveniles and eggs and to investigate the ability of these fish to spawn naturally. Fish collected as juveniles were held for a short time at the Sawtooth Fish Hatchery and later transferred to the Eagle Fish Hatchery for rearing. Eyed-eggs were transferred immediately to the Eagle Fish Hatchery where they were disinfected and reared by family groups. When fish from either collection method reached approximately 60 mm, they were PIT tagged and reared separately by brood year and source stream. Sixteen different groups were in culture at IDFG facilities in 1999. Hatchery spawning activities of captive-reared chinook salmon produced eyed-eggs for outplanting in streamside incubation chambers in the West Fork Yankee Fork Salmon River (N=2,297) and the East Fork Salmon River (N=1,038). Additionally, a number of these eggs were maintained at the Eagle Fish Hatchery to ensure adequate brood year 1999 representation from these systems, and produced 279 and 87 juveniles from the West Fork Yankee Fork and East Fork Salmon River, respectively. Eyed-eggs were not collected from the West Fork Yankee Fork due to low adult escapement. Brood year 1998 juveniles were collected from the Lemhi River (N=191), West Fork Yankee Fork Salmon River (N=229), and East Fork Salmon River (N=185). Additionally, brood year 1999 eyed-eggs were collected from the Lemhi River (N=264) and East Fork Salmon River (N=143). Sixty-two and seven maturing adults were released into Bear Valley Creek (Lemhi River system) and the East Fork Salmon River, respectively, for spawning evaluation in 1999. Nine female carcasses from Bear Valley Creek were examined for egg retention, and of

  19. Silica-supported Macroporous Chitosan Bead for Affinity Purification of Trypsin Inhibitor

    Institute of Scientific and Technical Information of China (English)

    Feng Na XI; Jian Min WU; Ming Ming LUAN

    2005-01-01

    Macroporous cross-linking chitosan layer coated on silica gel (CTS-SiO2) was prepared by phase inversion and polyethylene glycol (PEG) molecular imprinting methods. Formation of macroporous surface was investigated by scanning electron microscopy (SEM) and BET analysis.The prepared bead was activated by reacting with 1,2-ethylene diglycidyl ether for introducing epoxy groups, and trypsin could be efficiently immobilized on the bead as a biospecific ligand.The bead bearing trypsin was employed to purify trypsin inhibitor (TIs) from egg white as affinity adsorbent.

  20. Crystallization, data collection and processing of the chymotrypsin–BTCI–trypsin ternary complex

    Energy Technology Data Exchange (ETDEWEB)

    Esteves, Gisele Ferreira; Teles, Rozeni Chagas Lima; Cavalcante, Nayara Silva; Neves, David; Ventura, Manuel Mateus [Laboratório de Biofísica, Instituto de Ciências Biológicas, Universidade de Brasília, 70910-900 Brasília-DF (Brazil); Barbosa, João Alexandre Ribeiro Gonçalves, E-mail: joao@lnls.br [Center for Structural Molecular Biology (CeBiME), Brazilian Synchrotron Light Laboratory (LNLS), CP 6192, 13083-970 Campinas-SP (Brazil); Freitas, Sonia Maria de, E-mail: joao@lnls.br [Laboratório de Biofísica, Instituto de Ciências Biológicas, Universidade de Brasília, 70910-900 Brasília-DF (Brazil)

    2007-12-01

    A ternary complex of the proteinase inhibitor (BTCI) with trypsin and chymotrypsin was crystallized and its crystal structure was solved by molecular replacement. A ternary complex of the black-eyed pea trypsin and chymotrypsin inhibitor (BTCI) with trypsin and chymotrypsin was crystallized by the sitting-drop vapour-diffusion method with 0.1 M HEPES pH 7.5, 10%(w/v) polyethylene glycol 6000 and 5%(v/v) 2-methyl-2,4-pentanediol as precipitant. BTCI is a small protein with 83 amino-acid residues isolated from Vigna unguiculata seeds and is able to inhibit trypsin and chymotrypsin simultaneously by forming a stable ternary complex. X-ray data were collected from a single crystal of the trypsin–BTCI–chymotrypsin ternary complex to 2.7 Å resolution under cryogenic conditions. The structure of the ternary complex was solved by molecular replacement using the crystal structures of the BTCI–trypsin binary complex (PDB code) and chymotrypsin (PDB code) as search models.

  1. Crystallization, data collection and processing of the chymotrypsin–BTCI–trypsin ternary complex

    International Nuclear Information System (INIS)

    Esteves, Gisele Ferreira; Teles, Rozeni Chagas Lima; Cavalcante, Nayara Silva; Neves, David; Ventura, Manuel Mateus; Barbosa, João Alexandre Ribeiro Gonçalves; Freitas, Sonia Maria de

    2007-01-01

    A ternary complex of the proteinase inhibitor (BTCI) with trypsin and chymotrypsin was crystallized and its crystal structure was solved by molecular replacement. A ternary complex of the black-eyed pea trypsin and chymotrypsin inhibitor (BTCI) with trypsin and chymotrypsin was crystallized by the sitting-drop vapour-diffusion method with 0.1 M HEPES pH 7.5, 10%(w/v) polyethylene glycol 6000 and 5%(v/v) 2-methyl-2,4-pentanediol as precipitant. BTCI is a small protein with 83 amino-acid residues isolated from Vigna unguiculata seeds and is able to inhibit trypsin and chymotrypsin simultaneously by forming a stable ternary complex. X-ray data were collected from a single crystal of the trypsin–BTCI–chymotrypsin ternary complex to 2.7 Å resolution under cryogenic conditions. The structure of the ternary complex was solved by molecular replacement using the crystal structures of the BTCI–trypsin binary complex (PDB code) and chymotrypsin (PDB code) as search models

  2. Carbohydrate as covalent crosslink in human inter-alpha-trypsin inhibitor

    DEFF Research Database (Denmark)

    Jessen, T E; Faarvang, K L; Ploug, M

    1988-01-01

    The primary structure of inter-alpha-trypsin inhibitor is partially elucidated, but controversy about the construction of the polypeptide backbone still exists. We present evidence suggesting that inter-alpha-trypsin inhibitor represents a novel plasma protein structure with two separate polypept...... polypeptide chains covalently crosslinked only by carbohydrate (chondroitin sulphate)....

  3. In vitro and in silico investigations of the binding interactions between chlorophenols and trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yan-Qing, E-mail: wyqing76@126.com [Jiangsu Provincial Key Laboratory of Coastal Wetland Bioresources and Environmental Protection, Yancheng City 224002, Jiangsu Province (China); Institute of Applied Chemistry and Environmental Engineering, Yancheng Teachers University, Yancheng City 224002, Jiangsu Province (China); Tan, Chun-Yun [Institute of Applied Chemistry and Environmental Engineering, Yancheng Teachers University, Yancheng City 224002, Jiangsu Province (China); Zhuang, Shu-Lin [Institute of Environmental Science, College of Environmental and Resource Science, Zhejiang University, Hangzhou 310058 (China); Zhai, Peng-Zhan; Cui, Yun; Zhou, Qiu-Hua; Zhang, Hong-Mei [Institute of Applied Chemistry and Environmental Engineering, Yancheng Teachers University, Yancheng City 224002, Jiangsu Province (China); Fei, Zhenghao [Jiangsu Provincial Key Laboratory of Coastal Wetland Bioresources and Environmental Protection, Yancheng City 224002, Jiangsu Province (China); Institute of Applied Chemistry and Environmental Engineering, Yancheng Teachers University, Yancheng City 224002, Jiangsu Province (China)

    2014-08-15

    Graphical abstract: - Highlights: • Binding interactions of five chlorophenols with trypsin were investigated. • The number of chlorine atoms of chlorophenols partly affected the binding ability of them to trypsin. • Noncovalent interactions stabilized the trypsin–chlorophenols complexes. • There was the one main binding site of trypsin for chlorophenols. - Abstract: Being the first-degree toxic pollutants, chlorophenols (CP) have potential carcinogenic and mutagenic activity and toxicity. Since there still lacks studies on molecular interactions of chlorophenols with trypsin, one major binding target of many exogenous environmental pollutants, the binding interactions between five chlorophenols, 2-CP, 2,6-DCP, 2,4,6-TCP, 2,4,6-TCP, 2,3,4,6-TCP and PCP and trypsin were characterized by the combination of multispectroscopic techniques and molecular modeling. The chlorophenols bind at the one main site of trypsin and the binding induces the changes of microenvironment and global conformations of trypsin. Different number of chloride atoms significantly affects the binding and the binding constants K{sub A} ranks as K{sub A} (2-CP) < K{sub A} (2,6-DCP) ≈ K{sub A} (2,4,6-TCP) < K{sub A} (2,3,4,6-TCP) < K{sub A} (PCP). These chlorophenols interacts with trypsin mainly through hydrophobic interactions and via hydrogen bonding interactions and aromatic–aromatic π–π stacking interaction. Our results offer insights into the binding mechanism of chlorophenols with trypsin and provide important information for possible toxicity risk of chlorophenols to human health.

  4. Blood types in Pacific salmon

    Science.gov (United States)

    Ridgway, G.L.; Klontz, G.W.

    1961-01-01

    Intraspecific differences in erythrocyte antigens (blood types) were shown to occur in four species of Pacific salmon, the sockeye or red salmon (Oncorhynchus nerka), the chinook or king salmon (0. tshawytscha), the chum salmon (O. keta), and the pink salmon (O. gorbuscha). Antisalmon-erythrocyte sera prepared in rabbits and chickens were used after absorption of species-specific antibodies. Some of these blood types were shown to differ in their frequency of occurrence between different geographic races. In addition, isoimmunizations were conducted on one race of sockeye salmon. Antisera of seven different specificities were prepared and at least eight different patterns of antigenic composition were displayed by the cells tested.

  5. Pathogenesis and immune response in Atlantic salmon (Salmo salar L.) parr experimentally infected with salmon pancreas disease virus (SPDV).

    Science.gov (United States)

    Desvignes, L; Quentel, C; Lamour, F; le, Ven A

    2002-01-01

    Atlantic salmon parr were injected intraperitoneally with salmon pancreas disease virus (SPDV) grown on CHSE-214 cells. The viraemia, the histopathological changes in target organs and some immune parameters were taken at intervals up to 30 days post-infection (dpi). The earliest kind of lesion was necrosis of exocrine pancreas, appearing as soon as 2 dpi. It progressed towards complete tissue breakdown at 9 dpi before resolving gradually. Concurrent to this necrosis, a strong inflammatory response was in evidence from 9 dpi in the pancreatic area for a majority of fish. A necrosis of the myocardial cells of the ventricle occurred in infected fish mainly at 16 dpi and it faded thereafter. The monitoring of the plasma viral load showed a rapid haematogenous spreading of SPDV, peaking at 4 dpi, but also the absence of a secondary viraemia. No interferon (IFN) was detected following the infection of parr with SPDV, probably owing to an IFN activity in Atlantic salmon below the detection level of the technique. Neutralising antibodies against SPDV were in evidence from 16 dpi and they showed a time-related increasing titre and prevalence. The phagocytic activity in head-kidney leucocytes was always significantly higher in the infected fish than in the control fish, being particularly high by 9 dpi. Lysozyme and complement levels were both increased and they peaked significantly in the infected fish at 9 and 16 dpi respectively. These results demonstrated that an experimental infection of Atlantic salmon parr with SPDV provoked a stimulation of both specific and non-specific immunity with regards to the viraemia and the histopathology.

  6. Quantitative proteomics reveals the kinetics of trypsin-catalyzed protein digestion.

    Science.gov (United States)

    Pan, Yanbo; Cheng, Kai; Mao, Jiawei; Liu, Fangjie; Liu, Jing; Ye, Mingliang; Zou, Hanfa

    2014-10-01

    Trypsin is the popular protease to digest proteins into peptides in shotgun proteomics, but few studies have attempted to systematically investigate the kinetics of trypsin-catalyzed protein digestion in proteome samples. In this study, we applied quantitative proteomics via triplex stable isotope dimethyl labeling to investigate the kinetics of trypsin-catalyzed cleavage. It was found that trypsin cleaves the C-terminal to lysine (K) and arginine (R) residues with higher rates for R. And the cleavage sites surrounded by neutral residues could be quickly cut, while those with neighboring charged residues (D/E/K/R) or proline residue (P) could be slowly cut. In a proteome sample, a huge number of proteins with different physical chemical properties coexists. If any type of protein could be preferably digested, then limited digestion could be applied to reduce the sample complexity. However, we found that protein abundance and other physicochemical properties, such as molecular weight (Mw), grand average of hydropathicity (GRAVY), aliphatic index, and isoelectric point (pI) have no notable correlation with digestion priority of proteins.

  7. Skeletal muscle protease activities in the early growth and development of wild Atlantic salmon (Salmo salar L.).

    Science.gov (United States)

    Lysenko, Liudmila A; Kantserova, Nadezda P; Kaivarainen, Elena I; Krupnova, Marina Yu; Nemova, Nina N

    2017-09-01

    Growth-related dynamics of intracellular protease activities in four year classes of the Atlantic salmon (Salmo salar L. 1758) parr and smolts inhabiting salmon rivers of northwestern Russia (the White Sea basin) were studied. Cathepsin B, cathepsin D, proteasome, and calpain activities in the skeletal muscles of salmon were assessed to investigate their relative contribution to the total protein degradation as well as to young fish growth process. It was confirmed that calpain activity dominates in salmon muscles while proteasome plays a minor role, in contrast to terrestrial vertebrates. Calpain and proteasome activities were maximal at the early post-larval stage (in parrs 0+) and declined with age (parrs 1+ through 2+) dropping to the lowest level in salmon smolts. Annual growth increments and proteolytic activities of calpains and proteasome in the muscles of salmon juveniles changed with age in an orchestrated manner, while lysosomal cathepsin activities increased with age. Comparing protease activities and growth increments in salmon parr and smolts we suggested that the partial suppression of the protein degradation could be a mechanism stimulating efficient growth in smoltifying salmon. Growth and smoltification-related dynamics of protease activities was quite similar in salmon populations from studied spawning rivers, such as Varzuga and Indera; however, some habitat-related differences were observed. Growth increments and protease activities varied in salmon parr 0+ (but not on later ages) inhabiting either main rivers or small tributaries apparently due to habitat difference on the resources for fish growth. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Influence of Different Genotypes on Trypsin Inhibitor Levels and Activity in Soybeans

    Directory of Open Access Journals (Sweden)

    Viktor A. Nedovic

    2007-01-01

    Full Text Available This study describes the relationship between the two major trypsin inhibitors (TI in soybean, i.e., the Kunitz (KTI and Bowman-Birk (BBI trypsin inhibitors, as well as between them and the corresponding trypsin inhibitor activity (TIA. Twelve investigated soybean genotypes showed significant differences in TI levels and TIA. A very strong positive correlation was found between the levels of KTI and total BBI (r = 0.94, P < 0.05. No relationship was found between KTI, BBI or total TI and TIA. Based on this data, it appears that the levels of major TI in soybean are related. Understanding the relationship between trypsin inhibitors and their activities could be useful for further improvement of the health impacts of soy proteins.

  9. The use of poly(ethylene terephthalate)-poly(aniline) composite for trypsin immobilisation

    Energy Technology Data Exchange (ETDEWEB)

    Caramori, S.S. [Laboratorio de Quimica de Proteinas, Departamento de Bioquimica e Biologia Molecular, Instituto de Ciencias Biologicas, Universidade Federal de Goias, Cx. Postal 131, 74001-970 Goiania-GO (Brazil)], E-mail: samanthabio@hotmail.com; Fernandes, K.F. [Laboratorio de Quimica de Proteinas, Departamento de Bioquimica e Biologia Molecular, Instituto de Ciencias Biologicas, Universidade Federal de Goias, Cx. Postal 131, 74001-970 Goiania-GO (Brazil)], E-mail: katia@icb.ufg.br

    2008-08-01

    This paper presents trypsin immobilisation on strips of poly(ethylene terephthalate)-poly(aniline), activated with glutaraldehyde (PET-PANIG) composite. The photomicrography of the material showed changes corresponding to the chemical modifications produced in the steps of synthesis. The immobilisation process was very efficient under optimal conditions (18.6%). The immobilised and free enzyme presented the same pH and temperature optimum. PET-PANIG-trypsin was able to hydrolyse casein, albumin, gelatine, and skimmed milk. Km{sub app} value for PET-PANIG-trypsin was very close to Km of the free enzyme for casein. Immobilised trypsin showed higher stability than the free enzyme, with 100% activity after 14 days of storage at 4 deg. C and 100% operational stability after 4 cycles of use.

  10. Anti-inflammatory effects of tetradecylthioacetic acid (TTA in macrophage-like cells from Atlantic salmon (Salmo salar L.

    Directory of Open Access Journals (Sweden)

    Grammes Fabian

    2011-07-01

    Full Text Available Abstract Background Commercial Atlantic salmon is fed diets with high fat levels to promote fast and cost-effective growth. To avoid negative impact of obesity, food additives that stimulate fat metabolism and immune function are of high interest. TTA, tetradecylthioacetic acid, is a synthetic fatty acid that stimulates mitochondrial β-oxidation most likely by activation of peroxysome proliferator-activated receptors (PPARs. PPARs are important transcription factors regulating multiple functions including fat metabolism and immune responses. Atlantic salmon experiments have shown that TTA supplemented diets significantly reduce mortality during natural outbreaks of viral diseases, suggesting a modulatory role of the immune system. Results To gain new insights into TTA effects on the Atlantic salmon immune system, a factorial, high-throughput microarray experiment was conducted using a 44K oligo nucleotide salmon microarray SIQ2.0 and the Atlantic salmon macrophage-like cell line ASK. The experiment was used to determine the transcriptional effects of TTA, the effects of TTA in poly(I:C elicited cells and the effects of pretreating the cells with TTA. The expression patterns revealed that a large proportion of genes regulated by TTA were related to lipid metabolism and increased mitochondrial β-oxidation. In addition we found that for a subset of genes TTA antagonized the transcriptional effects of poly(I:C. This, together with the results from qRT-PCR showing an increased transcription of anti-inflammatory IL10 by TTA, indicates anti-inflammatory effects. Conclusions We demonstrate that TTA has significant effects on macrophage-like salmon cells that are challenged by the artificial dsRNA poly(I:C. The immune stimulatory effect of TTA in macrophages involves increased lipid metabolism and suppressed inflammatory status. Thus, suggesting that TTA directs the macrophage-like cells towards alternative, anti-inflammatory, activation. This has

  11. Effect of exposure on salmon lice Lepeophtheirus salmonis population dynamics in Faroese salmon farms

    DEFF Research Database (Denmark)

    Patursson, Esbern J.; Simonsen, Knud; Visser, Andre

    2017-01-01

    We assessed variations in salmon lice Lepeophtheirus salmonis population dynamics in Faroese salmon farms in relationship to their physical exposure to local circulation patterns and flushing with adjacent waters. Factors used in this study to quantify physical exposure are estimates...... of the freshwater exchange rate, the tidal exchange rate and dispersion by tidal currents. Salmon farms were ranked according to the rate of increase in the average numbers of salmon lice per fish. In a multiple linear regression, physical exposure together with temperature were shown to have a significant effect...... threshold of salmon stocking numbers for outbreaks of infection. The study presents a simple method of characterizing salmon farming fjords in terms of their different exposure levels and how they relate to potential self-infection at these sites...

  12. The Expression of Leptin, Estrogen Receptors, and Vitellogenin mRNAs in Migrating Female Chum Salmon, : The Effects of Hypo-osmotic Environmental Changes

    Directory of Open Access Journals (Sweden)

    Young Jae Choi

    2014-04-01

    Full Text Available Leptin plays an important role in energy homeostasis and reproductive function in fish, especially in reproduction. Migrating fish, such as salmonoids, are affected by external environmental factors, and salinity changes are a particularly important influence on spawning migrations. The aim of this study was to test whether changes in salinity affect the expression of leptin, estrogen receptors (ERs, and vitellogenin (VTG in chum salmon (Oncorhynchus keta. The expression and activity of leptin, the expression of ERs and VTG, and the levels of estradiol-17β and cortisol increased after the fish were transferred to FW, demonstrating that changes in salinity stimulate the HPG axis in migrating female chum salmon. These findings reveal details about the role of elevated leptin levels and sex steroid hormones in stimulating sexual maturation and reproduction in response to salinity changes in chum salmon.

  13. Captive Rearing Initiative for Salmon River Chinook Salmon, 1998-1999 Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hassemer, Peter F.

    2001-04-01

    During 1999, the Idaho Department of Fish and Game (IDFG) continued developing techniques for the captive rearing of chinook salmon Oncorhynchus tshawytscha. Techniques under development included protocols for rearing juveniles in freshwater and saltwater hatchery environments, and fieldwork to collect brood year 1998 and 1999 juveniles and eggs and to investigate the ability of these fish to spawn naturally. Fish collected as juveniles were held for a short time at the Sawtooth Fish Hatchery and later transferred to the Eagle Fish Hatchery for rearing. Eyed-eggs were transferred immediately to the Eagle Fish Hatchery where they were disinfected and reared by family groups. When fish from either collection method reached approximately 60 mm, they were PIT tagged and reared separately by brood year and source stream. Sixteen different groups were in culture at IDFG facilities in 1999. Hatchery spawning activities of captive-reared chinook salmon produced eyed-eggs for outplanting in streamside incubation chambers in the West Fork Yankee Fork Salmon River (N=2,297) and the East Fork Salmon River (N=1,038). Additionally, a number of these eggs were maintained at the Eagle Fish Hatchery to ensure adequate brood year 1999 representation from these systems, and produced 279 and 87 juveniles from the West Fork Yankee Fork and East Fork Salmon River, respectively. Eyed-eggs were not collected from the West Fork Yankee Fork due to low adult escapement. Brood year 1998 juveniles were collected from the Lemhi River (N=191), West Fork Yankee Fork Salmon River (N=229), and East Fork Salmon River (N=185). Additionally, brood year 1999 eyed-eggs were collected from the Lemhi River (N=264) and East Fork Salmon River (N=143). Sixty-two and seven maturing adults were released into Bear Valley Creek (Lemhi River system) and the East Fork Salmon River, respectively, for spawning evaluation in 1999. Nine female carcasses from Bear Valley Creek were examined for egg retention, and of

  14. Purification and characterization of a trypsin inhibitor from the seeds of Artocarpus heterophyllus Lam.

    Science.gov (United States)

    Lyu, Junchen; Liu, Yuan; An, Tianchen; Liu, Yujun; Wang, Manchuriga; Song, Yanting; Zheng, Feifei; Wu, Dan; Zhang, Yingxia; Deng, Shiming

    2015-05-01

    A proteinaceous inhibitor against trypsin was isolated from the seeds of Artocarpus heterophyllus Lam. by successive ammonium sulfate precipitation, ion-exchange, and gel-filtration chromatography. The trypsin inhibitor, named as AHLTI (A. heterophyllus Lam. trypsin inhibitor), consisted of a single polypeptide chain with a molecular weight of 28.5 kDa, which was confirmed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and gel-filtration chromatography. The N-terminal sequence of AHLTI was DEPPSELDAS, which showed no similarity to other known trypsin inhibitor sequence. AHLTI completely inhibited bovine trypsin at a molar ratio of 1:2 (AHLTI:trypsin) analyzed by native polyacrylamide gel electrophoresis, inhibition activity assay, and gel-filtration chromatography. Moreover, kinetic enzymatic studies were carried out to understand the inhibition mechanism of AHLTI against trypsin. Results showed that AHLTI was a competitive inhibitor with an equilibrium dissociation constant (Ki) of 3.7 × 10(-8) M. However, AHLTI showed weak inhibitory activity toward chymotrypsin and elastase. AHLTI was stable over a broad range of pH 4-8 and temperature 20-80°C. The reduction agent, dithiothreitol, had no obvious effect on AHLTI. The trypsin inhibition assays of AHLTI toward digestive enzymes from insect pest guts in vitro demonstrated that AHLTI was effective against enzymes from Locusta migratoria manilensis (Meyen). These results suggested that AHLTI might be a novel trypsin inhibitor from A. heterophyllus Lam. belonging to Kunitz family, and play an important role in protecting from insect pest. © The Author 2015. Published by ABBS Editorial Office in association with Oxford University Press on behalf of the Institute of Biochemistry and Cell Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences.

  15. Characterization of trypsin-derived peptides acrylamide-adducted hemoglobin

    International Nuclear Information System (INIS)

    Springer, D.L.; Goheen, S.C.; Edmonds, C.G.; McCulloch, M.; Sylvester, D.M.; Sander, C.; Bull, R.J.

    1991-01-01

    Even though there are a number of sources for human exposure to acrylamide, reliable biomarkers of exposure are not available. In an effort to develop such a biomarker, the authors are characterizing peptides derived from trypsin digests of acrylamide-adducted hemoglobin. For this, radiolabeled acrylamide was incubated with this, radiolabeled acrylamide was incubated with purified human hemoglobin (Ao) and decomposition products removed by dialysis. When the adducted hemoglobin was separated by reverse-phase HPLC, radioactivity eluted with the α and β subunits, suggesting covalent binding. Digestion of individual subunits with trypsin followed by reverse phase HPLC, indicated that most of the radioactivity associated with the α subunit co-eluted with a single peptide. Similar results were observed for the β subunit except that significant amounts of radioactivity eluted with the solvent front, suggesting that radioactivity was released by trypsin digestion. Currently, these preparation are under further characterization by electrospray ionization mass spectrometry. This approach will aid in the identification of the adducted will aid in the identification of the adducted peptide and subsequent preparation of an acrylamide-specific antibody

  16. 50 CFR 226.205 - Critical habitat for Snake River sockeye salmon, Snake River fall chinook salmon, and Snake River...

    Science.gov (United States)

    2010-10-01

    ... salmon, Snake River fall chinook salmon, and Snake River spring/summer chinook salmon. 226.205 Section... Snake River sockeye salmon, Snake River fall chinook salmon, and Snake River spring/summer chinook salmon. The following areas consisting of the water, waterway bottom, and adjacent riparian zone of...

  17. Calcitonin Salmon Injection

    Science.gov (United States)

    Calcitonin salmon injection is used to treat osteoporosis in postmenopausal women. Osteoporosis is a disease that causes bones to weaken and break more easily. Calcitonin salmon injection is also used to treat Paget's disease ...

  18. Asymmetric hybridization and introgression between pink salmon and chinook salmon in the Laurentian Great Lakes

    Science.gov (United States)

    Rosenfield, Jonathan A.; Todd, Thomas; Greil, Roger

    2000-01-01

    Among Pacific salmon collected in the St. Marys River, five natural hybrids of pink salmon Oncorhynchus gorbuscha and chinook salmon Oncorhynchus tshawytscha and one suspected backcross have been detected using morphologic, meristic, and color evidence. One allozyme (LDH, l-lactate dehydrogenase from muscle) and one nuclear DNA locus (growth hormone) for which species-specific fixed differences exist were analyzed to detect additional hybrids and to determine if introgression had occurred. Restriction fragment length polymorphism of mitochondrial DNA (mtDNA) was used to identify the maternal parent of each hybrid. Evidence of introgression was found among the five previously identified hybrids. All hybrid specimens had chinook salmon mtDNA, indicating that hybridization between chinook salmon and pink salmon in the St. Marys River is asymmetric and perhaps unidirectional. Ecological, physiological, and sexual selection forces may contribute to this asymmetric hybridization. Introgression between these highly differentiated species has implications for management, systematics, and conservation of Pacific salmon.

  19. Gamma rays induced mutation for low phytic acid and trypsin inhibitor content in soybean

    International Nuclear Information System (INIS)

    Gupta, S.K.; Manjaya, J.G.

    2017-01-01

    Soybean (Glycine max (L.) Merrill) is an important source of vegetable protein and is used as a food, feed and health supplement. However, consumption of soybean as food is limited because of the presence of many anti-nutritional factors. Trypsin inhibitors and phytic acid are two major anti-nutritional factors present in soybean that need to be removed for increasing the soybean consumption as food. Trypsin inhibitor is known to inhibit the trypsin/chymotrpsin activity and phytic acid reduces the bioavailability of essential micronutrients in digestive tract, resulting in adverse effect on health. Therefore, developing soybean cultivars having low trypsin inhibitors and phytic acid content is highly desirable. Soybean cultivar JS 93-05 was irradiated with 250 Gy gamma rays to induce mutation for various morphological and biochemical characters. A large number of mutants with altered morphological characters were identified. Ninety true breeding mutant lines in M6 generation were screened for trypsin inhibitor and phytic acid content. The phytic acid content was estimated using modified colorimetric method and trypsin inhibitor concentration was estimated using BAPNA as substrate in colorimetric method. The phytic acid content in the mutants varied from 7.59 to 24.14 mg g -1 . Two mutants lines TSG - 62 (7.59 mg g -1 ) and TSG - 66 (9.62 mg g -1 ) showed significant low phytic acid content as compared to the parent JS 93-05 (20.19 mg g -1 ). The trypsin inhibitor concentration in the mutants varied from 19.92 to 53.64 TIU mg -1 and one mutant line (TSG -14) was found with the lowest trypsin inhibitor concentration of 19.92 TIU mg -1 compared to parent JS 93-05 (50.90 TIU mg -1 ). The mutant lines identified in this study will serve as important genetic resources for developing low phytic acid and low trypsin inhibitor cultivars in soybean. (author)

  20. Piscine reovirus, but not Jaundice Syndrome, was transmissible to Chinook Salmon, Oncorhynchus tshawytscha (Walbaum), Sockeye Salmon, Oncorhynchus nerka (Walbaum), and Atlantic Salmon, Salmo salar L.

    Science.gov (United States)

    Garver, Kyle A.; Marty, Gary D.; Cockburn, Sarah N.; Richard, Jon; Hawley, Laura M.; Müller, Anita; Thompson, Rachel L.; Purcell, Maureen K.; Saksida, Sonja M.

    2015-01-01

    A Jaundice Syndrome occurs sporadically among sea-pen-farmed Chinook Salmon in British Columbia, the westernmost province of Canada. Affected salmon are easily identified by a distinctive yellow discolouration of the abdominal and periorbital regions. Through traditional diagnostics, no bacterial or viral agents were cultured from tissues of jaundiced Chinook Salmon; however, piscine reovirus (PRV) was identified via RT-rPCR in all 10 affected fish sampled. By histopathology, Jaundice Syndrome is an acute to peracute systemic disease, and the time from first clinical signs to death is likely jaundiced Chinook Salmon, developed no gross or microscopic evidence of jaundice despite persistence of PRV for the 5-month holding period. The results from this study demonstrate that the Jaundice Syndrome was not transmissible by injection of material from infected fish and that PRV was not the sole aetiological factor for the condition. Additionally, these findings showed the Pacific coast strain of PRV, while transmissible, was of low pathogenicity for Atlantic Salmon, Chinook Salmon and Sockeye Salmon.

  1. Structural and functional studies of STAT1 from Atlantic salmon (Salmo salar

    Directory of Open Access Journals (Sweden)

    Thim Hanna L

    2010-03-01

    Full Text Available Abstract Background Type I and type II interferons (IFNs exert their effects mainly through the JAK/STAT pathway, which is presently best described in mammals. STAT1 is involved in signaling pathways induced by both types of IFNs. It has a domain-like structure including an amino-terminus that stabilizes interaction between STAT dimers in a promoter-binding situation, a coiled coil domain facilitating interactions to other proteins, a central DNA-binding domain, a SH2 domain responsible for dimerization of phosphorylated STATs and conserved phosphorylation sites within the carboxy terminus. The latter is also the transcriptional activation domain. Results A salmon (Salmo salar STAT1 homologue, named ssSTAT1a, has been identified and was shown to be ubiquitously expressed in various cells and tissues. The ssSTAT1a had a domain-like structure with functional motifs that are similar to higher vertebrates. Endogenous STAT1 was shown to be phosphorylated at tyrosine residues both in salmon leukocytes and in TO cells treated with recombinant type I and type II IFNs. Also ectopically expressed ssSTAT1 was phosphorylated in salmon cells upon in vitro stimulation by the IFNs, confirming that the cloned gene was recognized by upstream tyrosine kinases. Treatment with IFNs led to nuclear translocation of STAT1 within one hour. The ability of salmon STAT1 to dimerize was also shown. Conclusions The structural and functional properties of salmon STAT1 resemble the properties of mammalian STAT1.

  2. Quantitative risk assessment of salmon louse-induced mortality of seaward-migrating post-smolt Atlantic salmon

    Directory of Open Access Journals (Sweden)

    Anja Bråthen Kristoffersen

    2018-06-01

    Full Text Available The Norwegian government recently implemented a new management system to regulate salmon farming in Norway, aiming to promote environmentally sustainable growth in the aquaculture industry. The Norwegian coast has been divided into 13 production zones and the volume of salmonid production in the zones will be regulated based on salmon lice effects on wild salmonids. Here we present a model for assessing salmon louse-induced mortality of seaward-migrating post-smolts of Atlantic salmon. The model quantifies expected salmon lice infestations and louse-induced mortality of migrating post-smolt salmon from 401 salmon rivers draining into Norwegian coastal waters. It is assumed that migrating post-smolts follow the shortest path from river outlets to the high seas, at constant progression rates. During this migration, fish are infested by salmon lice of farm origin according to an empirical infestation model. Furthermore, louse-induced mortality is estimated from the estimated louse infestations. Rivers draining into production zones on the West Coast of Norway were at the highest risk of adverse lice effects. In comparison, rivers draining into northerly production zones, along with the southernmost production zone, were at lower risk. After adjusting for standing stock biomass, estimates of louse-egg output varied by factors of up to 8 between production zones. Correlation between biomass adjusted output of louse infestation and densities of farmed salmon in the production zones suggests that a large-scale density-dependent host-parasite effect is a major driver of louse infestation rates and parasite-induced mortality. The estimates are sensitive to many of the processes in the chain of events in the model. Nevertheless, we argue that the model is suited to assess spatial and temporal risks associated with farm-origin salmon lice. Keywords: Density dependent, Sea lice, Transmission, Farmed salmon, Migration pathway, Migration time

  3. Sockeye salmon evolution, ecology, and management

    Science.gov (United States)

    Woody, Carol Ann

    2007-01-01

    This collection of articles and photographs gives managers a good idea of recent research into what the sockeye salmon is and does, covering such topics as the vulnerability and value of sockeye salmon ecotypes, their homing ability, using new technologies to monitor reproduction, DNA and a founder event in the Lake Clark sockeye salmon, marine-derived nutrients, the exploitation of large prey, dynamic lake spawning migrations by females, variability of sockeye salmon residence, expression profiling using cDNA microarray technology, learning from stable isotropic records of native otolith hatcheries, the amount of data needed to manage sockeye salmon and estimating salmon "escapement." 

  4. The effect of exposure to farmed salmon on piscine orthoreovirus infection and fitness in wild Pacific salmon in British Columbia, Canada.

    Directory of Open Access Journals (Sweden)

    Alexandra Morton

    Full Text Available The disease Heart and Skeletal Muscle Inflammation (HSMI is causing substantial economic losses to the Norwegian salmon farming industry where the causative agent, piscine orthoreovirus (PRV, is reportedly spreading from farmed to wild Atlantic salmon (Salmo salar with as yet undetermined impacts. To assess if PRV infection is epidemiologically linked between wild and farmed salmon in the eastern Pacific, wild Pacific salmon (Oncorhynchus sp. from regions designated as high or low exposure to salmon farms and farmed Atlantic salmon reared in British Columbia (BC were tested for PRV. The proportion of PRV infection in wild fish was related to exposure to salmon farms (p = 0.0097. PRV was detected in: 95% of farmed Atlantic salmon, 37-45% of wild salmon from regions highly exposed to salmon farms and 5% of wild salmon from the regions furthest from salmon farms. The proportion of PRV infection was also significantly lower (p = 0.0008 where wild salmon had been challenged by an arduous return migration into high-elevation spawning habitat. Inter-annual PRV infection declined in both wild and farmed salmon from 2012-2013 (p ≤ 0.002. These results suggest that PRV transfer is occurring from farmed Atlantic salmon to wild Pacific salmon, that infection in farmed salmon may be influencing infection rates in wild salmon, and that this may pose a risk of reduced fitness in wild salmon impacting their survival and reproduction.

  5. Salmon-Eating Grizzly Bears Exposed to Elevated Levels of Marine Derived Persistent Organic Pollutants

    Science.gov (United States)

    Christensen, J. R.; Ross, P. S.; Whiticar, M. J.

    2004-12-01

    The coastal grizzly bears of British Columbia (BC, Canada) rely heavily on salmon returning from the Pacific Ocean, whereas interior bears do not have access to or readily utilize this marine-derived food source. Since salmon have been shown to accumulate persistent organic pollutants (POPs) from the North Pacific Ocean, we hypothesized that salmon consumption by grizzly bears would be reflected by an increase in the POP burden. To test this hypothesis we collected hair and fat tissue from grizzlies at various locations around BC to compare salmon-eating (coastal) grizzlies to non-salmon-eating (interior) grizzlies. We characterized the feeding habits for each bear sampled by measuring the stable carbon and nitrogen isotope signature of their hair. The positive relationship between 13C/12C and 15N/14N isotopic ratios suggests that the majority of the meat portion of the diet of coastal grizzlies is coming from salmon, rather than from terrestrial or freshwater sources. By contrast, stable isotope ratios revealed that interior bears have an almost exclusive vegetarian diet with no marine influence. As hypothesized, the coastal grizzly bears have significantly greater OC pesticide and lower-brominated PBDE congener body burden than the interior grizzlies. We also found a positive relationship between C and N isotope ratios and these same POP contaminants in bear tissue. Overall, these results demonstrate that Pacific salmon represents a significant vector delivering both OC pesticides and PBDEs to BC coastal grizzly bears.

  6. Rapid and Efficient Protein Digestion using Trypsin Coated Magnetic Nanoparticles under Pressure Cycles

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Byoungsoo; Lopez-Ferrer, Daniel; Kim, Byoung Chan; Na, Hyon Bin; Park, Yong Il; Weitz, Karl K.; Warner, Marvin G.; Hyeon, Taeghwan; Lee, Sang-Won; Smith, Richard D.; Kim, Jungbae

    2011-01-01

    Trypsin-coated magnetic nanoparticles (EC-TR/NPs), prepared via a simple crosslinking of the enzyme to magnetic nanoparticles, were highly stable and could be easily captured using a magnet after the digestion was complete. EC-TR/NPs showed a negligible loss of trypsin activity after multiple uses and continuous shaking, while a control sample of covalently-attached trypsin on NPs resulted in a rapid inactivation under the same conditions due to the denaturation and autolysis of trypsin. Digestions were carried out on a single model protein, a five protein mixture, and a whole mouse brain proteome, and also compared for digestion at atmospheric pressure and 37 ºC for 12 h, and in combination with pressure cycling technology (PCT) at room temperature for 1 min. In all cases, the EC-TR/NPs performed equally as well or better than free trypsin in terms of the number of peptide/protein identifications and reproducibility across technical replicates. However, the concomitant use of EC-TR/NPs and PCT resulted in very fast (~1 min) and more reproducible digestions.

  7. Salmon tracing: Genotyping to trace back escapees from salmon aquaculture

    NARCIS (Netherlands)

    Blonk, R.J.W.

    2014-01-01

    The overall objective of the project is to assign an escaped salmon back to the farm responsible for the escape with near 100% accuracy. In this report, the potential of a set of genetic markers to assign an escaped salmon was determined for a set of 12 polymorphic microsatellite markers, provided

  8. 78 FR 62616 - Salmon Creek Hydroelectric Company, Salmon Creek Hydroelectric Company, LLC; Notice of Transfer...

    Science.gov (United States)

    2013-10-22

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 3730-005] Salmon Creek Hydroelectric Company, Salmon Creek Hydroelectric Company, LLC; Notice of Transfer of Exemption 1. By letter filed September 23, 2013, Salmon Creek Hydroelectric Company informed the Commission that they have...

  9. The inhibitory effect of salmon calcitonin on tri-iodothyronine induction of early hypertrophy in articular cartilage.

    Directory of Open Access Journals (Sweden)

    Pingping Chen-An

    Full Text Available Salmon calcitonin has chondroprotective effect both in vitro and in vivo, and is therefore being tested as a candidate drug for cartilage degenerative diseases. Recent studies have indicated that different chondrocyte phenotypes may express the calcitonin receptor (CTR differentially. We tested for the presence of the CTR in chondrocytes from tri-iodothyronin (T3-induced bovine articular cartilage explants. Moreover, investigated the effects of human and salmon calcitonin on the explants.Early chondrocyte hypertrophy was induced in bovine articular cartilage explants by stimulation over four days with 20 ng/mL T3. The degree of hypertrophy was investigated by molecular markers of hypertrophy (ALP, IHH, COLX and MMP13, by biochemical markers of cartilage turnover (C2M, P2NP and AGNxII and histology. The expression of the CTR was detected by qPCR and immunohistochemistry. T3-induced explants were treated with salmon or human calcitonin. Calcitonin down-stream signaling was measured by levels of cAMP, and by the molecular markers.Compared with untreated control explants, T3 induction increased expression of the hypertrophic markers (p<0.05, of cartilage turnover (p<0.05, and of CTR (p<0.01. Salmon, but not human, calcitonin induced cAMP release (p<0.001. Salmon calcitonin also inhibited expression of markers of hypertrophy and cartilage turnover (p<0.05.T3 induced early hypertrophy of chondrocytes, which showed an elevated expression of the CTR and was thus a target for salmon calcitonin. Molecular marker levels indicated salmon, but not human, calcitonin protected the cartilage from hypertrophy. These results confirm that salmon calcitonin is able to modulate the CTR and thus have chondroprotective effects.

  10. Action of trypsin on structural changes of collagen fibres from sea cucumber (Stichopus japonicus).

    Science.gov (United States)

    Liu, Zi-Qiang; Tuo, Feng-Yan; Song, Liang; Liu, Yu-Xin; Dong, Xiu-Ping; Li, Dong-Mei; Zhou, Da-Yong; Shahidi, Fereidoon

    2018-08-01

    Trypsin, a representative serine proteinase, was used to hydrolyse the collagen fibres from sea cucumber (Stichopus japonicus) to highlight the role of serine proteinase in the autolysis of sea cucumber. Partial disaggregation of collagen fibres into collagen fibrils upon trypsin treatment occurred. The trypsin treatment also caused a time-dependent release of water-soluble glycosaminoglycans and proteins. Therefore, the degradation of the proteoglycan bridges between collagen fibrils might account for the disaggregation of collagen fibrils. For trypsin-treated collagen fibres (72 h), the collagen fibrils still kept their structural integrity and showed characteristic D-banding pattern, and the dissolution rate of hydroxyproline was just 0.21%. Meanwhile, Fourier transform infrared analysis showed the collagen within trypsin-treated collagen fibres (72 h) still retaining their triple-helical conformation. These results suggested that serine proteinase participated in the autolysis of S. japonicus body wall by damaging the proteoglycan bridges between collagen fibrils and disintegrating the latter. Copyright © 2018 Elsevier Ltd. All rights reserved.

  11. Increased susceptibility to infectious salmon anemia virus (ISAv) in Lepeophtheirus salmonis – infected Atlantic salmon

    Science.gov (United States)

    The salmon louse and infectious salmon anemia virus (ISAv) are the two most significant pathogens of concern to the Atlantic salmon (Salmo salar) aquaculture industry. However, the interactions between sea lice and ISAv, as well as the impact of a prior sea lice infection on the susceptibility of th...

  12. Trypsin diminishes the rat potency of polio serotype 3.

    Science.gov (United States)

    ten Have, R; Westdijk, J; Levels, L M A R; Koedam, P; de Haan, A; Hamzink, M R J; Metz, B; Kersten, G F A

    2015-11-01

    This study addresses observations made in view of testing in practice the guideline in the European Pharmacopoeia (EP) on omitting the rat potency test for release of polio containing vaccines. In general, use of the guideline is valid and the D-antigen ELISA can indeed be used as an in vitro alternative for the in vivo test. However, the set-up of the ELISA is crucial and should include detection of antigenic site 1 in polio serotype 3 as destruction of that site by trypsin results in a reduced rat potency. Antigenic site 1 in polio serotype 2 may also be modified by trypsin, but the cleavage of viral protein 1 (VP1) did not affect the rat potency. Therefore, any antigenic site, except site 1, can be used for detection of polio serotype 2. It is advised to include testing of the effect of trypsin treatment in the EP-guideline. This allows polio vaccine manufacturers to check whether their in-house ELISA needs improvement. Copyright © 2015 The International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  13. Evaluation of emamectin benzoate and substance EX against salmon lice in sea-ranched Atlantic salmon smolts.

    Science.gov (United States)

    Skilbrei, Ove Tommy; Espedal, Per Gunnar; Nilsen, Frank; Garcia, Enrique Perez; Glover, Kevin A

    2015-04-08

    Experimental releases of Atlantic salmon smolts treated with emamectin benzoate (EB) against salmon lice have previously been used to estimate the significance of salmon lice on the survival of migrating smolts. In recent years, the salmon louse has developed reduced sensitivity to EB, which may influence the results of such release experiments. We therefore tested the use of 2 anti-lice drugs: EB was administered to salmon smolts in high doses by intra-peritoneal injection and the prophylactic substance EX (SubEX) was administered by bathing. A third, untreated control group was also established. Salmon were challenged with copepodids of 2 strains of salmon lice (1 EB-sensitive strain and 1 with reduced EB-sensitivity) in mixed-group experimental tanks. At 31 d post-challenge, the numbers of pre-adult lice on treated fish were around 20% compared with the control fish, with minor or no differences between the 2 treatments and lice strains. Both treatments therefore appeared to give the smolts a high degree of protection against infestation of copepodids of salmon lice. However, significantly lower growth of the EB-treatment group indicates that bathing the fish in SubEX is less stressful for smolts than intra-peritoneal injection of EB.

  14. Differential effects of mercurial compounds on the electroolfactogram (EOG) of salmon (Salmo salar L.)

    DEFF Research Database (Denmark)

    Baatrup, E; Døving, K B; Winberg, S

    1991-01-01

    The effects on the salmon (Salmo salar L.) electroolfactogram (EOG) of the two mercurials, mercuric chloride (HgCl2) and methylmercuric chloride (CH3HgCl), were studied. The EOG responses were evoked by stimulating the olfactory epithelium with 340 microM L-alanine for 10 sec every second minute...

  15. Structure basis 1/2SLPI and porcine pancreas trypsin interaction

    Energy Technology Data Exchange (ETDEWEB)

    Fukushima, Kei; Kamimura, Takashi; Takimoto-Kamimura, Midori, E-mail: m.kamimura@teijin.co.jp [Teijin Institute for Bio-Medical Research, 4-3-2 Asahigaoka, Hino-shi, Tokyo 191-8512 (Japan)

    2013-11-01

    1/2SLPI is a C-terminal domain of SLPI (secretory leukocyte protease inhibitor) which inhibits various serine proteases broadly. The present study is the first X-ray structural report on how 1/2SLPI with P1 Leu strongly inhibits trypsin and how it can inhibit multiple serine proteases. SLPI (secretory leukocyte protease inhibitor) is a 107-residue protease inhibitor which inhibits various serine proteases, including elastase, cathepsin G, chymotrypsin and trypsin. SLPI is obtained as a multiple inhibitor in lung defense and in chronic airway infection. X-ray crystal structures have so far reported that they are full-length SLPIs with bovine α-chymotrypsin and 1/2SLPI (recombinant C-terminal domain of SLPI; Arg58–Ala107) with HNE (human neutrophil elastase). To understand the role of this multiple inhibitory mechanism, the crystal structure of 1/2SLPI with porcine pancreas trypsin was solved and the binding modes of two other complexes compared. The Leu residue surprisingly interacts with the S1 site of trypsin, as with chymotrypsin and elastase. The inhibitory mechanism of 1/2SLPI using the wide primary binding site contacts (from P2′ to P5) with various serine proteases is discussed. These inhibitory mechanisms have been acquired in the evolution of the protection system for acute inflammatory diseases.

  16. Label-free electrical determination of trypsin activity by a silicon-on-insulator based thin film resistor.

    Science.gov (United States)

    Neff, Petra A; Serr, Andreas; Wunderlich, Bernhard K; Bausch, Andreas R

    2007-10-08

    A silicon-on-insulator (SOI) based thin film resistor is employed for the label-free determination of enzymatic activity. We demonstrate that enzymes, which cleave biological polyelectrolyte substrates, can be detected by the sensor. As an application, we consider the serine endopeptidase trypsin, which cleaves poly-L-lysine (PLL). We show that PLL adsorbs quasi-irreversibly to the sensor and is digested by trypsin directly at the sensor surface. The created PLL fragments are released into the bulk solution due to kinetic reasons. This results in a measurable change of the surface potential allowing for the determination of trypsin concentrations down to 50 ng mL(-1). Chymotrypsin is a similar endopeptidase with a different specificity, which cleaves PLL with a lower efficiency as compared to trypsin. The activity of trypsin is analyzed quantitatively employing a kinetic model for enzyme-catalyzed surface reactions. Moreover, we have demonstrated the specific inactivation of trypsin by a serine protease inhibitor, which covalently binds to the active site of the enzyme.

  17. Supplementing long-chain n-3 polyunsaturated fatty acids in canned wild Pacific pink salmon with Alaska salmon oil

    Science.gov (United States)

    Lapis, Trina J; Oliveira, Alexandra C M; Crapo, Charles A; Himelbloom, Brian; Bechtel, Peter J; Long, Kristy A

    2013-01-01

    Establishing n-3 polyunsaturated fatty acid contents in canned wild Alaska pink salmon products is challenging due to ample natural variation found in lipid content of pink salmon muscle. This study investigated the effect of adding salmon oil (SO) to canned pink salmon produced from fish exhibiting two opposite degrees of skin watermarking, bright (B) and dark (D). Specific goals of the study were to evaluate the benefits of adding SO to canned pink salmon with regard to nutritional value of the product, sensory characteristics, and the oxidative and hydrolytic stability of the lipids over thermal processing. Six groups of canned pink salmon were produced with variable levels of SO, either using bright (with 0, 1, or 2% SO) or dark (with 0, 2, or 4% SO) pink salmon. Compositional analysis revealed highest (P  0.05) ranging from 5.7% to 6.8%. Consequently, addition of SO to canned pink salmon allowed for consistent lipid content between bright and dark fish. Addition of 1% or 2% SO to canned bright pink salmon was not detrimental to the sensory properties of the product. It is recommended that canned bright pink salmon be supplemented with at least 1% SO, while supplementation with 2% SO would guarantee a minimum quantity of 1.9 g of n-3 fatty acids per 100 g of product. Addition of 4% SO to canned dark pink salmon was detrimental to product texture and taste, while supplementation with 2% SO did not negatively affect sensorial properties of the product. Accordingly, canned dark pink salmon should be supplemented with 2% SO so that a minimum n-3 fatty acids content of 1.5 g per 100 g of product. PMID:24804010

  18. Calcitonin Salmon Nasal Spray

    Science.gov (United States)

    Calcitonin salmon is used to treat osteoporosis in women who are at least 5 years past menopause and cannot ... a human hormone that is also found in salmon. It works by preventing bone breakdown and increasing ...

  19. Biochemical Characterization of An Arginine-Specific Alkaline Trypsin from Bacillus licheniformis.

    Science.gov (United States)

    Gong, Jin-Song; Li, Wei; Zhang, Dan-Dan; Xie, Min-Feng; Yang, Biao; Zhang, Rong-Xian; Li, Heng; Lu, Zhen-Ming; Xu, Zheng-Hong; Shi, Jin-Song

    2015-12-17

    In the present study, we isolated a trypsin-producing strain DMN6 from the leather waste and identified it as Bacillus licheniformis through a two-step screening strategy. The trypsin activity was increased up to 140 from 20 U/mL through culture optimization. The enzyme was purified to electrophoretic homogeneity with a molecular mass of 44 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and the specific activity of purified enzyme is 350 U/mg with Nα-Benzoyl-L-arginine ethylester as the substrate. The optimum temperature and pH for the trypsin are 65 °C and pH 9.0, respectively. Also, the enzyme can be significantly activated by Ba(2+). This enzyme is relatively stable in alkaline environment and displays excellent activity at low temperatures. It could retain over 95% of enzyme activity after 180 min of incubation at 45 °C. The distinguished activity under low temperature and prominent stability enhance its catalytic potential. In the current work, the open reading frame was obtained with a length of 1371 nucleotides that encoded a protein of 456 amino acids. These data would warrant the B. licheniformis trypsin as a promising candidate for catalytic application in collagen preparation and leather bating through further protein engineering.

  20. Biochemical Characterization of An Arginine-Specific Alkaline Trypsin from Bacillus licheniformis

    Directory of Open Access Journals (Sweden)

    Jin-Song Gong

    2015-12-01

    Full Text Available In the present study, we isolated a trypsin-producing strain DMN6 from the leather waste and identified it as Bacillus licheniformis through a two-step screening strategy. The trypsin activity was increased up to 140 from 20 U/mL through culture optimization. The enzyme was purified to electrophoretic homogeneity with a molecular mass of 44 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and the specific activity of purified enzyme is 350 U/mg with Nα-Benzoyl-l-arginine ethylester as the substrate. The optimum temperature and pH for the trypsin are 65 °C and pH 9.0, respectively. Also, the enzyme can be significantly activated by Ba2+. This enzyme is relatively stable in alkaline environment and displays excellent activity at low temperatures. It could retain over 95% of enzyme activity after 180 min of incubation at 45 °C. The distinguished activity under low temperature and prominent stability enhance its catalytic potential. In the current work, the open reading frame was obtained with a length of 1371 nucleotides that encoded a protein of 456 amino acids. These data would warrant the B. licheniformis trypsin as a promising candidate for catalytic application in collagen preparation and leather bating through further protein engineering.

  1. 21 CFR 161.170 - Canned Pacific salmon.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned Pacific salmon. 161.170 Section 161.170... § 161.170 Canned Pacific salmon. (a) Identity. (1) Canned Pacific salmon is the food prepared from one... forms of canned Pacific salmon are processed from fish prepared by removing the head, gills, and tail...

  2. High-gradient magnetic affinity separation of trypsin from porcine pancreatin

    DEFF Research Database (Denmark)

    Hubbuch, Jürgen; Thomas, Owen R. T.

    2002-01-01

    We introduce a robust and scale-flexible approach to macromolecule purification employing tailor-made magnetic adsorbents and high-gradient magnetic separation technology adapted from the mineral processing industries. Detailed procedures for the synthesis of large quantities of low-cost defined......-scale studies approximate to95% of the endogenous trypsin present in a crude porcine pancreatin feedstock was recovered with a purification factor of approximate to4.1 at the expense of only a 4% loss in a-amylase activity. Efficient recovery of trypsin from the same feedstock was demonstrated at a vastly...

  3. Label-Free Fluorescent Detection of Trypsin Activity Based on DNA-Stabilized Silver Nanocluster-Peptide Conjugates

    Directory of Open Access Journals (Sweden)

    Cai-Xia Zhuo

    2016-11-01

    Full Text Available Trypsin is important during the regulation of pancreatic exocrine function. The detection of trypsin activity is currently limited because of the need for the substrate to be labeled with a fluorescent tag. A label-free fluorescent method has been developed to monitor trypsin activity. The designed peptide probe consists of six arginine molecules and a cysteine terminus and can be conjugated to DNA-stabilized silver nanoclusters (DNA-AgNCs by Ag-S bonding to enhance fluorescence. The peptide probe can also be adsorbed to the surface of graphene oxide (GO, thus resulting in the fluorescence quenching of DNA-AgNCs-peptide conjugate because of Förster resonance energy transfer. Once trypsin had degraded the peptide probe into amino acid residues, the DNA-AgNCs were released from the surface of GO, and the enhanced fluorescence of DNA-AgNCs was restored. Trypsin can be determined with a linear range of 0.0–50.0 ng/mL with a concentration as low as 1 ng/mL. This label-free method is simple and sensitive and has been successfully used for the determination of trypsin in serum. The method can also be modified to detect other proteases.

  4. Physical-chemical characterization and stability study of alpha-trypsin at ph 3.0 by differential scanning calorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Santos, A.M.C.; Santana, M.A.; Gomide, F.T.F.; Oliveira, J.S.; Vilas Boas, F.A.S.; Santoro, M.M.; Teixera, K.N. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Inst. de Ciencias Biologicas (ICB). Dept. de Bioquimica e Imunologia; Miranda, A.A.C.; Biondi, I. [Universidade Estadual de Feira de Santana (UEFS), BA (Brazil). Dept. de Ciencias Biologicas; Vasconcelos, A.B.; Bemquerer, M.P. [EMBRAPA Recursos Geneticos e Biotecnologia, Brasilia, DF (Brazil). Parque Estacao Biologica (PqEB)

    2008-07-01

    Full text: {alpha}-Trypsin is a serine-protease with a polypeptide chain of 223 amino acid residues and six disulfide bridges. It is a globular protein with predominance of antiparallel {beta}-sheet secondary structure and it has two domains with similar structures. In the present work, a stability study of {alpha}-trypsin in the acid pH range was performed and physical-chemical denaturation parameters were measured by using differential scanning calorimetry (DSC). The {alpha}-trypsin has a shelf-life (t{sub 95%}) of about ten months at pH 3.0 and 4 deg C and its hydrolysis into the {psi}-trypsin isoform is negligible during six months as monitored by mass spectrometry (Micromass Q-ToF). The observed {delta}H{sub cal}/{delta}H{sub vH} ratio is close to unity for {alpha}-trypsin denaturation, which suggests the occurrence of a two-state transition, devoid of molten-globule intermediates. At pH 3.0, {alpha}-trypsin unfolded with T{sub m} 325.9 K and {delta}H= 99.10 kcal mol{sup -1}, and the change in heat capacity between the native and unfolded forms of the protein was estimated to be 1.96 {+-} 0.18 kcal mol{sup -1} K{sup -1}. The stability of {alpha}-trypsin calculated at 298 K and at pH 3.0 was {delta}G{sub U} = 6.10 kcal mol{sup -1}. These values are in the range expected for a small globular protein. These results show that the thermodynamic parameters for unfolding of {beta}-trypsin do not change substantially after its conversion to {alpha}-trypsin.

  5. Ectoparasite Caligus rogercresseyi modifies the lactate response in Atlantic salmon (Salmo salar) and Coho salmon (Oncorhynchus kisutch).

    Science.gov (United States)

    Vargas-Chacoff, L; Muñoz, J L P; Hawes, C; Oyarzún, R; Pontigo, J P; Saravia, J; González, M P; Mardones, O; Labbé, B S; Morera, F J; Bertrán, C; Pino, J; Wadsworth, S; Yáñez, A

    2017-08-30

    Although Caligus rogercresseyi negatively impacts Chilean salmon farming, the metabolic effects of infection by this sea louse have never been completely characterized. Therefore, this study analyzed lactate responses in the plasma, as well as the liver/muscle lactate dehydrogenase (LDH) activity and gene expression, in Salmo salar and Oncorhynchus kisutch infested by C. rogercresseyi. The lactate responses of Atlantic and Coho salmon were modified by the ectoparasite. Both salmon species showed increasing in plasma levels, whereas enzymatic activity increased in the muscle but decreased in the liver. Gene expression was overexpressed in both Coho salmon tissues but only in the liver for Atlantic salmon. These results suggest that salmonids need more energy to adapt to infection, resulting in increased gene expression, plasma levels, and enzyme activity in the muscles. The responses differed between both salmon species and over the course of infection, suggesting potential species-specific responses to sea-lice infection. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Lessons from sea louse and salmon epidemiology.

    Science.gov (United States)

    Groner, Maya L; Rogers, Luke A; Bateman, Andrew W; Connors, Brendan M; Frazer, L Neil; Godwin, Sean C; Krkošek, Martin; Lewis, Mark A; Peacock, Stephanie J; Rees, Erin E; Revie, Crawford W; Schlägel, Ulrike E

    2016-03-05

    Effective disease management can benefit from mathematical models that identify drivers of epidemiological change and guide decision-making. This is well illustrated in the host-parasite system of sea lice and salmon, which has been modelled extensively due to the economic costs associated with sea louse infections on salmon farms and the conservation concerns associated with sea louse infections on wild salmon. Consequently, a rich modelling literature devoted to sea louse and salmon epidemiology has been developed. We provide a synthesis of the mathematical and statistical models that have been used to study the epidemiology of sea lice and salmon. These studies span both conceptual and tactical models to quantify the effects of infections on host populations and communities, describe and predict patterns of transmission and dispersal, and guide evidence-based management of wild and farmed salmon. As aquaculture production continues to increase, advances made in modelling sea louse and salmon epidemiology should inform the sustainable management of marine resources. © 2016 The Author(s).

  7. Pacific Coastal Salmon Recovery Fund

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Congress established the Pacific Coastal Salmon Recovery Fund (PCSRF) to monitor the restoration and conservation of Pacific salmon and steelhead populations and...

  8. Juvenile salmon usage of the Skeena River estuary.

    Science.gov (United States)

    Carr-Harris, Charmaine; Gottesfeld, Allen S; Moore, Jonathan W

    2015-01-01

    Migratory salmon transit estuary habitats on their way out to the ocean but this phase of their life cycle is more poorly understood than other phases. The estuaries of large river systems in particular may support many populations and several species of salmon that originate from throughout the upstream river. The Skeena River of British Columbia, Canada, is a large river system with high salmon population- and species-level diversity. The estuary of the Skeena River is under pressure from industrial development, with two gas liquefaction terminals and a potash loading facility in various stages of environmental review processes, providing motivation for understanding the usage of the estuary by juvenile salmon. We conducted a juvenile salmonid sampling program throughout the Skeena River estuary in 2007 and 2013 to investigate the spatial and temporal distribution of different species and populations of salmon. We captured six species of juvenile anadromous salmonids throughout the estuary in both years, and found that areas proposed for development support some of the highest abundances of some species of salmon. Specifically, the highest abundances of sockeye (both years), Chinook in 2007, and coho salmon in 2013 were captured in areas proposed for development. For example, juvenile sockeye salmon were 2-8 times more abundant in the proposed development areas. Genetic stock assignment demonstrated that the Chinook salmon and most of the sockeye salmon that were captured originated from throughout the Skeena watershed, while some sockeye salmon came from the Nass, Stikine, Southeast Alaska, and coastal systems on the northern and central coasts of British Columbia. These fish support extensive commercial, recreational, and First Nations fisheries throughout the Skeena River and beyond. Our results demonstrate that estuary habitats integrate species and population diversity of salmon, and that if proposed development negatively affects the salmon populations that

  9. Collaborative Approaches to Flow Restoration in Intermittent Salmon-Bearing Streams: Salmon Creek, CA, USA

    Directory of Open Access Journals (Sweden)

    Cleo Woelfle-Erskine

    2017-03-01

    Full Text Available In Mediterranean-climate regions of California and southern Oregon, juvenile salmon depend on groundwater aquifers to sustain their tributary habitats through the dry summers. Along California’s North Coast streams, private property regimes on land have created commons tragedies in groundwater and salmon fisheries, both classic examples of commons that are often governed collectively and sustainably by their users. Understanding the linkages between salmon and groundwater is one major focus of salmon recovery and climate change adaptation planning in central California and increasingly throughout the Pacific Northwest. In this paper, I use extended field interviews and participant-observation in field ecology campaigns and regulatory forums to explore how, in one water-scarce, salmon-bearing watershed on California’s central coast, collaborators are synthesizing agency and landowner data on groundwater and salmon management. I focus on three projects undertaken by citizen scientists in collaboration with me and Gold Ridge Resource Conservation District staff: salmonid censuses, mapping of wet and dry stream reaches and well monitoring. I find that collaborative research initiated by local residents and agency personnel has, in some cases, created a new sense of ecological possibility in the region. I also consider some limitations of this collaborations, namely the lack of engagement with indigenous Pomo and Miwok tribal members, with the Confederated Tribes of Graton Rancheria and with farmworkers and other marginalized residents, and suggest strategies for deepening environmental justice commitments in future collaborative work.

  10. Radio-immuno-assay for trypsin in newborn-screening for cystic fibrosis

    International Nuclear Information System (INIS)

    Sander, J.; Niehaus, C.

    1982-01-01

    In 4,956 infants the concentration of immunoreactive trypsin was measured in dried blood on filter paper using a double antibody radioimmuno assay. About 90% of all results were below 40 ng/ml. In 13 infants the concentration of immunoreactive trypsin exceeded 80 ng/ml. These infants were examined clinically, including sweationtophoresis. We found three children suffering from cystic fibrosis. One further child showing an elevated concentration of chloride in the sweat (60 mval/ml) could not be reexamined. The concentration of immunoreactive trypsin in the cystic fibrosis children was 230, 297, and in one case 108 ng/ml at the 76th day of life, whereas the values for the 9 other children were between 80 and 154 ng/ml. We believe these results justify to use this test for a much higher number of infants, especially because it is inexpensive and can easily be added to existing newborn screening programs for inborn errors of metabolism. (orig.) [de

  11. Genotype-temperature interaction in the regulation of development, growth, and morphometrics in wild-type, and growth-hormone transgenic coho salmon.

    Directory of Open Access Journals (Sweden)

    Mare Lõhmus

    2010-04-01

    Full Text Available The neuroendocrine system is an important modulator of phenotype, directing cellular genetic responses to external cues such as temperature. Behavioural and physiological processes in poikilothermic organisms (e.g. most fishes, are particularly influenced by surrounding temperatures.By comparing the development and growth of two genotypes of coho salmon (wild-type and transgenic with greatly enhanced growth hormone production at six different temperatures, ranging between 8 degrees and 18 degrees C, we observed a genotype-temperature interaction and possible trend in directed neuroendocrine selection. Differences in growth patterns of the two genotypes were compared by using mathematical models, and morphometric analyses of juvenile salmon were performed to detect differences in body shape. The maximum hatching and alevin survival rates of both genotypes occurred at 12 degrees C. At lower temperatures, eggs containing embryos with enhanced GH production hatched after a shorter incubation period than wild-type eggs, but this difference was not apparent at and above 16 degrees C. GH transgenesis led to lower body weights at the time when the yolk sack was completely absorbed compared to the wild genotype. The growth of juvenile GH-enhanced salmon was to a greater extent stimulated by higher temperatures than the growth of the wild-type. Increased GH production significantly influenced the shape of the salmon growth curves.Growth hormone overexpression by transgenesis is able to stimulate the growth of coho salmon over a wide range of temperatures. Temperature was found to affect growth rate, survival, and body morphology between GH transgenic and wild genotype coho salmon, and differential responses to temperature observed between the genotypes suggests they would experience different selective forces should they ever enter natural ecosystems. Thus, GH transgenic fish would be expected to differentially respond and adapt to shifts in environmental

  12. 77 FR 75101 - Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 17 to the Salmon Fishery...

    Science.gov (United States)

    2012-12-19

    .... 120813333-2647-01] RIN 0648-BC28 Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 17 to the Salmon Fishery Management Plan AGENCY: National Marine Fisheries Service (NMFS), National.... SUMMARY: NMFS proposes regulations to implement Amendment 17 to the Pacific Coast Salmon Fishery...

  13. Mechanisms involved in the chemical inhibition of the Eosin-sensitized photooxidation of trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Rizzuto, F.; Spikes, J.D.

    1975-01-01

    A large series of compounds was screened for ability to protect trypsin from eosin-sensitized photodynamic inactivation. Eosin-sensitized photooxidation reactions of this type typically proceed via the triplet state of the dye and often involve singlet state oxygen as the oxidizing entity. In order to determine the mechanisms by which trypsin is protected from photoinactivation, a number of good protective agents (inhibitors) and some non-protective agents were selected for more detailed flash photolysis studies. Good inhibitors such as p-phenylenediamine, n-propyl gallate, serotonin creatinine sulfate and p-toluenediamine competed efficiently with oxygen and with trypsin for reaction with the triplet state of eosin. The inhibitors were shown to quench triplet eosin to the ground state and/or reduce triplet eosin to form the semireduced eosin radical and an oxidized form of the inhibitor. In the latter case, oxidized inhibitor could react by a reverse electron transfer reaction with the semireduced eosin radical to regenerate ground state eosin and the inhibitor. The good inhibitors also competed effectively with trypsin for oxidation by semioxidized eosin, thus giving another possible protective mechanism. Non-inhibitors such as halogen ions and the paramagnetic ions Co/sup + +/, Cu/sup + +/ and Mn/sup + +/ reacted only slowly with triplet and with semioxidized eosin. The primary pathway for the eosin-sensitized photooxidation of trypsin at pH 8.0 involved singlet oxygen, although semioxidized eosin may also participate.

  14. 76 FR 81851 - Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 16 to the Salmon Fishery...

    Science.gov (United States)

    2011-12-29

    .... 101206604-1758-02] RIN 0648-BA55 Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 16 to the Salmon Fishery Management Plan AGENCY: National Marine Fisheries Service (NMFS), National...) to implement Amendment 16 to the Pacific Coast Salmon Fishery Management Plan for Commercial and...

  15. 76 FR 65673 - Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 16 to the Salmon Fishery...

    Science.gov (United States)

    2011-10-24

    .... 101206604-1620-01] RIN 0648-BA55 Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 16 to the Salmon Fishery Management Plan AGENCY: National Marine Fisheries Service (NMFS), National... implement Amendment 16 to the Pacific Coast Salmon Fishery Management Plan for Commercial and Recreational...

  16. 78 FR 10557 - Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 17 to the Salmon Fishery...

    Science.gov (United States)

    2013-02-14

    .... 120813333-3107-02] RIN 0648-BC28 Fisheries Off West Coast States; West Coast Salmon Fisheries; Amendment 17 to the Salmon Fishery Management Plan AGENCY: National Marine Fisheries Service (NMFS), National... implement Amendment 17 to the Pacific Coast Salmon Fishery Management Plan for Commercial and Recreational...

  17. Overlapping binding sites for trypsin and papain on a Kunitz-type proteinase inhibitor from Prosopis juliflora.

    Science.gov (United States)

    Franco, Octávio L; Grossi de Sá, Maria F; Sales, Maurício P; Mello, Luciane V; Oliveira, Adeliana S; Rigden, Daniel J

    2002-11-15

    Proteinase inhibitors are among the most promising candidates for expression by transgenic plants and consequent protection against insect predation. However, some insects can respond to the threat of the proteinase inhibitor by the production of enzymes insensitive to inhibition. Inhibitors combining more than one favorable activity are therefore strongly favored. Recently, a known small Kunitz trypsin inhibitor from Prosopis juliflora (PTPKI) has been shown to possess unexpected potent cysteine proteinase inhibitory activity. Here we show, by enzyme assay and gel filtration, that, unlike other Kunitz inhibitors with dual activities, this inhibitor is incapable of simultaneous inhibition of trypsin and papain. These data are most readily interpreted by proposing overlapping binding sites for the two enzymes. Molecular modeling and docking experiments favor an interaction mode in which the same inhibitor loop that interacts in a canonical fashion with trypsin can also bind into the papain catalytic site cleft. Unusual residue substitutions at the proposed interface can explain the relative rarity of twin trypsin/papain inhibition. Other changes seem responsible for the relative low affinity of PTPKI for trypsin. The predicted coincidence of trypsin and papain binding sites, once confirmed, would facilitate the search, by phage display for example, for mutants highly active against both proteinases. Copyright 2002 Wiley-Liss, Inc.

  18. Nutrient additions to mitigate for loss of Pacific salmon: consequences for stream biofilm and nutrient dynamics

    Science.gov (United States)

    Marcarelli, Amy M.; Baxter, Colden V.; Wipfli, Mark S.

    2014-01-01

    Mitigation activities designed to supplement nutrient and organic matter inputs to streams experiencing decline or loss of Pacific salmon typically presuppose that an important pathway by which salmon nutrients are moved to fish (anadromous and/or resident) is via nutrient incorporation by biofilms and subsequent bottom-up stimulation of biofilm production, which is nutrient-limited in many ecosystems where salmon returns have declined. Our objective was to quantify the magnitude of nutrient incorporation and biofilm dynamics that underpin this indirect pathway in response to experimental additions of salmon carcasses and pelletized fish meal (a.k.a., salmon carcass analogs) to 500-m reaches of central Idaho streams over three years. Biofilm standing crops increased 2–8-fold and incorporated marine-derived nutrients (measured using 15N and 13C) in the month following treatment, but these responses did not persist year-to-year. Biofilms were nitrogen (N) limited before treatments, and remained N limited in analog, but not carcass-treated reaches. Despite these biofilm responses, in the month following treatment total N load was equal to 33–47% of the N added to the treated reaches, and N spiraling measurements suggested that as much as 20%, but more likely 2–3% of added N was taken up by microbes. Design of biologically and cost-effective strategies for nutrient addition will require understanding the rates at which stream microbes take up nutrients and the downstream distance traveled by exported nutrients.

  19. A novel poly(deep eutectic solvent)-based magnetic silica composite for solid-phase extraction of trypsin

    International Nuclear Information System (INIS)

    Xu, Kaijia; Wang, Yuzhi; Li, Yixue; Lin, Yunxuan; Zhang, Haibao; Zhou, Yigang

    2016-01-01

    Novel poly(deep eutectic solvent) grafted silica-coated magnetic microspheres (Fe 3 O 4 @SiO 2 -MPS@PDES) were prepared by polymerization of choline chloride-itaconic acid (ChCl-IA) and γ-MPS-modified magnetic silica composites, and were characterized by vibrating sample magnetometer (VSM), Fourier transform infrared spectrometry (FT-IR), X-ray photoelectron spectra (XPS), thermal gravimetric analysis (TGA) and transmission electron microscope (TEM). Then the synthetic Fe 3 O 4 @SiO 2 -MPS@PDES microspheres were applied for the magnetic solid-phase extraction (MSPE) of trypsin for the first time. After extraction, the concentration of trypsin in the supernatant was determined by a UV–vis spectrophotometer. Single factor experiments were carried out to investigate the effects of the extraction process, including the concentration of trypsin, the ionic strength, the pH value, the extraction time and the temperature. Experimental results showed the extraction capacity could reach up to 287.5 mg/g under optimized conditions. In comparison with Fe 3 O 4 @SiO 2 -MPS, Fe 3 O 4 @SiO 2 -MPS@PDES displayed higher extraction capacity and selectivity for trypsin. According to the regeneration studies, Fe 3 O 4 @SiO 2 -MPS@PDES microspheres can be recycled six times without significant loss of its extraction capacity, and retained a high extraction capacity of 233 mg/g after eight cycles. Besides, the activity studies also demonstrated that the activity of the extracted trypsin was well retained. Furthermore, the analysis of real sample revealed that the prepared magnetic microspheres can be used to purify trypsin in crude bovine pancreas extract. These results highlight the potential of the proposed Fe 3 O 4 @SiO 2 -MPS@PDES-MSPE method in separation of biomolecules. - Highlights: • A strategy for solid-phase extraction of trypsin based on poly(deep eutectic solvent) modified magnetic silica microspheres. • Fe 3 O 4 @SiO 2 -MPS@PDES showed higher extraction capacity

  20. Mast cell tryptase stimulates myoblast proliferation; a mechanism relying on protease-activated receptor-2 and cyclooxygenase-2

    Directory of Open Access Journals (Sweden)

    Côté Claude H

    2011-10-01

    Full Text Available Abstract Background Mast cells contribute to tissue repair in fibrous tissues by stimulating proliferation of fibroblasts through the release of tryptase which activates protease-activated receptor-2 (PAR-2. The possibility that a tryptase/PAR-2 signaling pathway exists in skeletal muscle cell has never been investigated. The aim of this study was to evaluate whether tryptase can stimulate myoblast proliferation and determine the downstream cascade. Methods Proliferation of L6 rat skeletal myoblasts stimulated with PAR-2 agonists (tryptase, trypsin and SLIGKV was assessed. The specificity of the tryptase effect was evaluated with a specific inhibitor, APC-366. Western blot analyses were used to evaluate the expression and functionality of PAR-2 receptor and to assess the expression of COX-2. COX-2 activity was evaluated with a commercial activity assay kit and by measurement of PGF2α production. Proliferation assays were also performed in presence of different prostaglandins (PGs. Results Tryptase increased L6 myoblast proliferation by 35% above control group and this effect was completely inhibited by APC-366. We confirmed the expression of PAR-2 receptor in vivo in skeletal muscle cells and in satellite cells and in vitro in L6 cells, where PAR-2 was found to be functional. Trypsin and SLIGKV increased L6 cells proliferation by 76% and 26% above control, respectively. COX-2 activity was increased following stimulation with PAR-2 agonist but its expression remained unchanged. Inhibition of COX-2 activity by NS-398 abolished the stimulation of cell proliferation induced by tryptase and trypsin. Finally, 15-deoxy-Δ-12,14-prostaglandin J2 (15Δ-PGJ2, a product of COX-2-derived prostaglandin D2, stimulated myoblast proliferation, but not PGE2 and PGF2α. Conclusions Taken together, our data show that tryptase can stimulate myoblast proliferation and this effect is part of a signaling cascade dependent on PAR-2 activation and on the downstream

  1. Salmon on the Edge: Growth and Condition of Juvenile Chum and Pink Salmon in the Northeastern Bering Sea

    Science.gov (United States)

    McPhee, M. V.

    2016-02-01

    As the Arctic and Subarctic regions warm, Pacific salmon (Oncorhynchus spp.) are expected to expand their range northward during ice-free periods in the Bering and Chukchi seas. The oscillating control hypothesis, which describes energetic differences of primary consumers between ice-associated and pelagic production phases, provides a framework for understanding how juvenile salmon might respond to changing conditions at the northern edge of their marine range. Additionally, relationships between growth/condition and temperature, salinity and bottom depth will help identify marine habitats supporting growth at the Arctic-Subarctic interface. In this study, we used survey data from NOAA and Arctic Ecosystem Integrated Survey project to 1) compare growth and condition of juvenile pink (O. gorbuscha) and chum (O. keta) salmon in the NE Bering Sea between warm and cool spring phases, and 2) describe relationships between summer environmental conditions and juvenile salmon growth and condition from 2006 - 2010. Chum and pink salmon were shorter, and chum salmon exhibited greater energy density, in years with cool springs; however, no other aspects of size and condition differed significantly between phases. Over all years, longer and more energy dense individuals of both species were caught at stations with greater bottom depths and in cooler sea-surface temperatures. We found little evidence that chlorophyll-a explained much of the variation in size or condition. We used insulin-like growth factor-1 (IGF-1) concentration as an indicator of relative growth rate for fishes sampled in 2009-2012 and that found juvenile salmon exhibited higher IGF-1 concentrations in 2010-2012 than in 2009. IGF-1 concentrations tended to increase with SST in chum salmon and with bottom depth (a proxy for distance from shore) in pink salmon, but more years of data are needed to adequately describe the relationship of IGF with environmental conditions. This study, although descriptive in

  2. Identification and characterisation of TLR18-21 genes in Atlantic salmon (Salmo salar).

    Science.gov (United States)

    Lee, P T; Zou, J; Holland, J W; Martin, S A M; Collet, B; Kanellos, T; Secombes, C J

    2014-12-01

    Teleost fish possess many types of toll-like receptor (TLR) some of which exist in other vertebrate groups and some that do not (ie so-called "fish-specific" TLRs). In this study, we identified in Atlantic salmon (Salmo salar) whole-genome shotgun (WGS) contigs seven TLRs that are not found in mammals, including six types of fish-specific TLRs (one TLR18, one TLR19, and four TLR20 members (two of which are putative soluble forms (s)) and one TLR21. Phylogenetic analysis revealed that teleost TLR19-21 are closely related with murine TLR11-TLR13, whilst teleost TLR18 groups with mammalian TLR1, 2, 6 and 10. A typical TLR protein domain structure was found in all these TLRs with the exception of TLR20b(s) and TLR20c(s). TLR-GFP expression plasmids transfected into SHK-1 cells showed that salmon TLR19, TLR20a and TLR20d were preferentially localised to the intracellular compartment. Real time PCR analysis suggested that salmon TLR19-TLR21 are mainly expressed in immune related organs, such as spleen, head kidney and gills, while TLR18 transcripts are more abundant in muscle. In vitro stimulation of primary head kidney cells with type I IFN, IFNγ and IL-1β had no impact on TLR expression. Infectious salmon anaemia virus (ISAV) infection, in vivo, down-regulated TLR20a, TLR20b(s), TLR20d and TLR21 in infected salmon kidney tissue. In contrast, up-regulation of TLR19 and TLR20a expression was found in posterior kidney in rainbow trout with clinical proliferative kidney disease (PKD). Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Improved purification process of β- and α-trypsin isoforms by ion-exchange chromatography

    Directory of Open Access Journals (Sweden)

    Alexandre Martins Costa Santos

    2008-08-01

    Full Text Available The purpose of this work was to improve the separation and yield of pure β- and α-trypsin isoforms by ion-exchange chromatography and to characterize some physical-chemical properties of these isoforms. Purification of trypsin isoforms was performed by ion-exchange chromatography in 0.1 mol/L tris-HC buffer, pH 7.10 at 4ºC. The sample loading, salt concentration, flow rate and pH of mobile phase were varied to determine their effects on the resolution of the separation. The resolution was optimized mainly between β- and α-trypsin. Pure isoforms were obtained by chromatographying 100 mg of commercial trypsin during seven days, yielding 51 mg of high purity β-trypsin and 13 mg of α-trypsin partially pure, with small amounts of contaminating of ψ-trypsin. Thus, time and resolution of purification were optimized yielding large amounts of pure active enzymes that are useful for several research areas and biotechnology.O propósito deste trabalho foi melhorar a separação e o rendimento das isoformas puras β- e α-tripsina por meio de cromatografia de troca iônica e caracterizar algumas propriedades físico-químicas dessas isoformas. A purificação de isoformas de tripsina foi realizada em SE Sephadex, com tampão tris-HCl, pH 7,10 a 4ºC. A quantidade de amostra, a concentração salina, o fluxo e o pH da fase móvel foram variados para determinar o efeito sobre a resolução da separação. A resolução foi otimizada principalmente entre β- e α-tripsina, utilizando o pH 7,10 a 4ºC. Isoformas puras foram obtidas a partir de 100 mg de tripsina comercial bovina depois de sete dias de cromatografia, fornecendo 51,0 mg de β-tripsina totalmente pura e 13,0 mg de α-tripsina parcialmente pura, com quantidades pequenas de contaminação por ψ-Tripsina. Assim, tempo e resolução da purificação foram otimizados redendo grandes quantidades de enzimas puras e ativas que são úteis em várias áreas de pesquisa e ciências biotecnológicas.

  4. Cessation of a salmon decline with control of parasites

    KAUST Repository

    Peacock, Stephanie J.

    2013-04-01

    The resilience of coastal social-ecological systems may depend on adaptive responses to aquaculture disease outbreaks that can threaten wild and farm fish. A nine-year study of parasitic sea lice (Lepeophtheirus salmonis) and pink salmon (Oncorhynchus gorbuscha) from Pacific Canada indicates that adaptive changes in parasite management on salmon farms have yielded positive conservation outcomes. After four years of sea lice epizootics and wild salmon population decline, parasiticide application on salmon farms was adapted to the timing of wild salmon migrations. Winter treatment of farm fish with parasiticides, prior to the out-migration of wild juvenile salmon, has reduced epizootics of wild salmon without significantly increasing the annual number of treatments. Levels of parasites on wild juvenile salmon significantly influence the growth rate of affected salmon populations, suggesting that these changes in management have had positive outcomes for wild salmon populations. These adaptive changes have not occurred through formal adaptive management, but rather, through multi-stakeholder processes arising from a contentious scientific and public debate. Despite the apparent success of parasite control on salmon farms in the study region, there remain concerns about the long-term sustainability of this approach because of the unknown ecological effects of parasticides and the potential for parasite resistance to chemical treatments. © 2013 by the Ecological Society of America.

  5. Future of Pacific salmon in the face of environmental change: Lessons from one of the world's remaining productive salmon regions

    Science.gov (United States)

    Schoen, Erik R.; Wipfli, Mark S.; Trammell, Jamie; Rinella, Daniel J.; Floyd, Angelica L.; Grunblatt, Jess; McCarthy, Molly D.; Meyer, Benjamin E.; Morton, John M.; Powell, James E.; Prakash, Anupma; Reimer, Matthew N.; Stuefer, Svetlana L.; Toniolo, Horacio; Wells, Brett M.; Witmer, Frank D. W.

    2017-01-01

    Pacific salmon Oncorhynchus spp. face serious challenges from climate and landscape change, particularly in the southern portion of their native range. Conversely, climate warming appears to be allowing salmon to expand northwards into the Arctic. Between these geographic extremes, in the Gulf of Alaska region, salmon are at historically high abundances but face an uncertain future due to rapid environmental change. We examined changes in climate, hydrology, land cover, salmon populations, and fisheries over the past 30–70 years in this region. We focused on the Kenai River, which supports world-famous fisheries but where Chinook Salmon O. tshawytscha populations have declined, raising concerns about their future resilience. The region is warming and experiencing drier summers and wetter autumns. The landscape is also changing, with melting glaciers, wetland loss, wildfires, and human development. This environmental transformation will likely harm some salmon populations while benefiting others. Lowland salmon streams are especially vulnerable, but retreating glaciers may allow production gains in other streams. Some fishing communities harvest a diverse portfolio of fluctuating resources, whereas others have specialized over time, potentially limiting their resilience. Maintaining diverse habitats and salmon runs may allow ecosystems and fisheries to continue to thrive amidst these changes.

  6. Cloning and chromosomal assignment of a human cDNA encoding a T cell- and natural killer cell-specific trypsin-like serine protease

    International Nuclear Information System (INIS)

    Gershenfeld, H.K.; Hershberger, R.J.; Shows, T.B.; Weissman, I.L.

    1988-01-01

    A cDNA clone encoding a human T cell- and natural killer cell-specific serine protease was obtained by screening a phage λgt10 cDNA library from phytohemagglutinin-stimulated human peripheral blood lymphocytes with the mouse Hanukah factor cDNA clone. In an RNA blot-hybridization analysis, this human Hanukah factor cDNA hybridized with a 1.3-kilobase band in allogeneic-stimulated cytotoxic T cells and the Jurkat cell line, but this transcript was not detectable in normal muscle, liver, tonsil, or thymus. By dot-blot hybridization, this cDNA hybridized with RNA from three cytolytic T-cell clones and three noncytolytic T-cell clones grown in vitro as well as with purified CD16 + natural killer cells and CD3 + , CD16 - T-cell large granular lymphocytes from peripheral blood lymphocytes (CD = cluster designation). The nucleotide sequence of this cDNA clone encodes a predicted serine protease of 262 amino acids. The active enzyme is 71% and 77% similar to the mouse sequence at the amino acid and DNA level, respectively. The human and mouse sequences conserve the active site residues of serine proteases--the trypsin-specific Asp-189 and all 10 cysteine residues. The gene for the human Hanukah factor serine protease is located on human chromosome 5. The authors propose that this trypsin-like serine protease may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells

  7. Consumption choice by bears feeding on salmon.

    Science.gov (United States)

    Gende, S M; Quinn, T P; Willson, M F

    2001-05-01

    Consumption choice by brown (Ursus arctos) and black bears (U. americanus) feeding on salmon was recorded for over 20,000 bear-killed fish from 1994 to 1999 in Bristol Bay (sockeye salmon, Oncorhynchus nerka) and southeastern Alaska (pink, O. gorbuscha and chum salmon O. keta). These data revealed striking patterns of partial and selective consumption that varied with relative availability and attributes of the fish. As the availability of salmon decreased, bears consumed a larger proportion of each fish among both years and habitats. When availability was high (absolute number and density of salmon), bears consumed less biomass per captured fish, targeting energy-rich fish (those that had not spawned) or energy-rich body parts (eggs in females; brain in males). In contrast, individual fish were consumed to a much greater extent, regardless of sex or spawning status, in habitats or years of low salmon availability. The proportion of biomass consumed per fish was similar for males and females, when spawning status was statistically controlled, but bears targeted different body parts: the body flesh, brain and dorsal hump in males and the roe in females. Bears thus appeared to maximize energy intake by modifying the amount and body parts consumed, based on availability and attributes of spawning salmon.

  8. Pacific salmon (Oncorhynchus spp.) runs and consumer fitness: growth and energy storage in stream-dwelling salmonids increase with salmon spawner density

    Science.gov (United States)

    Rinella, Daniel J.; Wipfli, Mark S.; Stricker, Craig A.; Heintz, Ron A.; Rinella, Matthew J.

    2012-01-01

    We examined how marine-derived nutrients (MDN), in the form of spawning Pacific salmon, influenced the nutritional status and δ15N of stream-dwelling fishes. We sampled juvenile coho salmon (Oncorhynchus kisutch) and Dolly Varden (Salvelinus malma) during spring and fall from 11 south-central Alaskan streams that ranged widely in spawning salmon biomass (0.1–4.7 kg·m–2). Growth rate (as indexed by RNA–DNA ratios), energy density, and δ15N enrichment in spring-sampled fishes increased with spawner biomass, indicating the persistence of spawner effects more than 6 months after salmon spawning. Point estimates suggest that spawner effects on nutrition were substantially greater for coho salmon than Dolly Varden (268% and 175% greater for growth and energy, respectively), indicating that both species benefitted physiologically, but that juvenile coho salmon accrued more benefits than Dolly Varden. Although the data were less conclusive for fall- than spring-sampled fish, they do suggest spawner effects were also generally positive during fall, soon after salmon spawned. In a follow-up analysis where growth rate and energy density were modeled as a function of δ15N enrichment, results suggested that both increased with MDN assimilation, especially in juvenile coho salmon. Our results support the importance of salmon runs to the nutritional ecology of stream-dwelling fishes.

  9. A new protein inhibitor of trypsin and activated Hageman factor from pumpkin (Cucurbita maxima) seeds.

    Science.gov (United States)

    Krishnamoorthi, R; Gong, Y X; Richardson, M

    1990-10-29

    A protein inhibitor (CMTI-V; Mr 7106) of trypsin and activated Hageman factor (Factor XIIa), a serine protease involved in blood coagulation, has been isolated for the first time from pumpkin (Cucurbita maxima) seeds by means of trypsin-affinity chromatography and reverse phase high performance liquid chromatography (HPLC). The dissociation constants of the inhibitor complexes with trypsin and Factor XIIa have been determined to be 1.6 x 10(-8) and 4.1 x 10(-8) M, respectively. The primary structure of CMTI-V is reported. The protein has 68 amino acid residues and one disulfide bridge and shows a high level of sequence homology to the Potato I inhibitor family. Furthermore, its amino terminus consists of an N-acetylates Ser. The reactive site has been established to be the peptide bond between Lys44-Asp45. The modified inhibitor which has the reactive site peptide bond hydrolyzed inhibits trypsin but not the Hageman factor.

  10. A novel poly(deep eutectic solvent)-based magnetic silica composite for solid-phase extraction of trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Kaijia [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha, 410082 (China); Wang, Yuzhi, E-mail: wyzss@hnu.edu.cn [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha, 410082 (China); Li, Yixue; Lin, Yunxuan; Zhang, Haibao [State Key Laboratory of Chemo/Biosensing and Chemometrics, College of Chemistry and Chemical Engineering, Hunan University, Changsha, 410082 (China); Zhou, Yigang [Department of Microbiology, College of Basic Medicine, Central South University, Changsha, 410083 (China)

    2016-11-23

    Novel poly(deep eutectic solvent) grafted silica-coated magnetic microspheres (Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS@PDES) were prepared by polymerization of choline chloride-itaconic acid (ChCl-IA) and γ-MPS-modified magnetic silica composites, and were characterized by vibrating sample magnetometer (VSM), Fourier transform infrared spectrometry (FT-IR), X-ray photoelectron spectra (XPS), thermal gravimetric analysis (TGA) and transmission electron microscope (TEM). Then the synthetic Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS@PDES microspheres were applied for the magnetic solid-phase extraction (MSPE) of trypsin for the first time. After extraction, the concentration of trypsin in the supernatant was determined by a UV–vis spectrophotometer. Single factor experiments were carried out to investigate the effects of the extraction process, including the concentration of trypsin, the ionic strength, the pH value, the extraction time and the temperature. Experimental results showed the extraction capacity could reach up to 287.5 mg/g under optimized conditions. In comparison with Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS, Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS@PDES displayed higher extraction capacity and selectivity for trypsin. According to the regeneration studies, Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS@PDES microspheres can be recycled six times without significant loss of its extraction capacity, and retained a high extraction capacity of 233 mg/g after eight cycles. Besides, the activity studies also demonstrated that the activity of the extracted trypsin was well retained. Furthermore, the analysis of real sample revealed that the prepared magnetic microspheres can be used to purify trypsin in crude bovine pancreas extract. These results highlight the potential of the proposed Fe{sub 3}O{sub 4}@SiO{sub 2}-MPS@PDES-MSPE method in separation of biomolecules. - Highlights: • A strategy for solid-phase extraction of trypsin based on poly(deep eutectic solvent) modified magnetic silica

  11. Robust Trypsin Coating on Electrospun Polymer Nanofibers in Rigorous Conditions and Its Uses for Protein Digestion

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Hye-Kyung; Kim, Byoung Chan; Jun, Seung-Hyun; Chang, Mun Seock; Lopez-Ferrer, Daniel; Smith, Richard D.; Gu, Man Bock; Lee, Sang-Won; Kim, Beom S.; Kim, Jungbae

    2010-12-15

    An efficient protein digestion in proteomic analysis requires the stabilization of proteases such as trypsin. In the present work, trypsin was stabilized in the form of enzyme coating on electrospun polymer nanofibers (EC-TR), which crosslinks additional trypsin molecules onto covalently-attached trypsin (CA-TR). EC-TR showed better stability than CA-TR in rigorous conditions, such as at high temperatures of 40 °C and 50 °C, in the presence of organic co-solvents, and at various pH's. For example, the half-lives of CA-TR and EC-TR were 0.24 and 163.20 hours at 40 ºC, respectively. The improved stability of EC-TR can be explained by covalent-linkages on the surface of trypsin molecules, which effectively inhibits the denaturation, autolysis, and leaching of trypsin. The protein digestion was performed at 40 °C by using both CA-TR and EC-TR in digesting a model protein, enolase. EC-TR showed better performance and stability than CA-TR by maintaining good performance of enolase digestion under recycled uses for a period of one week. In the same condition, CA-TR showed poor performance from the beginning, and could not be used for digestion at all after a few usages. The enzyme coating approach is anticipated to be successfully employed not only for protein digestion in proteomic analysis, but also for various other fields where the poor enzyme stability presently hampers the practical applications of enzymes.

  12. Juvenile Pacific Salmon in Puget Sound

    National Research Council Canada - National Science Library

    Fresh, Kurt L

    2006-01-01

    Puget sound salmon (genus Oncorhynchus) spawn in freshwater and feed, grow and mature in marine waters, During their transition from freshwater to saltwater, juvenile salmon occupy nearshore ecosystems in Puget Sound...

  13. Cytogenetic study of Ascaris trypsin inhibitor in cultured human ...

    Indian Academy of Sciences (India)

    2009-04-01

    Apr 1, 2009 ... Although the physical and chemical properties of Ascaris trypsin inhibitors ... male of Ascaris suum according to the method of Pudles and. Rola (1967). ..... inhibitor isolated from Ascaris resulted in the appearance of dominant ...

  14. Reconnecting Social and Ecological Resilience in Salmon Ecosystems

    Directory of Open Access Journals (Sweden)

    Daniel L. Bottom

    2009-06-01

    Full Text Available Fishery management programs designed to control Pacific salmon (Oncorhynchus spp. for optimum production have failed to prevent widespread fish population decline and have caused greater uncertainty for salmon, their ecosystems, and the people who depend upon them. In this special feature introduction, we explore several key attributes of ecosystem resilience that have been overlooked by traditional salmon management approaches. The dynamics of salmon ecosystems involve social-ecological interactions across multiple scales that create difficult mismatches with the many jurisdictions that manage fisheries and other natural resources. Of particular importance to ecosystem resilience are large-scale shifts in oceanic and climatic regimes or in global economic conditions that unpredictably alter social and ecological systems. Past management actions that did not account for such changes have undermined salmon population resilience and increased the risk of irreversible regime shifts in salmon ecosystems. Because salmon convey important provisioning, cultural, and supporting services to their local watersheds, widespread population decline has undermined both human well-being and ecosystem resilience. Strengthening resilience will require expanding habitat opportunities for salmon populations to express their maximum life-history variation. Such actions also may benefit the "response diversity" of local communities by expanding the opportunities for people to express diverse social and economic values. Reestablishing social-ecological connections in salmon ecosystems will provide important ecosystem services, including those that depend on clean water, ample stream flows, functional wetlands and floodplains, intact riparian systems, and abundant fish populations.

  15. Chronic consumption of farmed salmon containing persistent organic pollutants causes insulin resistance and obesity in mice.

    Directory of Open Access Journals (Sweden)

    Mohammad Madani Ibrahim

    Full Text Available BACKGROUND: Dietary interventions are critical in the prevention of metabolic diseases. Yet, the effects of fatty fish consumption on type 2 diabetes remain unclear. The aim of this study was to investigate whether a diet containing farmed salmon prevents or contributes to insulin resistance in mice. METHODOLOGY/PRINCIPAL FINDINGS: Adult male C57BL/6J mice were fed control diet (C, a very high-fat diet without or with farmed Atlantic salmon fillet (VHF and VHF/S, respectively, and Western diet without or with farmed Atlantic salmon fillet (WD and WD/S, respectively. Other mice were fed VHF containing farmed salmon fillet with reduced concentrations of persistent organic pollutants (VHF/S(-POPs. We assessed body weight gain, fat mass, insulin sensitivity, glucose tolerance, ex vivo muscle glucose uptake, performed histology and immunohistochemistry analysis, and investigated gene and protein expression. In comparison with animals fed VHF and WD, consumption of both VHF/S and WD/S exaggerated insulin resistance, visceral obesity, and glucose intolerance. In addition, the ability of insulin to stimulate Akt phosphorylation and muscle glucose uptake was impaired in mice fed farmed salmon. Relative to VHF/S-fed mice, animals fed VHF/S(-POPs had less body burdens of POPs, accumulated less visceral fat, and had reduced mRNA levels of TNFα as well as macrophage infiltration in adipose tissue. VHF/S(-POPs-fed mice further exhibited better insulin sensitivity and glucose tolerance than mice fed VHF/S. CONCLUSIONS/SIGNIFICANCE: Our data indicate that intake of farmed salmon fillet contributes to several metabolic disorders linked to type 2 diabetes and obesity, and suggest a role of POPs in these deleterious effects. Overall, these findings may participate to improve nutritional strategies for the prevention and therapy of insulin resistance.

  16. Changing the inhibitory specificity and function of Cucurbita maxima trypsin inhibitor-V by site-directed mutagenesis.

    Science.gov (United States)

    Wen, L; Lee, I; Chen, G; Huang, J K; Gong, Y; Krishnamoorthi, R

    1995-02-27

    Cucurbita maxima trypsin inhibitor-V (CMTI-V) is also a specific inhibitor of human blood coagulation factor beta-factor XIIa. A recombinant version of CMTI-V has allowed probing of roles of individual amino acid residues including the reactive site residue, lysine (P1), by site-directed mutagenesis. The K44R showed at least a 5-fold increase in inhibitory activity toward human beta-factor XIIa, while there was no change toward bovine trypsin. This result demonstrates that beta-factor-XIIa prefers an arginine residue over lysine residue, while trypsin is non-specific to lysine or arginine in its binding pocket. On the other hand, the specificity of CMTI-V could be changed from trypsin to chymotrypsin inhibition by mutation of the P1 residue to either leucine or methionine (K44L or K44M).

  17. Selective breeding can increase resistance of Atlantic salmon to furunculosis, infectious salmon anaemia and infectious pancreatic necrosis

    DEFF Research Database (Denmark)

    Kjøglum, Sissel; Henryon, Mark; Aasmundstad, Torunn

    2008-01-01

    We reasoned that by challenging large numbers of Atlantic salmon families with the causative agents of furunculosis, infectious salmon anaemia (ISA) and infectious pancreatic necrosis (IPN), we could show unequivocally that resistance to these diseases expresses moderate-to-high levels of additive...... genetic variation, and that the resistances are weakly correlated genetically. We tested this reasoning by challenging Atlantic salmon from 920 (approximately) full-sib families with the causative agents of furunculosis and ISA, and fish from 265 of these families with the causative agent of IPN. Additive...... indicate that it should be relatively easy to improve resistance to the diseases simultaneously. We believe that there is now strong evidence that selectively breeding Atlantic salmon for resistance can be highly successful...

  18. ELISA analysis of soybean trypsin inhibitors in processed foods.

    Science.gov (United States)

    Brandon, D L; Bates, A H; Friedman, M

    1991-01-01

    Soybean proteins are widely used in human foods in a variety of forms, including infant formulas, flour, protein concentrates, protein isolates, soy sauces, textured soy fibers, and tofu. The presence of inhibitors of digestive enzymes in soy proteins impairs the nutritional quality and possibly the safety of soybeans and other legumes. Processing, based on the use of heat or fractionation of protein isolates, does not completely inactivate or remove these inhibitors, so that residual amounts of inhibitors are consumed by animals and humans. New monoclonal antibody-based immunoassays can measure low levels of the soybean Kunitz trypsin inhibitor (KTI) and the Bowman-Birk trypsin and chymotrypsin inhibitor (BBI) and the Bowman-Birk foods. The enzyme-linked immunosorbent assay (ELISA) was used to measure the inhibitor content of soy concentrates, isolates, and flours, both heated and unheated; a commercial soy infant formula; KTI and BBI with rearranged disulfide bonds; browning products derived from heat-treatment of KTI with glucose and starch; and KTI exposed to high pH. The results indicate that even low inhibitor isolates contain significant amounts of specific inhibitors. Thus, infants on soy formula consume about 10 mg of KTI plus BBI per day. The immunoassays complement the established enzymatic assays of trypsin and chymotrypsin inhibitors, and have advantages in (a) measuring low levels of inhibitors in processed foods; and (b) differentiating between the Kunitz and Bowman-Birk inhibitors. The significance of our findings for food safety are discussed.

  19. Magnetic nanoparticles coated with polyaniline to stabilize immobilized trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Maciel, J. C., E-mail: jackeline-maciel@hotmail.com [Universidade Federal de Roraima (Brazil); Mercês, A. A. D.; Cabrera, M. [Universidade Federal de Pernambuco, Laboratório de Imunopatologia Keizo Asami (Brazil); Shigeyosi, W. T. [Universidade Federal de São Carlos, Departamento de Física (Brazil); Souza, S. D. de; Olzon-Dionysio, M.; Fabris, J. D. [Universidade Federal dos Vales de Jequitinhonha e Mucuri (Brazil); Cardoso, C. A. [Universidade Federal de São Carlos, Departamento de Física (Brazil); Neri, D. F. M. [Universidade Federal do Vale do São Francisco (Brazil); Silva, M. P. C.; Carvalho, L. B. [Universidade Federal de Pernambuco, Laboratório de Imunopatologia Keizo Asami (Brazil)

    2016-12-15

    It is reported the synthesis of magnetic nanoparticles via the chemical co-precipitation of Fe {sup 3+} ions and their preparation by coating them with polyaniline. The electronic micrograph analysis showed that the mean diameter for the nanoparticles is ∼15 nm. FTIR, powder X-ray diffraction and Mössbauer spectroscopy were used to understand the chemical, crystallographic and {sup 57}Fe hyperfine structures for the two samples. The nanoparticles, which exhibited magnetic behavior with relatively high spontaneous magnetization at room temperature, were identified as being mainly formed by maghemite (γFe{sub 2}O{sub 3}). The coated magnetic nanoparticles (sample labeled “mPANI”) presented a real ability to bind biological molecules such as trypsin, forming the magnetic enzyme derivative (sample “mPANIG-Trypsin”). The amount of protein and specific activity of the immobilized trypsin were found to be 13±5 μg of protein/mg of mPANI (49.3 % of immobilized protein) and 24.1±0.7 U/mg of immobilized protein, respectively. After 48 days of storage at 4 {sup ∘}C, the activity of the immobilized trypsin was found to be 89 % of its initial activity. This simple, fast and low-cost procedure was revealed to be a promising way to prepare mPANI nanoparticles if technological applications addressed to covalently link biomolecules are envisaged. This route yields chemically stable derivatives, which can be easily recovered from the reaction mixture with a magnetic field and recyclable reused.

  20. Trypsin from unicorn leatherjacket (Aluterus monoceros) pyloric caeca: purification and its use for preparation of fish protein hydrolysate with antioxidative activity.

    Science.gov (United States)

    Zamani, Abbas; Benjakul, Soottawat

    2016-02-01

    Fish proteases, especially trypsin, could be used to prepare fish protein hydrolysates with antioxidative activities. In this study, trypsin from the pyloric caeca of unicorn leatherjacket was purified by ammonium sulfate precipitation and soybean trypsin inhibitor (SBTI)-Sepharose 4B affinity chromatography. Hydrolysate from Indian mackerel protein isolate with different degrees of hydrolysis (20, 30 and 40% DH) was prepared using the purified trypsin, and antioxidative activities (1,1-diphenyl-2-picrylhydrazyl and 2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) radical-scavenging activities, ferric-reducing antioxidant power and ferrous-chelating activity) of the hydrolysate were determined. Trypsin was purified 26.43-fold with a yield of 13.43%. The purified trypsin had a molecular weight (MW) of 23.5 kDa and optimal activity at pH 8.0 and 55 °C. It displayed high stability in the pH range of 6.0-11.0 and was thermally stable up to 50 °C. Both SBTI (0.05 mmol L(-1)) and N-p-tosyl-L-lysine-chloromethylketone (5 mmol L(-1)) completely inhibited trypsin activity. Antioxidative activities of the hydrolysate from Indian mackerel protein isolate increased with increasing DH up to 40% (P unicorn leatherjacket pyloric caeca was identified as trypsin based on its ability to hydrolyze a specific synthetic substrate and the response to specific trypsin inhibitors. The purified trypsin could hydrolyze Indian mackerel protein isolate, and the resulting hydrolysate exhibited antioxidative activity depending on its DH. © 2015 Society of Chemical Industry.

  1. Pipelines and salmon in northern British Columbia : potential impacts

    International Nuclear Information System (INIS)

    Levy, D.A.

    2009-10-01

    Four pipeline projects have been proposed for northern British Columbia that could threaten the health of the Fraser, Skeena, and Kitimat watersheds. The pipelines will expose salmon to risks on several fronts. Enbridge's Northern Gateway pipeline project has generated the most concern for a several reasons, including the risks to salmon and freshwater habitat from pipeline failures, notably leaks or ruptures. This paper reviewed the salmon resources in affected watersheds; salmon and BC's economy; salmon diversity and abundance; impacts on fish from pipeline construction, operations and failures; behaviours of different petroleum products in fresh water; hydrocarbon toxicity; history of pipeline failures; sabotage and natural disasters; and Canadian case studies. Salmon are already experiencing stresses from forestry, hydro-electricity, transportation, agriculture, mining, mountain pine beetle, climate change and coalbed methane development. Their cumulative impact will dictate the long-term health and viability of salmon. It was concluded that if all of the proposed pipelines were built, they would extend over 4,000 km, crossing more than 1,000 rivers and streams in some of Canada's most productive salmon habitat. During construction, pipeline stream crossings are vulnerable to increased sedimentation, which can degrade salmon habitat. In the event of a spill, the condensate and oil sands products carried in the pipelines are highly toxic to salmon, with serious and lasting adverse impacts on salmon and their habitat. Any decision to approve such a pipeline should be made in recognition of these risks. 73 refs., 5 tabs., 15 figs., 2 appendices.

  2. Structural and functional characterization of salmon STAT1, STAT2 and IRF9 homologs sheds light on interferon signaling in teleosts

    Directory of Open Access Journals (Sweden)

    Mehrdad Sobhkhez

    2014-01-01

    Full Text Available Mammalian IRF9 and STAT2, together with STAT1, form the ISGF3 transcription factor complex, which is critical for type I interferon (IFN-induced signaling, while IFNγ stimulation is mediated by homodimeric STAT1 protein. Teleost fish are known to possess most JAK and STAT family members, however, description of their functional activity in lower vertebrates is still scarce. In the present study we have identified two different STAT2 homologs and one IRF9 homolog from Atlantic salmon (Salmo salar. Both proteins have domain-like structures with functional motifs that are similar to higher vertebrates, suggesting that they are orthologs to mammalian STAT2 and IRF9. The two identified salmon STAT2s, named STAT2a and STAT2b, showed high sequence identity but were divergent in their transactivation domain (TAD. Like STAT1, ectopically expressed STAT2a and b were shown to be tyrosine phosphorylated by type I IFNs and, interestingly, also by IFNγ. Microscopy analyses demonstrated that STAT2 co-localized with STAT1a in the cytoplasm of unstimulated cells, while IFNa1 and IFNγ stimulation seemed to favor their nuclear localization. Overexpression of STAT2a or STAT2b together with STAT1a activated a GAS-containing reporter gene construct in IFNγ-stimulated cells. The highest induction of GAS promoter activation was found in IFNγ-stimulated cells transfected with IRF9 alone. Taken together, these data suggest that salmon STAT2 and IRF9 may have a role in IFNγ-induced signaling and promote the expression of GAS-driven genes in bony fish. Since mammalian STAT2 is primarily an ISGF3 component and not involved in IFNγ signaling, our finding features a novel role for STAT2 in fish.

  3. Why Ser and not Thr brokers catalysis in the trypsin fold.

    Science.gov (United States)

    Pelc, Leslie A; Chen, Zhiwei; Gohara, David W; Vogt, Austin D; Pozzi, Nicola; Di Cera, Enrico

    2015-02-24

    Although Thr is equally represented as Ser in the human genome and as a nucleophile is as good as Ser, it is never found in the active site of the large family of trypsin-like proteases that utilize the Asp/His/Ser triad. The molecular basis of the preference of Ser over Thr in the trypsin fold was investigated with X-ray structures of the thrombin mutant S195T free and bound to an irreversible active site inhibitor. In the free form, the methyl group of T195 is oriented toward the incoming substrate in a conformation seemingly incompatible with productive binding. In the bound form, the side chain of T195 is reoriented for efficient substrate acylation without causing steric clash within the active site. Rapid kinetics prove that this change is due to selection of an active conformation from a preexisting ensemble of reactive and unreactive rotamers whose relative distribution determines the level of activity of the protease. Consistent with these observations, the S195T substitution is associated with a weak yet finite activity that allows identification of an unanticipated important role for S195 as the end point of allosteric transduction in the trypsin fold. The S195T mutation abrogates the Na(+)-dependent enhancement of catalytic activity in thrombin, activated protein C, and factor Xa and significantly weakens the physiologically important allosteric effects of thrombomodulin on thrombin and of cofactor Va on factor Xa. The evolutionary selection of Ser over Thr in trypsin-like proteases was therefore driven by the need for high catalytic activity and efficient allosteric regulation.

  4. Development of a rapid high-efficiency scalable process for acetylated Sus scrofa cationic trypsin production from Escherichia coli inclusion bodies.

    Science.gov (United States)

    Zhao, Mingzhi; Wu, Feilin; Xu, Ping

    2015-12-01

    Trypsin is one of the most important enzymatic tools in proteomics and biopharmaceutical studies. Here, we describe the complete recombinant expression and purification from a trypsinogen expression vector construct. The Sus scrofa cationic trypsin gene with a propeptide sequence was optimized according to Escherichia coli codon-usage bias and chemically synthesized. The gene was inserted into pET-11c plasmid to yield an expression vector. Using high-density E. coli fed-batch fermentation, trypsinogen was expressed in inclusion bodies at 1.47 g/L. The inclusion body was refolded with a high yield of 36%. The purified trypsinogen was then activated to produce trypsin. To address stability problems, the trypsin thus produced was acetylated. The final product was generated upon gel filtration. The final yield of acetylated trypsin was 182 mg/L from a 5-L fermenter. Our acetylated trypsin product demonstrated higher BAEE activity (30,100 BAEE unit/mg) than a commercial product (9500 BAEE unit/mg, Promega). It also demonstrated resistance to autolysis. This is the first report of production of acetylated recombinant trypsin that is stable and suitable for scale-up. Copyright © 2015 Elsevier Inc. All rights reserved.

  5. AquAdvantage Salmon Genetically modified organism

    OpenAIRE

    Núñez Saurí, Ester; Universitat Autònoma de Barcelona. Facultat de Veterinària

    2014-01-01

    Póster AquAdvantage Salmon is a genetically modified organism developed by AquBounty Technologies. The objective of this transgenic organism is to increase the growth rate to obtain the same of conventional salmon faster.

  6. Immobilization of trypsin on miniature incandescent bulbs for infrared-assisted proteolysis

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Huimin; Bao, Huimin; Zhang, Luyan; Chen, Gang, E-mail: gangchen@fudan.edu.cn

    2014-10-03

    Highlights: • Trypsin was immobilized on miniature incandescent bulbs via chitosan coating. • The bulbs acted as enzymatic reactors and the generators of infrared radiation. • The bulb bioreactors were successfully employed in infrared-assisted proteolysis. • The proteolysis could accomplish within 5 min with high sequence coverages. - Abstract: A novel efficient proteolysis approach was developed based on trypsin-immobilized miniature incandescent bulbs and infrared (IR) radiation. Trypsin was covalently immobilized in the chitosan coating on the outer surface of miniature incandescent bulbs with the aid of glutaraldehyde. When an illuminated enzyme-immobilized bulb was immersed in protein solution, the emitted IR radiation could trigger and accelerate heterogeneous protein digestion. The feasibility and performance of the novel proteolysis approach were demonstrated by the digestion of hemoglobin (HEM), cytochrome c (Cyt-c), lysozyme (LYS), and ovalbumin (OVA) and the digestion time was significantly reduced to 5 min. The obtained digests were identified by MALDI-TOF-MS with the sequence coverages of 91%, 77%, 80%, and 52% for HEM, Cyt-c, LYS, and OVA (200 ng μL{sup −1} each), respectively. The suitability of the prepared bulb bioreactors to complex proteins was demonstrated by digesting human serum.

  7. Chemically modified, immobilized trypsin reactor with improved digestion efficiency

    NARCIS (Netherlands)

    Freije, J.R.; Mulder, P.P.; Werkman, W.; Rieux, L.; Niederlander, H.A G; Verpoorte, Sabeth; Bischoff, Rainer

    2005-01-01

    Tryptic digestion followed by identification using mass spectrometry is an important step in many proteomic studies. Here, we describe the preparation of immobilized, acetylated trypsin for enhanced digestion efficacy in integrated protein analysis platforms. Complete digestion of cytochrome c was

  8. A trypsin inhibitor from rambutan seeds with antitumor, anti-HIV-1 reverse transcriptase, and nitric oxide-inducing properties.

    Science.gov (United States)

    Fang, Evandro Fei; Ng, Tzi Bun

    2015-04-01

    Nephelium lappaceum L., commonly known as "rambutan," is a typical tropical tree and is well known for its juicy and sweet fruit which has an exotic flavor. Chemical studies on rambutan have led to the identification of various components such as monoterpene lactones and volatile compounds. Here, a 22.5-kDa trypsin inhibitor (N . lappaceum trypsin inhibitor (NLTI)) was isolated from fresh rambutan seeds using liquid chromatographical techniques. NLTI reduced the proteolytic activities of both trypsin and α-chymotrypsin. Dithiothreitol reduced the trypsin inhibitory activity of NLTI at a concentration of 1 mM, indicating that an intact disulfide bond is essential to the activity. NLTI inhibited HIV-1 reverse transcriptase with an IC50 of 0.73 μM. In addition, NLTI manifested a time- and dose-dependent inhibitory effect on growth in many tumor cells. NLTI is one of the few trypsin inhibitors with nitric oxide-inducing activity and may find application in tumor therapy.

  9. Determinants of public attitudes to genetically modified salmon.

    Directory of Open Access Journals (Sweden)

    Latifah Amin

    Full Text Available The objective of this paper is to assess the attitude of Malaysian stakeholders to genetically modified (GM salmon and to identify the factors that influence their acceptance of GM salmon using a structural equation model. A survey was carried out on 434 representatives from various stakeholder groups in the Klang Valley region of Malaysia. Public attitude towards GM salmon was measured using self-developed questionnaires with seven-point Likert scales. The findings of this study have confirmed that public attitudes towards GM salmon is a complex issue and should be seen as a multi-faceted process. The most important direct predictors for the encouragement of GM salmon are the specific application-linked perceptions about religious acceptability of GM salmon followed by perceived risks and benefits, familiarity, and general promise of modern biotechnology. Encouragement of GM salmon also involves the interplay among other factors such as general concerns of biotechnology, threatening the natural order of things, the need for labeling, the need for patenting, confidence in regulation, and societal values. The research findings can serve as a database that will be useful for understanding the social construct of public attitude towards GM foods in a developing country.

  10. Differential use of salmon by vertebrate consumers: implications for conservation

    Directory of Open Access Journals (Sweden)

    Taal Levi

    2015-08-01

    Full Text Available Salmon and other anadromous fish are consumed by vertebrates with distinct life history strategies to capitalize on this ephemeral pulse of resource availability. Depending on the timing of salmon arrival, this resource may be in surplus to the needs of vertebrate consumers if, for instance, their populations are limited by food availability during other times of year. However, the life history of some consumers enables more efficient exploitation of these ephemeral resources. Bears can deposit fat and then hibernate to avoid winter food scarcity, and highly mobile consumers such as eagles, gulls, and other birds can migrate to access asynchronous pulses of salmon availability. We used camera traps on pink, chum, and sockeye salmon spawning grounds with various run times and stream morphologies, and on individual salmon carcasses, to discern potentially different use patterns among consumers. Wildlife use of salmon was highly heterogeneous. Ravens were the only avian consumer that fed heavily on pink salmon in small streams. Eagles and gulls did not feed on early pink salmon runs in streams, and only moderately at early sockeye runs, but were the dominant consumers at late chum salmon runs, particularly on expansive river flats. Brown bears used all salmon resources far more than other terrestrial vertebrates. Notably, black bears were not observed on salmon spawning grounds despite being the most frequently observed vertebrate on roads and trails. From a conservation and management perspective, all salmon species and stream morphologies are used extensively by bears, but salmon spawning late in the year are disproportionately important to eagles and other highly mobile species that are seasonally limited by winter food availability.

  11. Study on transformation of cowpea trypsin inhibitor gene into ...

    African Journals Online (AJOL)

    Cowpea Trypsin Inhibitor (CpTI) gene was transferred into cauliflower by agrobacterium-mediated transformation method, and 14 transgenic cauliflower plants were obtained. Cotyledons and hypocotyls were used as explants. The putative transformants were assayed by PCR and Southern blotting analysis. The results ...

  12. THE FUTURE OF PACIFIC NORTHWEST SALMON: ANATOMY OF A CRISIS

    Science.gov (United States)

    Salmon are categorized biologically into two groups: Pacific salmon or Atlantic salmon. All seven species of Pacific salmon on both sides of the North Pacific Ocean have declined substantially from historic levels, but large runs still occur in northern British Columbia, Yukon,...

  13. Trypsin digest protocol to analyze the retinal vasculature of a mouse model.

    Science.gov (United States)

    Chou, Jonathan C; Rollins, Stuart D; Fawzi, Amani A

    2013-06-13

    Trypsin digest is the gold standard method to analyze the retinal vasculature (1-5). It allows visualization of the entire network of complex three-dimensional retinal blood vessels and capillaries by creating a two-dimensional flat-mount of the interconnected vascular channels after digestion of the non-vascular components of the retina. This allows one to study various pathologic vascular changes, such as microaneurysms, capillary degeneration, and abnormal endothelial to pericyte ratios. However, the method is technically challenging, especially in mice, which have become the most widely available animal model to study the retina because of the ease of genetic manipulations (6,7). In the mouse eye, it is particularly difficult to completely remove the non-vascular components while maintaining the overall architecture of the retinal blood vessels. To date, there is a dearth of literature that describes the trypsin digest technique in detail in the mouse. This manuscript provides a detailed step-by-step methodology of the trypsin digest in mouse retina, while also providing tips on troubleshooting difficult steps.

  14. Atomic-scale investigation of the interactions between tetrabromobisphenol A, tetrabromobisphenol S and bovine trypsin by spectroscopies and molecular dynamics simulations

    International Nuclear Information System (INIS)

    Ding, Keke; Zhang, Huanxin; Wang, Haifei; Lv, Xuan; Pan, Liumeng; Zhang, Wenjing; Zhuang, Shulin

    2015-01-01

    Highlights: • The interaction of TBBPA/TBBPS with bovine trypsin was deciphered for the first time. • The fluorescence of bovine trypsin was quenched in a concentration-dependent mode. • TBBPA and TBBPS bind at the ANS binding site with distinct binding modes. • TBBPS has a higher binding affinity toward bovine trypsin than TBBPA. • Our in vitro and in silico approach is helpful to assess risk of TBBPA-related BFRs. - Abstract: Tetrabromobisphenol A (TBBPA) and its replacement alternative tetrabromobisphenol S (TBBPS) are used widely as brominated flame retardants (BFRs). However, the potential risk of their effects on bovine trypsin remains largely unknown. We investigated the effects of TBBPA and TBBPS to bovine trypsin by the fluorescence spectroscopy, circular dichroism and molecular dynamics (MD) simulations. They statically quenched the intrinsic fluorescence of bovine trypsin in a concentration-dependent mode and caused slight red-shifted fluorescence. The short and long fluorescence lifetime decay components of bovine trypsin were both affected, partly due to the disturbed microenvironmental changes of Trp215. The β-sheet content of bovine trypsin was significantly reduced from 82.4% to 75.7% and 76.6% by TBBPA and TBBPS, respectively, possibly impairing the physiological function of bovine trypsin. TBBPA and TBBPS bind at the 8-anilinonaphthalene-1-sulfonate (ANS) binding site with an association constant of 1.09 × 10 4 M −1 and 2.41 × 10 4 M −1 at 298 K, respectively. MD simulations revealed that van der Waals interactions and hydrogen bond interactions are dominant for TBBPA, whereas electrostatic interactions are critical for TBBPS. Our in vitro and in silico studies are beneficial to the understanding of risk assessment and future design of environmental benign BFRs.

  15. Influence of surface-imprinted nanoparticles on trypsin activity.

    Science.gov (United States)

    Guerreiro, António; Poma, Alessandro; Karim, Kal; Moczko, Ewa; Takarada, Jessica; de Vargas-Sansalvador, Isabel Perez; Turner, Nicholas; Piletska, Elena; de Magalhães, Cristiana Schmidt; Glazova, Natalia; Serkova, Anastasia; Omelianova, Aleksandra; Piletsky, Sergey

    2014-09-01

    Here, the modulation of enzyme activity is presented by protein-imprinted nanoparticles produced using a solid-phase approach. Using trypsin as target, binding of the nanoparticles to the enzyme results in its inhibition or in stabilization, depending on the orientation of the immobilized enzyme used during imprinting. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Salmon Mapper

    Science.gov (United States)

    Information about the web application to assist pesticide users' with an understanding of the spatial extent of certain pesticide use limitations to protect endangered or threatened salmon and steelhead in California, Oregon and Washington.

  17. Thermostable trypsin conjugates immobilized to biogenic magnetite show a high operational stability and remarkable reusability for protein digestion

    Science.gov (United States)

    Pečová, M.; Šebela, M.; Marková, Z.; Poláková, K.; Čuda, J.; Šafářová, K.; Zbořil, R.

    2013-03-01

    In this work, magnetosomes produced by microorganisms were chosen as a suitable magnetic carrier for covalent immobilization of thermostable trypsin conjugates with an expected applicability for efficient and rapid digestion of proteins at elevated temperatures. First, a biogenic magnetite was isolated from Magnetospirillum gryphiswaldense and its free surface was coated with the natural polysaccharide chitosan containing free amino and hydroxy groups. Prior to covalent immobilization, bovine trypsin was modified by conjugating with α-, β- and γ-cyclodextrin. Modified trypsin was bound to the magnetic carriers via amino groups using 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide and N-hydroxysulfosuccinimide as coupling reagents. The magnetic biomaterial was characterized by magnetometric analysis and electron microscopy. With regard to their biochemical properties, the immobilized trypsin conjugates showed an increased resistance to elevated temperatures, eliminated autolysis, had an unchanged pH optimum and a significant storage stability and reusability. Considering these parameters, the presented enzymatic system exhibits properties that are superior to those of trypsin forms obtained by other frequently used approaches. The proteolytic performance was demonstrated during in-solution digestion of model proteins (horseradish peroxidase, bovine serum albumin and hen egg white lysozyme) followed by mass spectrometry. It is shown that both magnetic immobilization and chemical modification enhance the characteristics of trypsin making it a promising tool for protein digestion.

  18. Buckwheat trypsin inhibitor with helical hairpin structure belongs to a new family of plant defence peptides.

    Science.gov (United States)

    Oparin, Peter B; Mineev, Konstantin S; Dunaevsky, Yakov E; Arseniev, Alexander S; Belozersky, Mikhail A; Grishin, Eugene V; Egorov, Tsezi A; Vassilevski, Alexander A

    2012-08-15

    A new peptide trypsin inhibitor named BWI-2c was obtained from buckwheat (Fagopyrum esculentum) seeds by sequential affinity, ion exchange and reversed-phase chromatography. The peptide was sequenced and found to contain 41 amino acid residues, with four cysteine residues involved in two intramolecular disulfide bonds. Recombinant BWI-2c identical to the natural peptide was produced in Escherichia coli in a form of a cleavable fusion with thioredoxin. The 3D (three-dimensional) structure of the peptide in solution was determined by NMR spectroscopy, revealing two antiparallel α-helices stapled by disulfide bonds. Together with VhTI, a trypsin inhibitor from veronica (Veronica hederifolia), BWI-2c represents a new family of protease inhibitors with an unusual α-helical hairpin fold. The linker sequence between the helices represents the so-called trypsin inhibitory loop responsible for direct binding to the active site of the enzyme that cleaves BWI-2c at the functionally important residue Arg(19). The inhibition constant was determined for BWI-2c against trypsin (1.7×10(-1)0 M), and the peptide was tested on other enzymes, including those from various insect digestive systems, revealing high selectivity to trypsin-like proteases. Structural similarity shared by BWI-2c, VhTI and several other plant defence peptides leads to the acknowledgement of a new widespread family of plant peptides termed α-hairpinins.

  19. Gene expression in Atlantic salmon skin in response to infection with the parasitic copepod Lepeophtheirus salmonis, cortisol implant, and their combination

    Directory of Open Access Journals (Sweden)

    Krasnov Aleksei

    2012-04-01

    Full Text Available Abstract Background The salmon louse is an ectoparasitic copepod that causes major economic losses in the aquaculture industry of Atlantic salmon. This host displays a high level of susceptibility to lice which can be accounted for by several factors including stress. In addition, the parasite itself acts as a potent stressor of the host, and outcomes of infection can depend on biotic and abiotic factors that stimulate production of cortisol. Consequently, examination of responses to infection with this parasite, in addition to stress hormone regulation in Atlantic salmon, is vital for better understanding of the host pathogen interaction. Results Atlantic salmon post smolts were organised into four experimental groups: lice + cortisol, lice + placebo, no lice + cortisol, no lice + placebo. Infection levels were equal in both treatments upon termination of the experiment. Gene expression changes in skin were assessed with 21 k oligonucleotide microarray and qPCR at the chalimus stage 18 days post infection at 9°C. The transcriptomic effects of hormone treatment were significantly greater than lice-infection induced changes. Cortisol stimulated expression of genes involved in metabolism of steroids and amino acids, chaperones, responses to oxidative stress and eicosanoid metabolism and suppressed genes related to antigen presentation, B and T cells, antiviral and inflammatory responses. Cortisol and lice equally down-regulated a large panel of motor proteins that can be important for wound contraction. Cortisol also suppressed multiple genes involved in wound healing, parts of which were activated by the parasite. Down-regulation of collagens and other structural proteins was in parallel with the induction of proteinases that degrade extracellular matrix (MMP9 and MMP13. Cortisol reduced expression of genes encoding proteins involved in formation of various tissue structures, regulators of cell differentiation and growth factors. Conclusions

  20. The immobilisation of trypsin and glucose oxidase onto natural rubber-g.co-HEMA - high energy radiation derived copolymeric support systems

    International Nuclear Information System (INIS)

    Devi, S.; Guthrie, J.T.; Beddows, C.G.

    1990-01-01

    Natural rubber has been grafted with 2-HEMA by three different methods each involving Co(60)γ-radiation as the initiation source. The grafted samples were used in the immobilisation of glucose oxidase and trypsin. Optimisation of immobilisation involving trypsin was studied with regard to the pH and the type of crosslinking agent. It was observed that the immobilised enzyme had superior stability over a wider pH range when compared to the free trypsin. The retention of activity demonstrated by the immobilised trypsin was significant. That of immobilised glucose oxidase was far from being satisfactory. (author)

  1. Canada-USA Salmon Shelf Survival Study, 2007-2008 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Trudel, Marc; Tucker, Strahan; Morris, John

    2009-03-09

    Historically, salmon stocks from the Columbia River and Snake River formed one of the most valuable fisheries on the west coast of North America. However, salmon and steelhead returns sharply declined during the 1980s and 1990s to reach nearly 1 million fish. Although several factors may be responsible for the decline of Columbia River salmon and steelhead, there is increasing evidence that these drastic declines were primarily attributable to persistently unfavorable ocean conditions. Hence, an understanding of the effects of ocean conditions on salmon production is required to forecast the return of salmon to the Columbia River basin and to assess the efficacy of mitigation measures such as flow regulation on salmon resources in this system. The Canadian Program on High Seas Salmon has been collecting juvenile salmon and oceanographic data off the west coast of British Columbia and Southeast Alaska since 1998 to assess the effects of ocean conditions on the distribution, migration, growth, and survival of Pacific salmon. Here, we present a summary of the work conducted as part of the Canada-USA Salmon Shelf Survival Study during the 2008 fiscal year and compare these results with those obtained from previous years. The working hypothesis of this research is that fast growth enhances the marine survival of salmon, either because fast growing fish quickly reach a size that is sufficient to successfully avoid predators, or because they accumulate enough energy reserves to better survive their first winter at sea, a period generally considered critical in the life cycle of salmon. Sea surface temperature decreased from FY05 to FY08, whereas, the summer biomass of phytoplankton increased steadily off the west coast of Vancouver Island from FY05 to FY08. As in FY07, zooplankton biomass was generally above average off the west coast of Vancouver Island in FY08. Interestingly, phytoplankton and zooplankton biomass were higher in FY08 than was expected from the observed

  2. Trypsin from viscera of vermiculated sailfin catfish, Pterygoplichthys disjunctivus, Weber, 1991: its purification and characterization.

    Science.gov (United States)

    Villalba-Villalba, Ana Gloria; Ramírez-Suárez, Juan Carlos; Valenzuela-Soto, Elisa Miriam; Sánchez, Guillermina García; Ruiz, Gisela Carvallo; Pacheco-Aguilar, Ramón

    2013-11-15

    Pterygoplichthys disjunctivus viscera trypsin was purified by fractionation with ammonium sulphate, gel filtration, affinity and ion exchange chromatography (DEAE-Sepharose). Trypsin molecular weight was approximately 27.5kDa according to SDS-PAGE, shown a single band in zymography. It exhibited maximal activity at pH 9.5 and 40°C, using N-benzoyl-dl-arginine-p-nitroanilide (BAPNA) as substrate. Enzyme was effectively inhibited by phenyl methyl sulphonyl fluoride (PMSF) (100%), N-α-p-tosyl-l-lysine chloromethyl ketone (TLCK) (85.4%), benzamidine (80.2%), and soybean trypsin inhibitor (75.6%) and partially inhibited by N-tosyl-l-phenylalanine chloromethyl ketone (TPCK) (10.3%), ethylendiaminetetraacetic acid (EDTA) (8.7%) and pepstatin A (1.2%). Enzyme activity was slightly affected by metal ions (Fe(2+)>Hg(2+)>Mn(2+)>K(+)>Mg(2+)>Li(+)>Cu(2+)). Trypsin activity decreased continuously as NaCl concentration increased (0-30%). Km and kcat values were 0.13mM and 1.46s(-1), respectively. Results suggest the enzyme have a potential application where room processing temperatures (25-35°C) or high salt (30%) concentration are needed, such as in fish sauce production. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. An unusual helix-turn-helix protease inhibitory motif in a novel trypsin inhibitor from seeds of Veronica (Veronica hederifolia L.).

    Science.gov (United States)

    Conners, Rebecca; Konarev, Alexander V; Forsyth, Jane; Lovegrove, Alison; Marsh, Justin; Joseph-Horne, Timothy; Shewry, Peter; Brady, R Leo

    2007-09-21

    The storage tissues of many plants contain protease inhibitors that are believed to play an important role in defending the plant from invasion by pests and pathogens. These proteinaceous inhibitor molecules belong to a number of structurally distinct families. We describe here the isolation, purification, initial inhibitory properties, and three-dimensional structure of a novel trypsin inhibitor from seeds of Veronica hederifolia (VhTI). The VhTI peptide inhibits trypsin with a submicromolar apparent K(i) and is expected to be specific for trypsin-like serine proteases. VhTI differs dramatically in structure from all previously described families of trypsin inhibitors, consisting of a helix-turn-helix motif, with the two alpha helices tightly associated by two disulfide bonds. Unusually, the crystallized complex is in the form of a stabilized acyl-enzyme intermediate with the scissile bond of the VhTI inhibitor cleaved and the resulting N-terminal portion of the inhibitor remaining attached to the trypsin catalytic serine 195 by an ester bond. A synthetic, truncated version of the VhTI peptide has also been produced and co-crystallized with trypsin but, surprisingly, is seen to be uncleaved and consequently forms a noncovalent complex with trypsin. The VhTI peptide shows that effective enzyme inhibitors can be constructed from simple helical motifs and provides a new scaffold on which to base the design of novel serine protease inhibitors.

  4. Modifications outside the proteinase binding loop in Cucurbita maxima trypsin inhibitor III (CMTI-III) analogues change the binding energy with bovine beta-trypsin.

    Science.gov (United States)

    Jaśkiewicz, A; Lis, K; Rózycki, J; Kupryszewski, G; Rolka, K; Ragnarsson, U; Zbyryt, T; Wilusz, T

    1998-10-02

    Five 26-peptide analogues of the trypsin inhibitor [Pro18]CMTI-III containing Leu or Tyr in position 7 and Val or Tyr in position 27: 1 (Leu7, Tyr27), 2 (Tyr7, Val27), 3 (Tyr7, Tyr27), 4 (Leu7, Val27) and 5 (Leu7, Ala18, Tyr27) were synthesized by the solid-phase method. Analogues 1-4 displayed Ka with bovine beta-trypsin of the same order of magnitude as the wild CMTI-III inhibitor, whereas for analogue 5, this value was lower by about 3 orders of magnitude. This indicated that for the analogues with Pro (but not with Ala) in position 18, the side-chain interactions between positions 7 and 27 did not play a critical role for the stabilization of the active structure. In addition, these results also suggest that Tyr7 is involved in an additional aromatic interaction with position 41 of the enzyme.

  5. Salmon River Habitat Enhancement, 1989 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, Mike

    1989-04-01

    This project was funded by the Bonneville Power Administration (BPA). The annual report contains three individual subproject papers detailing tribal fisheries work completed during the summer and fall of 1989. Subproject 1 contains summaries of evaluation/monitoring efforts associated with the Bear Valley Creek, Idaho enhancement project. Subproject 2 contains an evaluation of the Yankee Fork of the Salmon River habitat enhancement project. This report has been sub-divided into two parts: Part 1; stream evaluation and Part 2; pond series evaluation. Subproject 3 concerns the East Fork of the Salmon River, Idaho. This report summarizes the evaluation of the project to date including the 1989 pre-construction evaluation conducted within the East Fork drainage. Dredge mining has degraded spawning and rearing habitat for chinook salmon and steelhead trout in the Yankee Fork drainage of the Salmon River and in Bear Valley Creek. Mining, agricultural, and grazing practices degraded habitat in the East Fork of the Salmon River. Biological monitoring of the success of habitat enhancement for Bear Valley Creek and Yankee Fork are presented in this report. Physical and biological inventories prior to habitat enhancement in East Fork were also conducted. Four series of off-channel ponds of the Yankee Fork are shown to provide effective rearing habitat for chinook salmon. 45 refs., 49 figs., 24 tabs.

  6. Surveys on Gyrodactylus parasites onwild Atlantic salmon in Denmark

    DEFF Research Database (Denmark)

    Jørgensen, Louise von Gersdorff; Heinecke, Rasmus Demuth; Buchmann, Kurt

    Gyrodactylus salaris is a monogenean ectoparasite parasitizing salmonids in freshwater. This parasite is highly pathogenic to both Norwegian and Scottish salmon and has decimated the salmon populations in 45 Norwegian rivers after anthropogenic transfer from Sweden. G. salaris has also been found...... on several occasions in Danish rainbow trout farms but has never been recorded as a pathogenic parasite on Danish wild salmon. In the present study the occurrence of G. salaris and other Gyrodactylus parasites on wild Danish salmon fry and parr were monitored. Electrofishing was conducted in three river......-systems (River Skjern, Ribe and Varde) and 0+ and 1+ salmon were collected and sacrificed using an overdose of MS222. During spring or summer time more salmon fry and parr will be collected. The fins were excised and fins and body were conserved separately in 96% ethanol. In the laboratory, the fins and body...

  7. A novel poly(deep eutectic solvent)-based magnetic silica composite for solid-phase extraction of trypsin.

    Science.gov (United States)

    Xu, Kaijia; Wang, Yuzhi; Li, Yixue; Lin, Yunxuan; Zhang, Haibao; Zhou, Yigang

    2016-11-23

    Novel poly(deep eutectic solvent) grafted silica-coated magnetic microspheres (Fe 3 O 4 @SiO 2 -MPS@PDES) were prepared by polymerization of choline chloride-itaconic acid (ChCl-IA) and γ-MPS-modified magnetic silica composites, and were characterized by vibrating sample magnetometer (VSM), Fourier transform infrared spectrometry (FT-IR), X-ray photoelectron spectra (XPS), thermal gravimetric analysis (TGA) and transmission electron microscope (TEM). Then the synthetic Fe 3 O 4 @SiO 2 -MPS@PDES microspheres were applied for the magnetic solid-phase extraction (MSPE) of trypsin for the first time. After extraction, the concentration of trypsin in the supernatant was determined by a UV-vis spectrophotometer. Single factor experiments were carried out to investigate the effects of the extraction process, including the concentration of trypsin, the ionic strength, the pH value, the extraction time and the temperature. Experimental results showed the extraction capacity could reach up to 287.5 mg/g under optimized conditions. In comparison with Fe 3 O 4 @SiO 2 -MPS, Fe 3 O 4 @SiO 2 -MPS@PDES displayed higher extraction capacity and selectivity for trypsin. According to the regeneration studies, Fe 3 O 4 @SiO 2 -MPS@PDES microspheres can be recycled six times without significant loss of its extraction capacity, and retained a high extraction capacity of 233 mg/g after eight cycles. Besides, the activity studies also demonstrated that the activity of the extracted trypsin was well retained. Furthermore, the analysis of real sample revealed that the prepared magnetic microspheres can be used to purify trypsin in crude bovine pancreas extract. These results highlight the potential of the proposed Fe 3 O 4 @SiO 2 -MPS@PDES-MSPE method in separation of biomolecules. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Response of ecosystem metabolism to low densities of spawning Chinook Salmon

    Science.gov (United States)

    Joseph R. Benjamin; J. Ryan Bellmore; Grace A. Watson

    2016-01-01

    Marine derived nutrients delivered by large runs of returning salmon are thought to subsidize the in situ food resources that support juvenile salmon. In the Pacific Northwest, USA, salmon have declined to salmon runs. We explored whether low densities...

  9. Decreasing the amount of trypsin in in-gel digestion leads to diminished chemical noise and improved protein identifications.

    Science.gov (United States)

    Hu, Mo; Liu, Yanhua; Yu, Kaiwen; Liu, Xiaoyun

    2014-09-23

    Pre-fractionation by gel electrophoresis is often combined with liquid chromatography-mass spectrometry (LC-MS) for large-scale profiling of complex protein samples. An essential component of this widely applied proteomic platform is in-gel protein digestion. In nearly two decades of practicing this approach, an extremely high level of trypsin has been utilized due to the consideration of slow enzyme diffusion into the gel matrix. Here we report that trypsin autolysis products contribute to the bulk of chemical noise in in-gel digestion and remarkably we found evidence that the amount of trypsin can be slashed by an order of magnitude with comparable digestion performance. By revising perhaps the most critical element of this decade-old digestion protocol, the proteomics community relying on gel separation prior to LC-MS analysis will benefit instantly from much lowered cost due to enzyme expenditure. More importantly, substantially reduced chemical noise (i.e., trypsin self-cleavage products) as a result of less enzyme usage translates into more protein identifications when limited amounts of samples are the interest of interrogation. In-gel digestion is one of the most widely used methods in proteomics. An exceedingly high level of trypsin has been utilized due to the consideration of slow enzyme diffusion into the gel matrix. This requirement has been faithfully kept in nearly two decades of practicing this approach. Here we report that trypsin concentration can be slashed by at least an order of magnitude while still providing comparable digestion performance. Thus the proteomics community relying on gel separation prior to LC-MS analysis will benefit instantly from much lowered enzyme cost. More importantly, substantially reduced chemical noise (i.e., trypsin autolysis products) due to less enzyme usage translates into ~30% more protein identifications when limited amounts of protein samples are analyzed. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. 50 CFR 660.412 - EFH identifications and descriptions for Pacific salmon.

    Science.gov (United States)

    2010-10-01

    ... Pacific salmon. 660.412 Section 660.412 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT... COAST STATES West Coast Salmon Fisheries § 660.412 EFH identifications and descriptions for Pacific salmon. Pacific salmon essential fish habitat (EFH) includes all those water bodies occupied or...

  11. Comparative analysis of innate immune responses to Streptococcus phocae strains in Atlantic salmon (Salmo salar) and rainbow trout (Oncorhynchus mykiss).

    Science.gov (United States)

    Salazar, Soraya; Oliver, Cristian; Yáñez, Alejandro J; Avendaño-Herrera, Ruben

    2016-04-01

    Streptococcus phocae subsp. salmonis is a Gram-positive bacterium that causes mortality only in Atlantic salmon (Salmo salar) farmed in Chile, even when this species is co-cultured with rainbow trout (Oncorhynchus mykiss). This susceptibility could be determined by innate immune response components and their responses to bacterial infection. This fish pathogen shares subspecies status with Streptococcus phocae subsp. phocae isolated from seals. The present study compared innate immune system mechanisms in Atlantic salmon and rainbow trout when challenged with different S. phocae, including two isolates from Atlantic salmon (LM-08-Sp and LM-13-Sp) and two from seal (ATCC 51973(T) and P23). Streptococcus phocae growth was evaluated in the mucus and serum of both species, with rainbow trout samples evidencing inhibitory effects. Lysozyme activity supported this observation, with significantly higher (p trout serum and mucus as compared to Atlantic salmon. No differences were found in phagocytic capacity between fish species when stimulated with ATCC 51973(T) and P23. Against all S. phocae strains, rainbow trout and Atlantic salmon showed up to two-fold increased bactericidal activity, and rainbow trout demonstrated up to three-fold greater reactive oxygen species production in macrophages. In conclusion, the non-specific humoral and cellular barriers of Atlantic salmon were immunologically insufficient against S. phocae subsp. salmonis, thereby facilitating streptococcosis. Moreover, the more robust response of rainbow trout to S. phocae could not be attributed to any specific component of the innate immune system, but was rather the consequence of a combined response by the evaluated components. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Trypsin level in gallbladder bile and ductitis and width of the cystic duct.

    Science.gov (United States)

    Vracko, J; Wiechel, K L

    2000-01-01

    The change from laparotomy to laparoscopy for cholecystectomy has raised the question of how to manage concomitant bile duct stones. The present-day interest--and controversy--has focused on a transcystic approach reported to be feasible in 66-96% of cases, but without explaining the necessary prerequisite: the widening of the cystic duct. The cystic duct, wide mainly in patients with bile duct stones, has been reported to be highly variable: from strictured to very wide. The present study aims at comparing the trypsin level in the gallbladder bile and the cystic duct morphology and width in patients with and without bile duct stones. A prospective series of 63 gallstone patients, 30 with and 33 without bile duct stones (controls), underwent cholecystectomy and bile duct clearance. The study includes the trypsin level in the gallbladder bile, the width and morphology of the cystic duct, and the size of the gallstones. The patients with bile duct stones had, in contrast to the controls, higher trypsin levels in the gallbladder bile (P extraction feasible.

  13. Proteolytic and Trypsin Inhibitor Activity in Germinating Jojoba Seeds (Simmondsia chinensis).

    Science.gov (United States)

    Samac, D; Storey, R

    1981-12-01

    Changes in proteolytic activity (aminopeptidase, carboxypeptidase, endopeptidase) were followed during germination (imbibition through seedling development) in extracts from cotyledons of jojoba seeds (Simmondsia chinensis). After imbibition, the cotyledons contained high levels of sulfhydryl aminopeptidase activity (APA) but low levels of serine carboxypeptidase activity (CPA). CPA increased with germination through the apparent loss of a CPA inhibitor substance in the seed. Curves showing changes in endopeptidase activity (EPA) assayed at pH 4, 5, 6, 7, and 8 during germination were distinctly different. EPA at pH 4, 5, 6, and 7 showed characteristics of sulfhydryl enzymes while activity at pH 8 was probably due to a serine type enzyme. EPA at pH 6 was inhibited early in germination by one or more substances in the seed. Activities at pH 5 and later at pH 6 were the highest of all EPA throughout germination and increases in these activities were associated with a rapid loss of protein from the cotyledons of the developing seedling.Jojoba cotyledonary extracts were found to inhibit the enzymic activity of trypsin, chymotrypsin, and pepsin but not the protease from Aspergillus saotoi. The heat-labile trypsin inhibitor substance(s) was found in commercially processed jojoba seed meal and the albumin fraction of seed proteins. Trypsin inhibitor activity decreased with germination.

  14. Detection of five tumor markers in lung cancer by trypsin digestion of sputum method

    International Nuclear Information System (INIS)

    Lin Min; Nong Tianlei; Liu Daying

    2011-01-01

    To explore the detection of five tumor markers by trypsin digestion of sputum in the diagnosis of lung cancer, the samples of sputum in patients with lung cancer and benign lung disease were digested by trypsin and used to measure five tumor markers. The results showed that the sputum were well digested by 6% trypsin at pH8 and no affect on the determination of tumor markers. The CEA, CA125, CA153, CA211 and NSE levels in lung cancer group were significantly higher than that of in benign group (P<0.05). The sputum CEA and CA125 levels were significantly higher than that of the serum levels (P<0.05). The detection of sputum CEA, CA125, CA153, CA211 and NSE levels have clinical value in the diagnosis of lung cancer. When combined with other diagnostic methods,it might be helpful for further diagnosis in non confirmed lung cancer patients. (authors)

  15. Inclusion of Palmaria palmata (red seaweed) in Atlantic salmon diets: effects on the quality, shelf-life parameters and sensory properties of fresh and cooked salmon fillets.

    Science.gov (United States)

    Moroney, Natasha C; Wan, Alex H L; Soler-Vila, Anna; FitzGerald, Richard D; Johnson, Mark P; Kerry, Joe P

    2015-03-30

    The use of Palmaria palmata (PP) as a natural ingredient in farmed Atlantic salmon diets was investigated. The effect of salmon diet supplementation with P. palmata (0, 5, 10 and 15%) or synthetic astaxanthin (positive control, PC) for 16 weeks pre-slaughter on quality indices of fresh salmon fillets was examined. The susceptibility of salmon fillets/homogenates to oxidative stress conditions was also measured. In salmon fillets stored in modified atmosphere packs (60% N2 /40% CO2 ) for up to 15 days at 4 °C, P. palmata increased surface -a* (greenness) and b* (yellowness) values in a dose-dependent manner, resulting in a final yellow/orange flesh colour. In general, the dietary addition of P. palmata had no effect on pH, lipid oxidation (fresh, cooked and fillet homogenates) and microbiological status. 'Eating quality' sensory descriptors (texture, odour and oxidation flavour) in cooked salmon fillets were not influenced by dietary P. palmata. Salmon fed 5% PP showed increased overall acceptability compared with those fed PC and 0% PP. Dietary P. palmata was ineffective at providing red coloration in salmon fillets, but pigment deposition enhanced fillets with a yellow/orange colour. Carotenoids from P. palmata may prove to be a natural pigment alternative to canthaxanthin in salmon feeds. © 2014 Society of Chemical Industry.

  16. Snake River sockeye salmon (Oncorhynchus nerka) habitat/limnologic research

    International Nuclear Information System (INIS)

    Spaulding, S.

    1993-05-01

    This report outlines long-term planning and monitoring activities that occurred in 1991 and 1992 in the Stanley Basin Lakes of the upper Salmon River, Idaho for the purpose of sockeye salmon nerka) recovery. Limnological monitoring and experimental sampling protocol, designed to establish a limnological baseline and to evaluate sockeye salmon production capability of the lakes, are presented. Also presented are recommended passage improvements for current fish passage barriers/impediments on migratory routes to the lakes. We initiated O. nerka population evaluations for Redfish and Alturas lakes; this included population estimates of emerging kokanee fry entering each lake in the spring and adult kokanee spawning surveys in tributary streams during the fall. Gill net evaluations of Alturas, Pettit, and Stanley lakes were done in September, 1992 to assess the relative abundance of fish species among the Stanley Basin lakes. Fish population data will be used to predict sockeye salmon production potential within a lake, as well as a baseline to monitor long-term fish community changes as a result of sockeye salmon recovery activities. Also included is a paper that reviews sockeye salmon enhancement activities in British Columbia and Alaska and recommends strategies for the release of age-0 sockeye salmon that will be produced from the current captive broodstock

  17. Adhesion mechanism of salmon to polymer-coated can walls

    NARCIS (Netherlands)

    Dommershuijzen, H.; Hviid, L.; Hartog, den H.; Vereijken, J.

    2005-01-01

    Minimization of the amount of salmon adhering to the can wall after emptying is one of the convenience requirements of consumers of canned salmon. In order to achieve this, the mechanism by which salmon adheres to cans needs to be understood. The aim of this study was to provide such knowledge for

  18. Effects of dietary n-3 fatty acids on Toll-like receptor activation in primary leucocytes from Atlantic salmon (Salmo salar).

    Science.gov (United States)

    Arnemo, Marianne; Kavaliauskis, Arturas; Andresen, Adriana Magalhaes Santos; Bou, Marta; Berge, Gerd Marit; Ruyter, Bente; Gjøen, Tor

    2017-08-01

    The shortage of the n-3 fatty acids eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) on the international markets has led to increasing substitution of fish oil by plant oils in Atlantic salmon (Salmo salar) feed and thereby reducing the EPA and DHA content in salmon. However, the minimum required levels of these fatty acids in fish diets for securing fish health are unknown. Fish were fed with 0, 1 or 2% EPA or DHA alone or in combination of both over a period, growing from 50 to 400 g. Primary head kidney leucocytes were isolated and stimulated with Toll-like receptor (TLR) ligands to determine if EPA and DHA deficiency can affect expression of important immune genes and eicosanoid production. Several genes related to viral immune response did not vary between groups. However, there was a tendency that the high-level EPA and DHA groups expressed lower levels of IL-1β in non-stimulated leucocytes. These leucocytes were also more responsive to the TLR ligands, inducing higher expression levels of IL-1β and Mx1 after stimulation. The levels of prostaglandin E2 and leukotriene B4 in serum and media from stimulated leucocytes were lower in both low and high EPA and DHA groups. In conclusion, leucocytes from low EPA and DHA groups seemed to be less responsive towards immunostimulants, like TLR ligands, indicating that low levels or absence of dietary EPA and DHA may have immunosuppressive effects.

  19. Salmon Population Summary - Impacts of climate change on Pacific salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This work involves 1) synthesizing information from the literature and 2) modeling impacts of climate change on specific aspects of salmon life history and...

  20. Dioxins, dioxin-like PCBs and organochlorine pesticides in farmed salmon of various origin

    Energy Technology Data Exchange (ETDEWEB)

    Karl, H. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Hamburg (Germany); Ruoff, U. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Kiel (Germany); Schwind, K.H.; Jira, W. [Bundesforschungszentrum fuer Ernaehrung und Nahrung, Kulmbach (Germany)

    2004-09-15

    With a market share of 8.4% in 2001 (approx. 100,000 t) farmed salmon is one of the most important fish species on the German market. The world wide production of salmon in 2001 was approximately 1.2 Mio t. Norway has produced around 450,000 t of Atlantic salmon of which 60,000 t has been exported to Germany. Other important suppliers of salmon to the German market are Scotland, Denmark, Chile and Ireland. The annual amount from Ireland is relatively small, being approximately 2,000 t. Most salmon is raised under conventional farming conditions. During the last years also high priced organically grown salmon is available on the German market, mainly produced in Ireland. With 800 t per year the market share of organically farmed salmon is less than 1%. Within the context of a study to develop methods for the detection of organically produced products taking salmon as example it was checked if the contaminant levels and/or the contaminant patterns are suitable to differentiate between organically and conventionally farmed salmon. Conventionally farmed salmon, referred as to farmed salmon, was collected from different European farms; organically farmed salmon, referred as to organic salmon, came from Ireland as well as wild Atlantic salmon, which was included into the study. In the present study dioxins, dioxin-like PCBs, marker PCBs and a range of organochlorine pesticides (toxaphene, chlordane, DDT, HCB etc.) in the muscle meat of salmon were investigated.

  1. Genome wide response to dietary tetradecylthioacetic acid supplementation in the heart of Atlantic Salmon (Salmo salar L

    Directory of Open Access Journals (Sweden)

    Grammes Fabian

    2012-05-01

    Full Text Available Abstract Background Under-dimensioned hearts causing functional problems are associated with higher mortality rates in intensive Atlantic salmon aquaculture. Previous studies have indicated that tetradecylthioacetic acid (TTA induces cardiac growth and also stimulates transcription of peroxisome proliferator activated receptors (PPAR αand βin the Atlantic salmon heart. Since cardiac and transcriptional responses to feed are of high interest in aquaculture, the objective of this study was to characterize the transcriptional mechanisms induced by TTA in the heart of Atlantic salmon. Results Atlantic salmon were kept at sea for 17 weeks. During the first 8 weeks the fish received a TTA supplemented diet. Using microarrays, profound transcriptional effects were observed in the heart at the end of the experiment, 9 weeks after the feeding of TTA stopped. Approximately 90% of the significant genes were expressed higher in the TTA group. Hypergeometric testing revealed the over-representation of 35 gene ontology terms in the TTA fed group. The GO terms were generally categorized into cardiac performance, lipid catabolism, glycolysis and TCA cycle. Conclusions Our results indicate that TTA has profound effects on cardiac performance based on results from microarray and qRT-PCR analysis. The gene expression profile favors a scenario of ”physiological”lright hypertrophy recognized by increased oxidative fatty acid metabolism, glycolysis and TCA cycle activity as well as cardiac growth and contractility in the heart ventricle. Increased cardiac efficiency may offer significant benefits in the demanding Aquaculture situations.

  2. Salmon returns and consumer fitness: growth and energy storage in stream-dwelling salmonids increases with spawning salmon abundance

    Science.gov (United States)

    We examined how biomass of marine-derived nutrients (MDN), in the form of spawning Pacific salmon, influenced the nutritional status and nitrogen stable isotope ratios (d15N) of stream-dwelling fishes. We sampled coho salmon (Oncorhynchus kisutch) parr and juvenile Dolly Varden (Salvelinus malma) d...

  3. Salmon carcass movements in forest streams

    Science.gov (United States)

    Burke Strobel; Daniel R. Shivley; Brett B. Roper

    2009-01-01

    The movements of salmon carcasses over time were studied in two forest streams in the context of a large-scale salmon carcass supplementation program. The objectives were to assess both the level of treatment after stream flows had displaced carcasses and to evaluate whether the magnitude of carcass movements outside of a given reach could be predicted. The movements...

  4. Bauhinia variegata var. variegata trypsin inhibitor: From isolation to potential medicinal applications

    International Nuclear Information System (INIS)

    Fang, Evandro Fei; Wong, Jack Ho; Bah, Clara Shui Fern; Lin, Peng; Tsao, Sai Wah; Ng, Tzi Bun

    2010-01-01

    Here we report for the first time of a new Kunitz-type trypsin inhibitor (termed BvvTI) from seeds of the Camel's foot tree, Bauhinia variegata var. variegata. BvvTI shares the same reactive site residues (Arg, Ser) and exhibits a homology of N-terminal amino acid sequence to other Bauhinia protease inhibitors. The trypsin inhibitory activity (K i , 0.1 x 10 -9 M) of BvvTI ranks the highest among them. Besides anti-HIV-1 reverse transcriptase activity, BvvTI could significantly inhibit the proliferation of nasopharyngeal cancer CNE-1 cells in a selective way. This may partially be contributed by its induction of cytokines and apoptotic bodies. These results unveil potential medicinal applications of BvvTI.

  5. How coarse is too coarse for salmon spawning substrates?

    Science.gov (United States)

    Wooster, J. K.; Riebe, C. S.; Ligon, F. K.; Overstreet, B. T.

    2009-12-01

    Populations of Pacific salmon species have declined sharply in many rivers of the western US. Reversing these declines is a top priority and expense of many river restoration projects. To help restore salmon populations, managers often inject gravel into rivers, to supplement spawning habitat that has been depleted by gravel mining and the effects of dams—which block sediment and thus impair habitat downstream by coarsening the bed where salmon historically spawned. However, there is little quantitative understanding nor a methodology for determining when a river bed has become too coarse for salmon spawning. Hence there is little scientific basis for selecting sites that would optimize the restoration benefits of gravel injection (e.g., sites where flow velocities are suitable but bed materials are too coarse for spawning). To develop a quantitative understanding of what makes river beds too coarse for salmon spawning, we studied redds and spawning use in a series of California and Washington rivers where salmon spawning ability appears to be affected by coarse bed material. Our working hypothesis is that for a given flow condition, there is a maximum “threshold” particle size that a salmon of a given size is able to excavate and/or move as she builds her redd. A second, related hypothesis is that spawning use should decrease and eventually become impossible with increasing percent coverage by immovable particles. To test these hypotheses, we quantified the sizes and spatial distributions of immovably coarse particles in a series of salmon redds in each river during the peak of spawning. We also quantified spawning use and how it relates to percent coverage by immovable particles. Results from our studies of fall-run chinook salmon (Oncorhynchus tshawytsha) in the Feather River suggest that immovable particle size varies as a function of flow velocity over the redd, implying that faster water helps fish move bigger particles. Our Feather River study also

  6. A prospective randomized trial of Kotase ® (Bromelain + Trypsin) in ...

    African Journals Online (AJOL)

    International Journal of Medicine and Health Development. Journal Home · ABOUT THIS ... A prospective randomized trial of Kotase® (Bromelain + Trypsin) in the management of post-operative abdominal wounds at the University of Nigeria Teaching Hospital Enugu, Nigeria. Emmanuel R Ezeome, Aloy E Aghaji ...

  7. Patterns of change in climate and Pacific salmon production

    Science.gov (United States)

    Nathan J. Mantua

    2009-01-01

    For much of the 20th century a clear north-south inverse production pattern for Pacific salmon had a time dynamic that closely followed that of the Pacific Decadal Oscillation (PDO), which is the dominant pattern of North Pacific sea surface temperature variability. Total Alaska salmon production was high during warm regimes of the PDO, and total Alaska salmon...

  8. Future challanges for the maturing Norwegian salmon aquaculture industry

    DEFF Research Database (Denmark)

    Asche, Frank; Guttormsen, Atle G.; Nielsen, Rasmus

    2013-01-01

    In this paper, we analyze total factor productivity change in the Norwegian salmon aquaculture sector from 1996 to 2008. During this period, the production has on average been growing with 8% per year. At the same time, the price of salmon has stabilized indicating that an increase in demand...... factor to future production growth in the salmon aquaculture industry....

  9. Influence of carbohydrates on the interaction of procyanidin B3 with trypsin.

    Science.gov (United States)

    Gonçalves, Rui; Mateus, Nuno; De Freitas, Victor

    2011-11-09

    The biological properties of procyanidins, in particular their inhibition of digestive enzymes, have received much attention in the past few years. Dietary carbohydrates are an environmental factor that is known to affect the interaction of procyanidins with proteins. This work aimed at understanding the effect of ionic food carbohydrates (polygalacturonic acid, arabic gum, pectin, and xanthan gum) on the interaction between procyanidins and trypsin. Physical-chemical techniques such as saturation transfer difference-NMR (STD-NMR) spectroscopy, fluorescence quenching, and nephelometry were used to evaluate the interaction process. Using STD-NMR, it was possible to identify the binding of procyanidin B3 to trypsin. The tested carbohydrates prevented the association of procyanidin B3 and trypsin by a competition mechanism in which the ionic character of carbohydrates and their ability to encapsulate procyanidins seem crucial leading to a reduction in STD signal and light scattering and to a recovery of the proteins intrinsic fluorescence. On the basis of these results, it was possible to grade the carbohydrates in their aggregation inhibition ability: XG > PA > AG ≫ PC. These effects may be relevant since the coingestion of procyanidins and ionic carbohydrates are frequent and furthermore since these might negatively affect the antinutritional properties ascribed to procyanidins in the past.

  10. Salmon vulnerability maps - Effect of Climate Change on Salmon Population Vulnerability

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Steelhead (Oncorhynchus mykiss) and other Pacific salmon are threatened by unsustainable levels of harvest, genetic introgression from hatchery stocks and...

  11. Proficiency test for paracitides in salmon muscle

    NARCIS (Netherlands)

    Elbers, I.J.W.

    2012-01-01

    The aim of this proficiency study was to give laboratories the possibility to evaluate or demonstrate their competence for the analysis of parasiticides in salmon muscle. This study also provided an evaluation of the methods applied for the quantitative analysis of parasiticides in salmon muscle.

  12. Coho Salmon Master Plan, Clearwater River Basin.

    Energy Technology Data Exchange (ETDEWEB)

    Nez Perce Tribe; FishPro

    2004-10-01

    The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these

  13. A colostrum trypsin inhibitor gene expressed in the Cape fur seal mammary gland during lactation.

    Science.gov (United States)

    Pharo, Elizabeth A; Cane, Kylie N; McCoey, Julia; Buckle, Ashley M; Oosthuizen, W H; Guinet, Christophe; Arnould, John P Y

    2016-03-01

    The colostrum trypsin inhibitor (CTI) gene and transcript were cloned from the Cape fur seal mammary gland and CTI identified by in silico analysis of the Pacific walrus and polar bear genomes (Order Carnivora), and in marine and terrestrial mammals of the Orders Cetartiodactyla (yak, whales, camel) and Perissodactyla (white rhinoceros). Unexpectedly, Weddell seal CTI was predicted to be a pseudogene. Cape fur seal CTI was expressed in the mammary gland of a pregnant multiparous seal, but not in a seal in its first pregnancy. While bovine CTI is expressed for 24-48 h postpartum (pp) and secreted in colostrum only, Cape fur seal CTI was detected for at least 2-3 months pp while the mother was suckling its young on-shore. Furthermore, CTI was expressed in the mammary gland of only one of the lactating seals that was foraging at-sea. The expression of β-casein (CSN2) and β-lactoglobulin II (LGB2), but not CTI in the second lactating seal foraging at-sea suggested that CTI may be intermittently expressed during lactation. Cape fur seal and walrus CTI encode putative small, secreted, N-glycosylated proteins with a single Kunitz/bovine pancreatic trypsin inhibitor (BPTI) domain indicative of serine protease inhibition. Mature Cape fur seal CTI shares 92% sequence identity with Pacific walrus CTI, but only 35% identity with BPTI. Structural homology modelling of Cape fur seal CTI and Pacific walrus trypsin based on the model of the second Kunitz domain of human tissue factor pathway inhibitor (TFPI) and porcine trypsin (Protein Data Bank: 1TFX) confirmed that CTI inhibits trypsin in a canonical fashion. Therefore, pinniped CTI may be critical for preventing the proteolytic degradation of immunoglobulins that are passively transferred from mother to young via colostrum and milk. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Effects of soybean Kunitz trypsin inhibitor on the cotton boll weevil (Anthonomus grandis).

    Science.gov (United States)

    Franco, Octávio L; Dias, Simoni C; Magalhães, Claudio P; Monteiro, Ana C S; Bloch, Carlos; Melo, Francislete R; Oliveira-Neto, Osmundo B; Monnerat, Rose G; Grossi-de-Sá, Maria Fátima

    2004-01-01

    The cotton boll weevil, Anthonomus grandis, is an economically important pest of cotton in tropical and subtropical areas of several countries in the Americas, causing severe losses due to their damage in cotton floral buds. Enzymatic assays using gut extracts from larval and adult boll weevil have demonstrated the presence of digestive serine proteinase-like activities. Furthermore, in vitro assays showed that soybean Kunitz trypsin inhibitor (SKTI) was able to inhibit these enzymes. Previously, in vivo effects of black-eyed pea trypsin chymotrypsin inhibitor (BTCI) have been demonstrated towards the boll weevil pest. Here, when neonate larvae were reared on an artificial diet containing SKTI at three different concentrations, a reduction of larval weight of up to 64% was observed for highest SKTI concentration 500 microM. The presence of SKTI caused an increase in mortality and severe deformities of larvae, pupae and adult insects. This work therefore represents the first observation of a Kunitz trypsin inhibitor active in vivo and in vitro against A. grandis. Bioassays suggested that SKTI could be used as a tool in engineering crop plants, which might exhibit increased resistance against cotton boll weevil.

  15. Effects of tannic acid on trypsin and leucine aminopeptidase activities in gypsy moth larval midgut

    Directory of Open Access Journals (Sweden)

    Mrdaković Marija

    2013-01-01

    Full Text Available The effects of allelochemical stress on genetic variations in the specific activities of gypsy moth digestive enzymes (trypsin and leucine aminopeptidase and relative midgut mass (indirect measure of food consumption, as well as variability in their plasticity, were investigated in fifth instar gypsy moths originating from two populations with different trophic adaptations (oak and locust-tree forests. Thirty-two full-sib families from the Quercus population and twenty-six full-sib families from the Robinia population were reared on an artificial diet with or without supplementation with tannic acid. Between population differences were observed as higher average specific activity of trypsin and relative midgut mass in larvae from the Robinia population. Significant broad-sense heritabilities were observed for the specific activity of trypsin in the control state, and for specific activity of leucine aminopeptidase in a stressful environment. Significantly lower heritability for relative midgut mass was recorded in larvae from the Robinia population reared under stressful conditions. Significant variability of trypsin plasticity in larvae from both populations and significant variability of leucine aminopeptidase plasticity in larvae from the Robinia population point to the potential for the evolution of enzyme adaptive plastic responses to the presence of stressor. Non-significant across-environment genetic correlations do not represent a constraint for the evolution of enzyme plasticity. [Projekat Ministarstva nauke Republike Srbije, br. 173027

  16. 78 FR 65555 - Establishment of Class E Airspace; Salmon, ID

    Science.gov (United States)

    2013-11-01

    ...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...

  17. Columbia River basin fish and wildlife program strategy for salmon

    International Nuclear Information System (INIS)

    Ruff, J.; Fazio, J.

    1993-01-01

    Three species of Snake River salmon have been listed as threatened or endangered under the federal Endangered Species Act. In response, the Northwest Power Planning Council worked with the states of Idaho, Montana, Oregon and Washington, Indian tribes, federal agencies and interest groups to address the status of Snake River salmon runs in a forum known as the Salmon Summit. The Summit met in 1990 and 1991 and reached agreement on specific, short-term actions. When the Summit disbanded in April 1991, responsibility for developing a regional recovery plan for salmon shifted to the Council. The Council responded with a four-phased process of amending its Columbia River Basin Fish and Wildlife Program. The first three phases. completed in September 1992, pertain to salmon and steelhead. Phase four, scheduled for completion in October 1993, will take up issues of resident fish and wildlife. This paper deals with the first three phases, collectively known as Strategy for Salmon

  18. Bauhinia variegata var. variegata trypsin inhibitor: From isolation to potential medicinal applications

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Evandro Fei; Wong, Jack Ho [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Shatin, Hong Kong SAR (China); Bah, Clara Shui Fern [Department of Food Science, Division of Sciences, University of Otago (New Zealand); Lin, Peng [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Shatin, Hong Kong SAR (China); Tsao, Sai Wah [Department of Anatomy, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Sassoon Road, Pokfulam, Hong Kong SAR (China); Ng, Tzi Bun, E-mail: b021770@mailserv.cuhk.edu.hk [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Shatin, Hong Kong SAR (China)

    2010-06-11

    Here we report for the first time of a new Kunitz-type trypsin inhibitor (termed BvvTI) from seeds of the Camel's foot tree, Bauhinia variegata var. variegata. BvvTI shares the same reactive site residues (Arg, Ser) and exhibits a homology of N-terminal amino acid sequence to other Bauhinia protease inhibitors. The trypsin inhibitory activity (K{sub i}, 0.1 x 10{sup -9} M) of BvvTI ranks the highest among them. Besides anti-HIV-1 reverse transcriptase activity, BvvTI could significantly inhibit the proliferation of nasopharyngeal cancer CNE-1 cells in a selective way. This may partially be contributed by its induction of cytokines and apoptotic bodies. These results unveil potential medicinal applications of BvvTI.

  19. Bauhinia variegata var. variegata trypsin inhibitor: from isolation to potential medicinal applications.

    Science.gov (United States)

    Fang, Evandro Fei; Wong, Jack Ho; Bah, Clara Shui Fern; Lin, Peng; Tsao, Sai Wah; Ng, Tzi Bun

    2010-06-11

    Here we report for the first time of a new Kunitz-type trypsin inhibitor (termed BvvTI) from seeds of the Camel's foot tree, Bauhinia variegata var. variegata. BvvTI shares the same reactive site residues (Arg, Ser) and exhibits a homology of N-terminal amino acid sequence to other Bauhinia protease inhibitors. The trypsin inhibitory activity (K(i), 0.1 x 10(-9)M) of BvvTI ranks the highest among them. Besides anti-HIV-1 reverse transcriptase activity, BvvTI could significantly inhibit the proliferation of nasopharyngeal cancer CNE-1 cells in a selective way. This may partially be contributed by its induction of cytokines and apoptotic bodies. These results unveil potential medicinal applications of BvvTI. (c) 2010 Elsevier Inc. All rights reserved.

  20. Salmon's Laws.

    Science.gov (United States)

    Shannon, Thomas A.

    1994-01-01

    Presents Paul Salmon's old-fashioned, common-sense guidelines for success in practical school administration. The maxims advise on problem ownership; the value of selective neglect; the importance of empowerment, enthusiasm, and effective communication; and the need for positive reinforcement, cultivation of support, and good relations with media,…

  1. Historical analysis of salmon-derived polychlorinated biphenyls (PCBs) in lake sediments

    International Nuclear Information System (INIS)

    Kruemmel, Eva M.; Scheer, Michael; Gregory-Eaves, Irene; Macdonald, Robie W.; Kimpe, Lynda E.; Smol, John P.; Finney, Bruce; Blais, Jules M.

    2009-01-01

    Several recent studies have highlighted the importance of salmon as a means to deliver biomagnifying contaminants to nursery lakes. There is a lack of studies, however, which demonstrate empirically how this source has varied through time. This is of great significance because past salmon-derived contaminant loading was potentially greater than it is today. By analyzing radiometrically dated sediment cores collected from ten lakes in Alaska and British Columbia (B.C.), we relate historical numbers of sockeye salmon spawners to ΣPCB concentrations and δ 15 N values (a paleolimnological proxy for past salmon-derived nitrogen) in the sediments. The results confirm that sockeye salmon have provided an important route for PCBs to enter the lakes in the past, a finding that is especially evident when the data of all lakes are pooled. Significant relationships between sockeye salmon numbers and δ 15 N, as well as ΣPCB concentrations and δ 15 N in sediments, were also found. However, it is difficult to establish relationships between salmon numbers, ΣPCBs and δ 15 N in individual lakes. This may be due to a number of factors which may influence contaminant loadings to the lakes. The factors include: a) changing salmon contaminant loads over time resulting from a lag in the upper ocean reservoir and/or changing salmon feeding locations; b) greater importance of atmospheric transport in lakes with relatively low salmon returns; and c) increased PCB scavenging due to higher algae productivity in the lakes in recent years

  2. Historical analysis of salmon-derived polychlorinated biphenyls (PCBs) in lake sediments

    Energy Technology Data Exchange (ETDEWEB)

    Kruemmel, Eva M. [Inuit Circumpolar Council (ICC), Canada Office, 75 Albert St., Suite 1001, Ottawa, Ontario, K1P 5E7 (Canada)], E-mail: eva_kruemmel@hotmail.com; Scheer, Michael [Scheer Software Solutions, 6 Coghlan Lane, P.O. Box 86, Barry' s Bay, Ontario, K0J 1B0 (Canada); Gregory-Eaves, Irene [Department of Biology, McGill University, Montreal, Quebec, H3A 1B1 (Canada); Macdonald, Robie W. [Department of Fisheries and Oceans, Institute of Ocean Sciences, Sidney, British Columbia, V8L 4B2 (Canada); Kimpe, Lynda E. [Department of Biology, University of Ottawa, 150 Louis Pasteur, Ottawa, Ontario, K1N 6N5 (Canada); Smol, John P. [Paleoecological Environmental Assessment and Research Laboratory, Department of Biology, Queen' s University, 10 Kingston, Ontario, K7L 3N6 (Canada); Finney, Bruce [Department of Biological Sciences, Idaho State University, Pocatello, ID 83209 (United States); Blais, Jules M. [Department of Biology, University of Ottawa, 150 Louis Pasteur, Ottawa, Ontario, K1N 6N5 (Canada)

    2009-03-01

    Several recent studies have highlighted the importance of salmon as a means to deliver biomagnifying contaminants to nursery lakes. There is a lack of studies, however, which demonstrate empirically how this source has varied through time. This is of great significance because past salmon-derived contaminant loading was potentially greater than it is today. By analyzing radiometrically dated sediment cores collected from ten lakes in Alaska and British Columbia (B.C.), we relate historical numbers of sockeye salmon spawners to {sigma}PCB concentrations and {delta}{sup 15}N values (a paleolimnological proxy for past salmon-derived nitrogen) in the sediments. The results confirm that sockeye salmon have provided an important route for PCBs to enter the lakes in the past, a finding that is especially evident when the data of all lakes are pooled. Significant relationships between sockeye salmon numbers and {delta}{sup 15}N, as well as {sigma}PCB concentrations and {delta}{sup 15}N in sediments, were also found. However, it is difficult to establish relationships between salmon numbers, {sigma}PCBs and {delta}{sup 15}N in individual lakes. This may be due to a number of factors which may influence contaminant loadings to the lakes. The factors include: a) changing salmon contaminant loads over time resulting from a lag in the upper ocean reservoir and/or changing salmon feeding locations; b) greater importance of atmospheric transport in lakes with relatively low salmon returns; and c) increased PCB scavenging due to higher algae productivity in the lakes in recent years.

  3. Evaluation of the possible proteomic application of trypsin from Streptomyces griseus

    Czech Academy of Sciences Publication Activity Database

    Štosová, T.; Šebela, M.; Řehulka, Pavel; Šedo, O.; Havliš, J.; Zdráhal, Z.

    2008-01-01

    Roč. 376, č. 1 (2008), s. 94-102 ISSN 0003-2697 Institutional research plan: CEZ:AV0Z40310501 Keywords : MALDI-TOF MS * Streptomyces griseus * trypsin Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.088, year: 2008

  4. In situ localisation of major histocompatibility complex class I and class II and CD8 positive cells in infectious salmon anaemia virus (ISAV)-infected Atlantic salmon

    DEFF Research Database (Denmark)

    Hetland, Dyveke Lem; Jørgensen, Sven Martin; Skjødt, Karsten

    2010-01-01

    It is assumed that the mobilisation of a strong cellular immune response is important for the survival of Atlantic salmon infected with infectious salmon anaemia virus (ISAV). In this study, the characterisation of immune cell populations in tissues of non-ISAV infected Atlantic salmon and during...... the early viraemia of ISAV was undertaken. Immunohistochemical investigations of spleen, head kidney and gills using monoclonal antibodies against recombinant proteins from MHC I, II and CD8 were performed on tissues from Atlantic salmon collected day 17 post-challenge in a cohabitant infection model....... The localisations of MHC I and II in control salmon were consistent with previous reports but this study presents novel observations on the distribution of CD8 labelled cell populations in Atlantic salmon including the description of significant mucosal populations in the gills. The distribution of MHC I, MHC II...

  5. Engineering of Yersinia Phytases to Improve Pepsin and Trypsin Resistance and Thermostability and Application Potential in the Food and Feed Industry.

    Science.gov (United States)

    Niu, Canfang; Yang, Peilong; Luo, Huiying; Huang, Huoqing; Wang, Yaru; Yao, Bin

    2017-08-30

    Susceptibility to proteases usually limits the application of phytase. We sought to improve the pepsin and trypsin resistance of YeAPPA from Yersinia enterocolitica and YkAPPA from Y. kristensenii by optimizing amino acid polarity and charge. The predicted pepsin/trypsin cleavage sites F89/K226 in pepsin/trypsin-sensitive YeAPPA and the corresponding sites (F89/E226) in pepsin-sensitive but trypsin-resistant YkAPPA were substituted with S and H, respectively. Six variants were produced in Pichia pastoris for catalytic and biochemical characterization. F89S, E226H, and F89S/E226H elevated pepsin resistance and thermostability and K226H and F89S/K226H improved pepsin and trypsin resistance and stability at 60 °C and low pH. All the variants increased the ability of the proteins to hydrolyze phytate in corn meal by 2.6-14.9-fold in the presence of pepsin at 37 °C and low pH. This study developed a genetic manipulation strategy specific for pepsin/trypsin-sensitive phytases that can improve enzyme tolerance against proteases and heat and benefit the food and feed industry in a cost-effective way.

  6. Using grizzly bears to assess harvest-ecosystem tradeoffs in salmon fisheries.

    Science.gov (United States)

    Levi, Taal; Darimont, Chris T; Macduffee, Misty; Mangel, Marc; Paquet, Paul; Wilmers, Christopher C

    2012-01-01

    Implementation of ecosystem-based fisheries management (EBFM) requires a clear conceptual and quantitative framework for assessing how different harvest options can modify benefits to ecosystem and human beneficiaries. We address this social-ecological need for Pacific salmon fisheries, which are economically valuable but intercept much of the annual pulse of nutrient subsidies that salmon provide to terrestrial and aquatic food webs. We used grizzly bears, vectors of salmon nutrients and animals with densities strongly coupled to salmon abundance, as surrogates for "salmon ecosystem" function. Combining salmon biomass and stock-recruitment data with stable isotope analysis, we assess potential tradeoffs between fishery yields and bear population densities for six sockeye salmon stocks in Bristol Bay, Alaska, and British Columbia (BC), Canada. For the coastal stocks, we find that both bear densities and fishery yields would increase substantially if ecosystem allocations of salmon increase from currently applied lower to upper goals and beyond. This aligning of benefits comes at a potential cost, however, with the possibility of forgoing harvests in low productivity years. In contrast, we detect acute tradeoffs between bear densities and fishery yields in interior stocks within the Fraser River, BC, where biomass from other salmon species is low. There, increasing salmon allocations to ecosystems would benefit threatened bear populations at the cost of reduced long-term yields. To resolve this conflict, we propose an EBFM goal that values fisheries and bears (and by extension, the ecosystem) equally. At such targets, ecosystem benefits are unexpectedly large compared with losses in fishery yields. To explore other management options, we generate tradeoff curves that provide stock-specific accounting of the expected loss to fishers and gain to bears as more salmon escape the fishery. Our approach, modified to suit multiple scenarios, provides a generalizable method

  7. Using grizzly bears to assess harvest-ecosystem tradeoffs in salmon fisheries.

    Directory of Open Access Journals (Sweden)

    Taal Levi

    Full Text Available Implementation of ecosystem-based fisheries management (EBFM requires a clear conceptual and quantitative framework for assessing how different harvest options can modify benefits to ecosystem and human beneficiaries. We address this social-ecological need for Pacific salmon fisheries, which are economically valuable but intercept much of the annual pulse of nutrient subsidies that salmon provide to terrestrial and aquatic food webs. We used grizzly bears, vectors of salmon nutrients and animals with densities strongly coupled to salmon abundance, as surrogates for "salmon ecosystem" function. Combining salmon biomass and stock-recruitment data with stable isotope analysis, we assess potential tradeoffs between fishery yields and bear population densities for six sockeye salmon stocks in Bristol Bay, Alaska, and British Columbia (BC, Canada. For the coastal stocks, we find that both bear densities and fishery yields would increase substantially if ecosystem allocations of salmon increase from currently applied lower to upper goals and beyond. This aligning of benefits comes at a potential cost, however, with the possibility of forgoing harvests in low productivity years. In contrast, we detect acute tradeoffs between bear densities and fishery yields in interior stocks within the Fraser River, BC, where biomass from other salmon species is low. There, increasing salmon allocations to ecosystems would benefit threatened bear populations at the cost of reduced long-term yields. To resolve this conflict, we propose an EBFM goal that values fisheries and bears (and by extension, the ecosystem equally. At such targets, ecosystem benefits are unexpectedly large compared with losses in fishery yields. To explore other management options, we generate tradeoff curves that provide stock-specific accounting of the expected loss to fishers and gain to bears as more salmon escape the fishery. Our approach, modified to suit multiple scenarios, provides a

  8. Quantification of vitellogenin in Atlantic salmon (Salmo salar) plasma by radioimmunoassay

    International Nuclear Information System (INIS)

    Idler, D.R.; Hwang, S.J.; Crim, L.W.

    1979-01-01

    An antibody prepared against salmon egg yolk proteins has been used to quantify Atlantic salmon (Salmo salar) plasma vitellogenin using radioimmunoassay. A low molecular weight fraction isolated from salmon egg yolk was used for radioiodination and as standard solution because plasma vitellogenin could not be iodinated successfully. Parallelism of the egg yolk standard to displacement given by a fraction isolated from vitellogenic salmon plasma and dilutions of plasma samples allowed the assay to be used to evaluate the state of gonadal development of migrating females several months in advance of spawning and for sexing relatively immature salmon. (author)

  9. Size as indicator of origin of salmon lice Lepeophtheirus salmonis (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Nordhagen, J.R.; Heuch, P.A.; Schram, T.A.

    2000-01-01

    Salmon lice Lepeophtheirus salmonis (Krøyer, 1837) from farmed Atlantic salmon have been implicated in the drastic sea trout and salmon stock declines found in Ireland and Norway. Can salmon lice from farmed and wild fish be distinguished? The hypothesis has been advanced that the treatment of

  10. New active analogues of Cucurbita maxima trypsin inhibitor III (CMTI-III) modified in the non-contact region.

    Science.gov (United States)

    Rózycki, J; Kupryszewski, G; Rolka, K; Ragnarsson, U; Zbyryt, T; Krokoszyńska, I; Wilusz, T

    1994-01-01

    Four new analogues of trypsin inhibitor CMTI-III(3-28) = [desArg1,desVal2,desGly29]CMTI-III which was recently shown to be fully active, were synthesized by the solid-phase method. The introduction of glycine in position 9 (peptide 1) and Gly-Pro-Gly (peptide 2) and Gly-Pro-Asn (peptide 3) in the regions 17-19 and 23-25, respectively, did not change the antitrypsin activity of all modified peptides. All of these substitutions are presumed to be outside the trypsin-binding loop as judged from the X-ray structure of the complex between beta-trypsin and the related inhibitor CMTI-I. Also the fourth analogue which was substituted in all the positions mentioned, exhibited the full activity.

  11. Yolo Bypass Juvenile Salmon Utilization Study 2016—Summary of acoustically tagged juvenile salmon and study fish release, Sacramento River, California

    Science.gov (United States)

    Liedtke, Theresa L.; Hurst, William R.

    2017-09-12

    The Yolo Bypass is a flood control bypass in Sacramento Valley, California. Flood plain habitats may be used for juvenile salmon rearing, however, the potential value of such habitats can be difficult to evaluate because of the intermittent nature of inundation events. The Yolo Bypass Juvenile Salmon Utilization Study (YBUS) used acoustic telemetry to evaluate the movements and survival of juvenile salmon adjacent to and within the Yolo Bypass during the winter of 2016. This report presents numbers, size data, and release data (times, dates, and locations) for the 1,197 acoustically tagged juvenile salmon released for the YBUS from February 21 to March 18, 2016. Detailed descriptions of the surgical implantation of transmitters are also presented. These data are presented to support the collaborative, interagency analysis and reporting of the study findings.

  12. 77 FR 10772 - Fresh and Chilled Atlantic Salmon From Norway

    Science.gov (United States)

    2012-02-23

    ... and Chilled Atlantic Salmon From Norway Determination On the basis of the record \\1\\ developed in the... countervailing duty order and antidumping duty order on fresh and chilled Atlantic salmon from Norway would not... and Chilled Atlantic Salmon from Norway: Investigation Nos. 701-TA-302 and 731-TA-454 (Third Review...

  13. Bovine pancreatic trypsin inhibitor immobilized onto sepharose as a new strategy to purify a thermostable alkaline peptidase from cobia (Rachycentron canadum) processing waste.

    Science.gov (United States)

    França, Renata Cristina da Penha; Assis, Caio Rodrigo Dias; Santos, Juliana Ferreira; Torquato, Ricardo José Soares; Tanaka, Aparecida Sadae; Hirata, Izaura Yoshico; Assis, Diego Magno; Juliano, Maria Aparecida; Cavalli, Ronaldo Olivera; Carvalho, Luiz Bezerra de; Bezerra, Ranilson Souza

    2016-10-15

    A thermostable alkaline peptidase was purified from the processing waste of cobia (Rachycentron canadum) using bovine pancreatic trypsin inhibitor (BPTI) immobilized onto Sepharose. The purified enzyme had an apparent molecular mass of 24kDa by both sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and mass spectrometry. Its optimal temperature and pH were 50°C and 8.5, respectively. The enzyme was thermostable until 55°C and its activity was strongly inhibited by the classic trypsin inhibitors N-ρ-tosyl-l-lysine chloromethyl ketone (TLCK) and benzamidine. BPTI column allowed at least 15 assays without loss of efficacy. The purified enzyme was identified as a trypsin and the N-terminal amino acid sequence of this trypsin was IVGGYECTPHSQAHQVSLNSGYHFC, which was highly homologous to trypsin from cold water fish species. Using Nα-benzoyl-dl-arginine ρ-nitroanilide hydrochloride (BApNA) as substrate, the apparent km value of the purified trypsin was 0.38mM, kcat value was 3.14s(-1), and kcat/km was 8.26s(-1)mM(-1). The catalytic proficiency of the purified enzyme was 2.75×10(12)M(-1) showing higher affinity for the substrate at the transition state than other fish trypsin. The activation energy (AE) of the BApNA hydrolysis catalyzed by this enzyme was estimated to be 11.93kcalmol(-1) while the resulting rate enhancement of this reaction was found to be approximately in a range from 10(9) to 10(10)-fold evidencing its efficiency in comparison to other trypsin. This new purification strategy showed to be appropriate to obtain an alkaline peptidase from cobia processing waste with high purification degree. According with N-terminal homology and kinetic parameters, R. canadum trypsin may gathers desirable properties of psychrophilic and thermostable enzymes. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Proteolytic and Trypsin Inhibitor Activity in Germinating Jojoba Seeds (Simmondsia chinensis) 1

    Science.gov (United States)

    Samac, Deborah; Storey, Richard

    1981-01-01

    Changes in proteolytic activity (aminopeptidase, carboxypeptidase, endopeptidase) were followed during germination (imbibition through seedling development) in extracts from cotyledons of jojoba seeds (Simmondsia chinensis). After imbibition, the cotyledons contained high levels of sulfhydryl aminopeptidase activity (APA) but low levels of serine carboxypeptidase activity (CPA). CPA increased with germination through the apparent loss of a CPA inhibitor substance in the seed. Curves showing changes in endopeptidase activity (EPA) assayed at pH 4, 5, 6, 7, and 8 during germination were distinctly different. EPA at pH 4, 5, 6, and 7 showed characteristics of sulfhydryl enzymes while activity at pH 8 was probably due to a serine type enzyme. EPA at pH 6 was inhibited early in germination by one or more substances in the seed. Activities at pH 5 and later at pH 6 were the highest of all EPA throughout germination and increases in these activities were associated with a rapid loss of protein from the cotyledons of the developing seedling. Jojoba cotyledonary extracts were found to inhibit the enzymic activity of trypsin, chymotrypsin, and pepsin but not the protease from Aspergillus saotoi. The heat-labile trypsin inhibitor substance(s) was found in commercially processed jojoba seed meal and the albumin fraction of seed proteins. Trypsin inhibitor activity decreased with germination. PMID:16662104

  15. Consumption of salmon. A survey of supermarkets in China

    OpenAIRE

    Wang, Lingling

    2003-01-01

    To keep up with the recent trends in consumer demand for salmon product in supermarkets, an understanding of the relationship between consumption and variation of lifestyle is needed. The present paper seeks to address this question by hypothesizing that consumption is strongly influenced by consumers’ sociodemograhic status, experience of salmon, beliefs with salmon’s attributes and preference for the preferred type of salmon. Understanding the main lifestyle factors influe...

  16. Performance of salmon fishery portfolios across western North America

    Science.gov (United States)

    Griffiths, Jennifer R; Schindler, Daniel E; Armstrong, Jonathan B; Scheuerell, Mark D; Whited, Diane C; Clark, Robert A; Hilborn, Ray; Holt, Carrie A; Lindley, Steven T; Stanford, Jack A; Volk, Eric C

    2014-01-01

    Quantifying the variability in the delivery of ecosystem services across the landscape can be used to set appropriate management targets, evaluate resilience and target conservation efforts. Ecosystem functions and services may exhibit portfolio-type dynamics, whereby diversity within lower levels promotes stability at more aggregated levels. Portfolio theory provides a framework to characterize the relative performance among ecosystems and the processes that drive differences in performance. We assessed Pacific salmon Oncorhynchus spp. portfolio performance across their native latitudinal range focusing on the reliability of salmon returns as a metric with which to assess the function of salmon ecosystems and their services to humans. We used the Sharpe ratio (e.g. the size of the total salmon return to the portfolio relative to its variability (risk)) to evaluate the performance of Chinook and sockeye salmon portfolios across the west coast of North America. We evaluated the effects on portfolio performance from the variance of and covariance among salmon returns within each portfolio, and the association between portfolio performance and watershed attributes. We found a positive latitudinal trend in the risk-adjusted performance of Chinook and sockeye salmon portfolios that also correlated negatively with anthropogenic impact on watersheds (e.g. dams and land-use change). High-latitude Chinook salmon portfolios were on average 2·5 times more reliable, and their portfolio risk was mainly due to low variance in the individual assets. Sockeye salmon portfolios were also more reliable at higher latitudes, but sources of risk varied among the highest performing portfolios. Synthesis and applications. Portfolio theory provides a straightforward method for characterizing the resilience of salmon ecosystems and their services. Natural variability in portfolio performance among undeveloped watersheds provides a benchmark for restoration efforts. Locally and regionally

  17. Performance of salmon fishery portfolios across western North America.

    Science.gov (United States)

    Griffiths, Jennifer R; Schindler, Daniel E; Armstrong, Jonathan B; Scheuerell, Mark D; Whited, Diane C; Clark, Robert A; Hilborn, Ray; Holt, Carrie A; Lindley, Steven T; Stanford, Jack A; Volk, Eric C

    2014-12-01

    Quantifying the variability in the delivery of ecosystem services across the landscape can be used to set appropriate management targets, evaluate resilience and target conservation efforts. Ecosystem functions and services may exhibit portfolio-type dynamics, whereby diversity within lower levels promotes stability at more aggregated levels. Portfolio theory provides a framework to characterize the relative performance among ecosystems and the processes that drive differences in performance. We assessed Pacific salmon Oncorhynchus spp. portfolio performance across their native latitudinal range focusing on the reliability of salmon returns as a metric with which to assess the function of salmon ecosystems and their services to humans. We used the Sharpe ratio (e.g. the size of the total salmon return to the portfolio relative to its variability (risk)) to evaluate the performance of Chinook and sockeye salmon portfolios across the west coast of North America. We evaluated the effects on portfolio performance from the variance of and covariance among salmon returns within each portfolio, and the association between portfolio performance and watershed attributes. We found a positive latitudinal trend in the risk-adjusted performance of Chinook and sockeye salmon portfolios that also correlated negatively with anthropogenic impact on watersheds (e.g. dams and land-use change). High-latitude Chinook salmon portfolios were on average 2·5 times more reliable, and their portfolio risk was mainly due to low variance in the individual assets. Sockeye salmon portfolios were also more reliable at higher latitudes, but sources of risk varied among the highest performing portfolios. Synthesis and applications . Portfolio theory provides a straightforward method for characterizing the resilience of salmon ecosystems and their services. Natural variability in portfolio performance among undeveloped watersheds provides a benchmark for restoration efforts. Locally and regionally

  18. Evaluation of Fall Chinook and Chum Salmon Spawning below Bonneville Dam; 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    van der Naald, Wayne; Duff, Cameron; Friesen, Thomas A. (Oregon Department of Fish and Wildlife, Clackamas, OR)

    2006-02-01

    Pacific salmon Oncorhynchus spp. populations have declined over the last century due to a variety of human impacts. Chum salmon O. keta populations in the Columbia River have remained severely depressed for the past several decades, while upriver bright (URB) fall Chinook salmon O. tschawytscha populations have maintained relatively healthy levels. For the past seven years we have collected data on adult spawning and juvenile emergence and outmigration of URB fall Chinook and chum salmon populations in the Ives and Pierce islands complex below Bonneville Dam. In 2004, we estimated 1,733 fall Chinook salmon and 336 chum salmon spawned in our study area. Fall Chinook salmon spawning peaked 19 November with 337 redds and chum salmon spawning peaked 3 December with 148 redds. Biological characteristics continue to suggest chum salmon in our study area are similar to nearby stocks in Hardy and Hamilton creeks, and Chinook salmon we observe are similar to upriver bright stocks. Temperature data indicated that 2004 brood URB fall Chinook salmon emergence began on 6 January and ended 27 May 2005, with peak emergence occurring 12 March. Chum salmon emergence began 4 February and continued through 2 May 2005, with peak emergence occurring on 21 March. Between 13 January and 28 June, we sampled 28,984 juvenile Chinook salmon and 1,909 juvenile chum salmon. We also released 32,642 fin-marked and coded-wire tagged juvenile fall Chinook salmon to assess survival. The peak catch of juvenile fall Chinook salmon occurred on 18 April. Our results suggested that the majority of fall Chinook salmon outmigrate during late May and early June, at 70-80 mm fork length (FL). The peak catch of juvenile chum salmon occurred 25 March. Juvenile chum salmon appeared to outmigrate at 40-55 mm FL. Outmigration of chum salmon peaked in March but extended into April and May.

  19. Etiology of sockeye salmon 'virus' disease

    Science.gov (United States)

    Guenther, Raymond W.; Watson, S.W.; Rucker, R.R.; Ross, A.J.

    1959-01-01

    Violent epizootics among hatchery reared sockeye salmon fingerlings (Oncorhynchus nerka) caused by a filterable agent have occurred. In 1954, one source of this infectious, filterable agent was found to be adult sockeye viscera used in the diet for the fingerlings. The results of observations on an epizootic in 1958 indicate that the infection may be transmitted to fingerlings from a water supply to which adult sockeye salmon have access.

  20. Bioinsecticidal activity of a novel Kunitz trypsin inhibitor from Catanduva (Piptadenia moniliformis) seeds.

    Science.gov (United States)

    Cruz, Ana C B; Massena, Fábio S; Migliolo, Ludovico; Macedo, Leonardo L P; Monteiro, Norberto K V; Oliveira, Adeliana S; Macedo, Francisco P; Uchoa, Adriana F; Grossi de Sá, Maria F; Vasconcelos, Ilka M; Murad, Andre M; Franco, Octavio L; Santos, Elizeu A

    2013-09-01

    The present study aims to provide new in vitro and in vivo biochemical information about a novel Kunitz trypsin inhibitor purified from Piptadenia moniliformis seeds. The purification process was performed using TCA precipitation, Trypsin-Sepharose and reversed-phase C18 HPLC chromatography. The inhibitor, named PmTKI, showed an apparent molecular mass of around 19 kDa, visualized by SDS-PAGE, which was confirmed by mass spectrometry MALDI-ToF demonstrating a monoisotopic mass of 19.296 Da. The inhibitor was in vitro active against trypsin, chymotrypsin and papain. Moreover, kinetic enzymatic studies were performed aiming to understand the inhibition mode of PmTKI, which competitively inhibits the target enzyme, presenting Ki values of 1.5 × 10(-8) and 3.0 × 10(-1) M against trypsin and chymotrypsin, respectively. Also, the inhibitory activity was assayed at different pH ranges, temperatures and reduction environments (DTT). The inhibitor was stable in all conditions maintaining an 80% residual activity. N-terminal sequence was obtained by Edman degradation and the primary sequence presented identity with members of Kunitz-type inhibitors from the same subfamily. Finally after biochemical characterization the inhibitory effect was evaluated in vitro on insect digestive enzymes from different orders, PmTKI demonstrated remarkable activity against enzymes from Anthonomus grandis (90%), Plodia interpuncptella (60%), and Ceratitis capitata (70%). Furthermore, in vivo bioinsecticidal assays of C. capitata larvae were also performed and the concentration of PmTKI (w/w) in an artificial diet required to LD50 and ED50 larvae were 0.37 and 0.3% respectively. In summary, data reported here shown the biotechnological potential of PmTKI for insect pest control. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  1. Benthic monitoring of salmon farms in Norway using foraminiferal metabarcoding

    DEFF Research Database (Denmark)

    Pawlowski, Jan; Esling, Philippe; Lejzerowicz, Franck

    2016-01-01

    The rapid growth of the salmon industry necessitates the development of fast and accurate tools to assess its environmental impact. Macrobenthic monitoring is commonly used to measure the impact of organic enrichment associated with salmon farm activities. However, classical benthic monitoring can...... of macrofauna-based benthic monitoring. Here, we tested the application of foraminiferal metabarcoding to benthic monitoring of salmon farms in Norway. We analysed 140 samples of eDNA and environmental RNA (eRNA) extracted from surface sediment samples collected at 4 salmon farming sites in Norway. We sequenced...... of Foraminifera as bioindicators of organic enrichment associated with salmon farming. The foraminiferal diversity increased with the distance to fish cages, and metabarcoding provides an assessment of the ecological quality comparable to the morphological analyses. The foraminiferal metabarcoding approach...

  2. Price formation of the salmon aquaculture futures market

    DEFF Research Database (Denmark)

    Ankamah-Yeboah, Isaac; Nielsen, Max; Nielsen, Rasmus

    2017-01-01

    This study examines price formation of the internationally traded salmon futures exchange. Analyzing data from 2006 to 2015, the study identifies the co-integration relationship between the spot market price and 1–6-, 9- and 12-month futures contract prices. With exception of the 12-month maturity....... Analysis of the term structure of futures volatilities reveal that the shorter the length of the futures contract, the more volatility there is. This is because salmon prices exhibit short-term cyclical and seasonal patterns like other agricultural commodities. As such, salmon producers will be better off...

  3. Coalbed methane and salmon : assessing the risks

    International Nuclear Information System (INIS)

    Wendling, G.; Vadgama, J.; Holmes, R.

    2008-05-01

    The harmful environmental impacts from coalbed methane (CBM) development on land, water and wildlife have all been well documented based on experience in the United States and elsewhere. However, proposals to develop CBM resources in the headwaters region of northwest British Columbia raise a new issue regarding the impacts of CBM extraction on salmon. In order to begin addressing this knowledge gap and provide essential information for communities, this report presented an assessment of the risks of CBM development on salmon, with a specific focus on a tenure held by Shell Canada Limited in the Klappan region of Northwest British Columbia. The report provided a general overview of the CBM extraction process and of the environmental impacts typically associated with commercial-scale production. The Klappan Tenure location and geology were described along with the significance of its CBM reserves. The report also addressed the question of salmon presence within the tenure, drawing on existing field research to identify streams where coho, chinook and sockeye salmon have been observed. The report also contained assessments of potential risks associated with the two primary impact pathways, notably runoff and erosion effects arising from land disturbance, and stream flow and temperature effects arising from groundwater extraction. The report provided a brief overview of additional CBM-related impacts which could have indirect effects on salmon. Last, the report considered factors external to the Klappan project which could influence the nature and severity of impacts on salmon, including climate change; inadequate regulations; and cumulative impacts. It was concluded that CBM development should not occur without social license. Communities need to be empowered to decide whether or not they support CBM extraction in their area before development proceeds. 73 refs., 3 tabs., 26 figs

  4. Protecting the endangered lake salmon

    International Nuclear Information System (INIS)

    Soimakallio, H.; Oesch, P.

    1997-01-01

    In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

  5. Protecting the endangered lake salmon

    Energy Technology Data Exchange (ETDEWEB)

    Soimakallio, H.; Oesch, P. [ed.

    1997-11-01

    In addition to the Ringed Seal, the labyrinthine Saimaa lake system created after the Ice Age also trapped a species of salmon, whose entire life cycle became adapted to fresh water. In order to improve the living conditions of this lake salmon which - like the ringed seal - is today classified as an endangered species, an intensive research programme has been launched. The partners include the Finnish Game and Fisheries Research Institute, fishing and environmental authorities and - in collaboration with UPM-Kymmene Oy and Kuurnan Voima Oy - the IVO subsidiary Pamilo Oy

  6. Dual core quantum dots for highly quantitative ratiometric detection of trypsin activity in cystic fibrosis patients

    Science.gov (United States)

    Castelló Serrano, Iván; Stoica, Georgiana; Matas Adams, Alba; Palomares, Emilio

    2014-10-01

    We present herein two colour encoded silica nanospheres (2nanoSi) for the fluorescence quantitative ratiometric determination of trypsin in humans. Current detection methods for cystic fibrosis diagnosis are slow, costly and suffer from false positives. The 2nanoSi proved to be a highly sensitive, fast (minutes), and single-step approach nanosensor for the screening and diagnosis of cystic fibrosis, allowing the quantification of trypsin concentrations in a wide range relevant for clinical applications (25-350 μg L-1). Furthermore, as trypsin is directly related to the development of cystic fibrosis (CF), different human genotypes, i.e. CF homozygotic, CF heterozygotic, and unaffected, respectively, can be determined using our 2nanoSi nanospheres. We anticipate the 2nanoSi system to be a starting point for non-invasive, easy-to-use and cost effective ratiometric fluorescent biomarkers for recessive genetic diseases like human cystic fibrosis. In a screening program in which the goal is to detect disease and also the carrier status, early diagnosis could be of great help.We present herein two colour encoded silica nanospheres (2nanoSi) for the fluorescence quantitative ratiometric determination of trypsin in humans. Current detection methods for cystic fibrosis diagnosis are slow, costly and suffer from false positives. The 2nanoSi proved to be a highly sensitive, fast (minutes), and single-step approach nanosensor for the screening and diagnosis of cystic fibrosis, allowing the quantification of trypsin concentrations in a wide range relevant for clinical applications (25-350 μg L-1). Furthermore, as trypsin is directly related to the development of cystic fibrosis (CF), different human genotypes, i.e. CF homozygotic, CF heterozygotic, and unaffected, respectively, can be determined using our 2nanoSi nanospheres. We anticipate the 2nanoSi system to be a starting point for non-invasive, easy-to-use and cost effective ratiometric fluorescent biomarkers for

  7. Crystallization and preliminary X-ray diffraction studies of Murraya koenigii trypsin inhibitor

    Energy Technology Data Exchange (ETDEWEB)

    Shee, Chandan [Department of Biotechnology, Indian Institute of Technology Roorkee, Roorkee 247 667 (India); Singh, Tej P. [Department of Biophysics, All India Institute of Medical Sciences, New Delhi 100 029 (India); Kumar, Pravindra, E-mail: kumarfbs@iitr.ernet.in; Sharma, Ashwani K., E-mail: kumarfbs@iitr.ernet.in [Department of Biotechnology, Indian Institute of Technology Roorkee, Roorkee 247 667 (India)

    2007-04-01

    A Kunitz-type trypsin inhibitor purified from the seeds of Murraya koenigii has been crystallized by the sitting-drop vapour-diffusion method using PEG 8000 as the precipitating agent. A Kunitz-type trypsin inhibitor purified from the seeds of Murraya koenigii has been crystallized by the sitting-drop vapour-diffusion method using PEG 8000 as the precipitating agent. The crystals belong to the tetragonal space group P4{sub 3}2{sub 1}2, with unit-cell parameters a = b = 75.8, c = 150.9 Å. The crystals contain two molecules in the asymmetric unit with a V{sub M} value of 2.5 Å{sup 3} Da{sup −1}. Diffraction was observed to 2.65 Å resolution and a complete data set was collected to 2.9 Å resolution.

  8. Characterization of a Value-Added Salmon Product: Infant/Toddler Food

    Science.gov (United States)

    De Santos, Felicia Ann

    2009-01-01

    Salmon are rich sources of omega-3 fatty acids. These are important in the human diet and especially for young children in the first two years of life. Wild Alaskan salmon was utilized in a novel way by development and investigation of basic baby food product formulations from sockeye and pink salmon. Thus, physical and sensory properties of baby…

  9. Cold adaptation, ca2+ dependency and autolytic stability are related features in a highly active cold-adapted trypsin resistant to autoproteolysis engineered for biotechnological applications.

    Directory of Open Access Journals (Sweden)

    Alvaro Olivera-Nappa

    Full Text Available Pig trypsin is routinely used as a biotechnological tool, due to its high specificity and ability to be stored as an inactive stable zymogen. However, it is not an optimum enzyme for conditions found in wound debriding for medical uses and trypsinization processes for protein analysis and animal cell culturing, where low Ca(2+ dependency, high activity in mild conditions and easy inactivation are crucial. We isolated and thermodynamically characterized a highly active cold-adapted trypsin for medical and laboratory use that is four times more active than pig trypsin at 10(° C and at least 50% more active than pig trypsin up to 50(° C. Contrary to pig trypsin, this enzyme has a broad optimum pH between 7 and 10 and is very insensitive to Ca(2+ concentration. The enzyme is only distantly related to previously described cryophilic trypsins. We built and studied molecular structure models of this trypsin and performed molecular dynamic calculations. Key residues and structures associated with calcium dependency and cryophilicity were identified. Experiments indicated that the protein is unstable and susceptible to autoproteolysis. Correlating experimental results and structural predictions, we designed mutations to improve the resistance to autoproteolysis and conserve activity for longer periods after activation. One single mutation provided around 25 times more proteolytic stability. Due to its cryophilic nature, this trypsin is easily inactivated by mild denaturation conditions, which is ideal for controlled proteolysis processes without requiring inhibitors or dilution. We clearly show that cold adaptation, Ca(2+ dependency and autolytic stability in trypsins are related phenomena that are linked to shared structural features and evolve in a concerted fashion. Hence, both structurally and evolutionarily they cannot be interpreted and studied separately as previously done.

  10. Snake River Sockeye Salmon Habitat and Limnological Research; 2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Kohler, Andre E.; Taki, Doug (Shoshone-Bannock Tribes, Fort Hall, ID); Griswold, Robert G. (Biolines, Stanley, ID)

    2004-06-01

    In March 1990, the Shoshone-Bannock Tribes petitioned the National Marine Fisheries Service (NMFS) to list the Snake River sockeye salmon (Oncorhynchus nerka) as endangered. Snake River sockeye salmon were officially listed as endangered in November 1991 under the Endangered Species Act (56 FR 58619). In 1991, the Snake River Sockeye Salmon Habitat and Limnological Research Program was implemented (Project Number 1991-071-00). This project is part of an interagency effort to prevent the extinction of the Redfish Lake stock of sockeye salmon. The Shoshone-Bannock Tribal goal for this project is two tiered: The immediate goal is to increase the population of Snake River sockeye salmon while preserving the unique genetic characteristics of the Evolutionarily Significant Unit (ESU); The Tribe's long term goal is to maintain a viable population that warrants delisting and provides Tribal harvest opportunities. The Bonneville Power Administration (BPA) provides funding for this interagency recovery program through their Integrated Fish and Wildlife Program. Collaborators in the recovery effort include the National Oceanic and Atmospheric Administration (NOAA), the Idaho Department of Fish and Game (IDFG), the University of Idaho (UI), and the Shoshone-Bannock Tribes (SBT). This report summarizes activities conducted by Shoshone-Bannock Tribal Fisheries Department personnel during the 2004 calendar year. Project tasks include: (1) monitor limnological parameters of the Sawtooth Valley lakes to assess lake productivity; (2) conduct lake fertilization in Pettit Lake; (3) reduce the number of mature kokanee salmon spawning in Fishhook Creek; (4) monitor and enumerate sockeye salmon smolt migration from Pettit and Alturas lakes; (5) monitor spawning kokanee salmon escapement and estimate fry recruitment in Fishhook, Alturas Lake, and Stanley Lake creeks; (6) conduct sockeye salmon and kokanee salmon population surveys; (7) evaluate potential competition and predation

  11. Microbial ecology of the salmon necrobiome: evidence salmon carrion decomposition influences aquatic and terrestrial insect microbiomes.

    Science.gov (United States)

    Pechal, Jennifer L; Benbow, M Eric

    2016-05-01

    Carrion decomposition is driven by complex relationships that affect necrobiome community (i.e. all organisms and their genes associated with a dead animal) interactions, such as insect species arrival time to carrion and microbial succession. Little is understood about how microbial communities interact with invertebrates at the aquatic-terrestrial habitat interface. The first objective of the study was to characterize internal microbial communities using high-throughput sequencing of 16S rRNA gene amplicons for aquatic insects (three mayfly species) in streams with salmon carcasses compared with those in streams without salmon carcasses. The second objective was to assess the epinecrotic microbial communities of decomposing salmon carcasses (Oncorhynchus keta) compared with those of terrestrial necrophagous insects (Calliphora terraenovae larvae and adults) associated with the carcasses. There was a significant difference in the internal microbiomes of mayflies collected in salmon carcass-bearing streams and in non-carcass streams, while the developmental stage of blow flies was the governing factor in structuring necrophagous insect internal microbiota. Furthermore, the necrophagous internal microbiome was influenced by the resource on which the larvae developed, and changes in the adult microbiome varied temporally. Overall, these carrion subsidy-driven networks respond to resource pulses with bottom-up effects on consumer microbial structure, as revealed by shifting communities over space and time. © 2015 Society for Applied Microbiology and John Wiley & Sons Ltd.

  12. Process analysis and data driven optimization in the salmon industry

    DEFF Research Database (Denmark)

    Johansson, Gine Ørnholt

    Aquaculture supplies around 70% of the salmon in the World and the industry is thus an important player in meeting the increasing demand for salmon products. Such mass production calls for systems that can handle thousands of tonnes of salmon without compromising the welfare of the fish...... and the following product quality. Moreover, the requirement of increased profit performance for the industry should be met with sustainable production solutions. Optimization during the production of salmon fillets could be one feasible approach to increase the outcome from the same level of incoming raw material...... and analysis of data from the salmon industry could be utilized to extract information that will support the industry in their decision-making processes. Mapping of quality parameters, their fluctuations and influences on yield and texture has been investigated. Additionally, the ability to predict the texture...

  13. Bombesin-stimulated serum immunoreactive trypsin in the different diagnosis between endocrine and exocrine tumors of the pancreas

    International Nuclear Information System (INIS)

    Bonora, G.; De Giorgio, R.; Toni, R.; Fanti, M.P.; Cariani, G.; Vezzadini, P.

    1987-01-01

    Bombesin administration was recently found to induce a marked increase in circulating immunoreactive trypsin (IRT), whose magnitude seems to reflect the functional capacity of pancreatic acinar cell mass. The purpose of the present study was to assess the effect of bombesin infusion on serum IRT concentration in patients with endocrine or exocrine tumors of the pancreas. Fifteen patients with pancreatic endocrine tumor, 17 patients with pancreatic exocrine carcinoma and 15 healty subjects were investigated. Serum IRT was measured by radioimmunoassay before and for 120 minutes after the start of bombesin infusion (9 ng/kg/min over 30 min). The integrated serum IRT response to bombesin administration in patients with endocrine tumor of the pancreas did not differ significantly from controls, but were significantly higher than in patients with exocrine carcinoma. In the latter the integrated IRT responses to bombesin infusion in patients with endocrine tumor can probably be explained by small tumor size and/or little invasion of the glandular parenchyma, resulting in an undetectable impairment of exocrine pancreatic function. The very low IRT responses in patients with exocrine carcinoma could reflect the presence of severe pancreatic damage. The results suggest that this newly proposed bombesin test may be useful in the preoperative differential diagnosis between endocrine and exocrine tumors of the pancreas

  14. Survival of juvenile chinook salmon and coho salmon in the Roza Dam fish bypass and in downstream reaches of the Yakima River, Washington, 2016

    Science.gov (United States)

    Kock, Tobias J.; Perry, Russell W.; Hansen, Amy C.

    2016-12-22

    Estimates of juvenile salmon survival are important data for fishery managers in the Yakima River Basin. Radiotelemetry studies during 2012–14 showed that tagged juvenile Chinook salmon (Oncorhynchus tshawytscha) that passed through the fish bypass at Roza Dam had lower survival than fish that passed through other routes at the dam. That study also identified flow-survival relationships in the reaches between the Roza Dam tailrace and Sunnyside Dam. During 2012–14, survival also was estimated through reaches downstream of Sunnyside Dam, but generally, sample sizes were low and the estimates were imprecise. In 2016, we conducted an evaluation using acoustic cameras and acoustic telemetry to build on information collected during the previous study. The goal of the 2016 research was to identify areas where mortality occurs in the fish bypass at Roza Dam, and to estimate reach-specific survival in reaches downstream of the dam. The 2016 study included juvenile Chinook salmon and coho salmon (O. kisutch).Three acoustic cameras were used to observe fish behavior (1) near the entrances to the fish bypass, (2) at a midway point in the fish bypass (convergence vault), and (3) at the bypass outfall. In total, 504 hours of acoustic camera footage was collected at these locations. We determined that smolt-sized fish (95–170 millimeters [mm]) were present in the highest proportions at each location, but predator-sized fish (greater than 250 mm) also were present at each site. Fish presence generally peaked during nighttime hours and crepuscular periods, and was low during daytime hours. In the convergence vault, smolt-sized fish exhibited holding behavior patterns, which may explain why some fish delayed while passing through the bypass.Some of the acoustic-tagged fish were delayed in the fish bypass following release, but there was no evidence to suggest that they experienced higher mortality than fish that were released at the bypass outfall or downstream of the dam

  15. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    Science.gov (United States)

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  16. Norwegian salmon goes to market: The case of the Austevoll seafood cluster

    DEFF Research Database (Denmark)

    Hovgaard, Gestur

    2006-01-01

    This paper examines the impact of the globalisation of the farmed salmon comodity chain upon farmed salmon production in the western Norwegian municipality of Austevoll. On the basis of field research conducted in 2002 and 2003, we conclude that salmon farming in Austevoll has responded to the ch......This paper examines the impact of the globalisation of the farmed salmon comodity chain upon farmed salmon production in the western Norwegian municipality of Austevoll. On the basis of field research conducted in 2002 and 2003, we conclude that salmon farming in Austevoll has responded...... to the challenges of 'buyer-driven' food chains by virtue of its history as a seafood cluster. Despite this era of 'homogenised globalisation'. Nevertheless, recent changes in the global farmed salmon supply chain may result in the imposition of vertical relations in the Austevoll cluster. We conclude...... with suggestions for incorporating the literatues on global food chains and industrial clusters in the study of seafood production and global markets....

  17. Passage survival of juvenile steelhead, coho salmon, and Chinook salmon in Lake Scanewa and at Cowlitz Falls Dam, Cowlitz River, Washington, 2010–16

    Science.gov (United States)

    Liedtke, Theresa L.; Kock, Tobias J.; Hurst, William

    2018-04-03

    A multi-year evaluation was conducted during 2010–16 to evaluate passage survival of juvenile steelhead (Oncorhynchus mykiss), Chinook salmon (O. tshawytscha), and coho salmon (O. kisutch) in Lake Scanewa, and at Cowlitz Falls Dam in the upper Cowlitz River Basin, Washington. Reservoir passage survival was evaluated in 2010, 2011, and 2016, and included the tagging and release of 1,127 juvenile salmonids. Tagged fish were released directly into the Cowlitz and Cispus Rivers, 22.3 and 8.9 km, respectively, upstream of the reservoir, and were monitored as they moved downstream into, and through the reservoir. A single release-recapture survival model was used to analyze detection records and estimate reservoir passage survival, which was defined as successful passage from reservoir entry to arrival at Cowlitz Falls Dam. Tagged fish generally moved quickly downstream of the release sites and, on average, arrived in the dam forebay within 2 d of release. Median travel time from release to first detection at the dam ranged from 0.23 to 0.96 d for juvenile steelhead, from 0.15 to 1.11 d for juvenile coho salmon, and from 0.18 to 1.89 d for juvenile Chinook salmon. Minimum reservoir passage survival probabilities were 0.960 for steelhead, 0.855 for coho salmon and 0.900 for Chinook salmon.Dam passage survival was evaluated at the pilot-study level during 2013–16 and included the tagging and release of 2,512 juvenile salmonids. Juvenile Chinook salmon were evaluated during 2013–14, and juvenile steelhead and coho salmon were evaluated during 2015–16. A paired-release study design was used that included release sites located upstream and downstream of Cowlitz Falls Dam. The downstream release site was positioned at the downstream margin of the dam’s tailrace, which allowed dam passage survival to be measured in a manner that included mortality that occurred in the passage route and in the dam tailrace. More than one-half of the tagged Chinook salmon (52 percent

  18. Research on Captive Broodstock Technology for Pacific Salmon, 1995 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Swanson, Penny; Pascho, Ronald; Hershberger, William K. (Northwest and Alaska Fisheries Center, Coastal Zone and Estuarine Studies Division, Seattle, WA)

    1996-01-01

    This report summarizes research on captive broodstock technologies conducted during 1995 under Bonneville Power Administration Project 93-56. Investigations were conducted by the National Marine Fisheries Service (NMFS) in cooperation with the US Fish and Wildlife Service, University of Washington, and Northwest Biological Science Center (US Geological Survey). Studies encompassed several categories of research, including fish husbandry, reproductive physiology, immunology, pathology, nutrition, and genetics. Captive broodstock programs are being developed and implemented to aid recovery of endangered Pacific salmon stocks. Like salmon hatchery programs, however, captive broodstock programs are not without problems and risks to natural salmon populations. The research projects described in this report were developed in part based on a literature review, Assessment of the Status of Captive Broodstock Technology for Pacific Salmon. The work was divided into three major research areas: (1) research on sockeye salmon; (2) research on spring chinook salmon; and (3) research on quantitative genetic problems associated with captive broodstock programs. Investigations of nutrition, reproductive physiology, fish husbandry, and fish health were integrated into the research on sockeye and spring chinook salmon. A description of each investigation and its major findings and conclusions is presented.

  19. SALMON AND THE ENDANGERED SPECIES ACT: TROUBLESOME QUESTIONS

    Science.gov (United States)

    Throughout the Pacific Northwest and California, all wild salmon runs have declined since 1850 and some have disappeared. A sustainable future for wild salmon remains elusive. In response to requirements of the U.S. Endangered Species Act, the Canadian Species at Risk Act, and ...

  20. Adaptive strategies and life history characteristics in a warming climate: salmon in the Arctic?

    Science.gov (United States)

    Nielsen, Jennifer L.; Ruggerone, Gregory T.; Zimmerman, Christian E.

    2013-01-01

    In the warming Arctic, aquatic habitats are in flux and salmon are exploring their options. Adult Pacific salmon, including sockeye (Oncorhynchus nerka), coho (O. kisutch), Chinook (O. tshawytscha), pink (O. gorbuscha) and chum (O. keta) have been captured throughout the Arctic. Pink and chum salmon are the most common species found in the Arctic today. These species are less dependent on freshwater habitats as juveniles and grow quickly in marine habitats. Putative spawning populations are rare in the North American Arctic and limited to pink salmon in drainages north of Point Hope, Alaska, chum salmon spawning rivers draining to the northwestern Beaufort Sea, and small populations of chum and pink salmon in Canada’s Mackenzie River. Pacific salmon have colonized several large river basins draining to the Kara, Laptev and East Siberian seas in the Russian Arctic. These populations probably developed from hatchery supplementation efforts in the 1960’s. Hundreds of populations of Arctic Atlantic salmon (Salmo salar) are found in Russia, Norway and Finland. Atlantic salmon have extended their range eastward as far as the Kara Sea in central Russian. A small native population of Atlantic salmon is found in Canada’s Ungava Bay. The northern tip of Quebec seems to be an Atlantic salmon migration barrier for other North American stocks. Compatibility between life history requirements and ecological conditions are prerequisite for salmon colonizing Arctic habitats. Broad-scale predictive models of climate change in the Arctic give little information about feedback processes contributing to local conditions, especially in freshwater systems. This paper reviews the recent history of salmon in the Arctic and explores various patterns of climate change that may influence range expansions and future sustainability of salmon in Arctic habitats. A summary of the research needs that will allow informed expectation of further Arctic colonization by salmon is given.

  1. 78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID

    Science.gov (United States)

    2013-07-29

    ...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...

  2. Efficiency of inactivation of trypsin inhibitory activity in some selected ...

    African Journals Online (AJOL)

    Trypsin inhibitor (TI) levels in the crop seeds varied between 0.0 in Adansonia digitata and 40.8 TIU/mg in Pterocarpus osun. Efficiency of inactivation of TI by autoclaving ranged from 58.1% in Millettia thonningii to 100% in Sesbania pachycarpa and Lonchocarpus. sericeus. It is concluded that the effect of heat treatment on ...

  3. Seasonal marine growth of Bristol Bay sockeye salmon (Oncorhynchus nerka) in relation to competition with Asian pink salmon (O. gorbuscho) and the 1977 ocean regime shift

    Science.gov (United States)

    Ruggerone, Gregory T.; Farley, Ed; Nielsen, Jennifer L.; Hagen, Peter

    2005-01-01

    Recent research demonstrated significantly lower growth and survival of Bristol Bay sockeye salmon (Oncorhynchus nerka) during odd-numbered years of their second or third years at sea (1975, 1977, etc.), a trend that was opposite that of Asian pink salmon (O. gorbuscha) abundance. Here we evaluated seasonal growth trends of Kvichak and Egegik river sockeye salmon (Bristol Bay stocks) during even- and odd-numbered years at sea by measuring scale circuli increments within each growth zone of each major salmon age group between 1955 and 2000. First year scale growth was not significantly different between odd- and even-numbered years, but peak growth of age-2. smolts was significantly higher than age-1 smolts. Total second and third year scale growth of salmon was significantly lower during odd- than during even-numbered years. However, reduced scale growth in odd-numbered years began after peak growth in spring and continued through summer and fall even though most pink salmon had left the high seas by late July (10-18% growth reduction in odd vs. even years). The alternating odd and even year growth pattern was consistent before and after the 1977 ocean regime shift. During 1977-2000, when salmon abundance was relatively great, sockeye salmon growth was high during specific seasons compared with that during 1955-1976, that is to say, immediately after entry to Bristol Bay, after peak growth in the first year, during the middle of the second growing season, and during spring of the third season. Growth after the spring peak in the third year at sea was relatively low during 1977-2000. We hypothesize that high consumption rates of prey by pink salmon during spring through mid-July of odd-numbered years, coupled with declining zooplankton biomass during summer and potentially cyclic abundances of squid and other prey, contributed to reduced prey availability and therefore reduced growth of Bristol Bay sockeye salmon during late spring through fall of odd-numbered years.

  4. The Salmon Smai Family of Short Interspersed Repetitive Elements (Sines): Interspecific and Intraspecific Variation of the Insertion of Sines in the Genomes of Chum and Pink Salmon

    OpenAIRE

    Takasaki, N.; Yamaki, T.; Hamada, M.; Park, L.; Okada, N.

    1997-01-01

    The genomes of chum salmon and pink salmon contain a family of short interspersed repetitive elements (SINEs), designated the salmon SmaI family. It is restricted to these two species, a distribution that suggests that this SINE family might have been generated in their common ancestor. When insertions of the SmaI SINEs at 10 orthologous loci of these species were analyzed, however, it was found that there were no shared insertion sites between chum and pink salmon. Furthermore, at six loci w...

  5. The quality of cold smoked salmon

    DEFF Research Database (Denmark)

    Løje, Hanne

    2007-01-01

    The objective of this Ph. D. thesis was to study the liquid holding capacity/liquid loss of raw and smoked salmonids as affected by raw material and chill storage of the cold smoked product. The liquid holding capacity is an important quality parameter for cold smoked salmon. This study has shown...... that the liquid holding capacity in raw and cold smoked salmon is influenced by several factors. The size of the fish affected the liquid holding capacity as large fish had lower liquid holding capacity than smaller fish. The salt content influenced the liquid holding capacity in smoked fish as it was found...... capacity in raw salmon, as high lipid content gave lower liquid holding capacity. Thus, the lipid content is an important parameter regarding the liquid holding capacity as it can influence the liquid holding capacity directly or indirectly by affecting other factors e.g. the salt content which influences...

  6. Preparation and characterization of magnetic levan particles as matrix for trypsin immobilization

    Energy Technology Data Exchange (ETDEWEB)

    Maciel, J.C. [Programa de Pos-Graduacao em Ciencias Biologicas, Universidade Federal de Pernambuco, Cidade Universitaria, 50670-901 Recife, PE (Brazil); Andrad, P.L. [Programa de Pos-Graduacao em Ciencia de Materiais, Universidade Federal de Pernambuco, Cidade Universitaria, 50679-901 Recife, PE (Brazil); Neri, D.F.M., E-mail: davidfmneri@yahoo.com.br [Universidade Federal do Vale do Sao Francisco, 56304-205 Petrolina, PE (Brazil); Carvalho, L.B. [Departamento de Bioquimica, Universidade Federal de Pernambuco, Cidade Universitaria, 50679-901 Recife, PE (Brazil); Cardoso, C.A. [Departamento de Fisica, Universidade Federal de Sao Carlos, 13565-905 Sao Carlos, PE (Brazil); Calazans, G.M.T. [Departamento de Antibioticos, Universidade Federal de Pernambuco, Cidade Universitaria, 50670-901 Recife, PE (Brazil); Albino Aguiar, J. [Departamento de Fisica, Universidade Federal de Pernambuco, Cidade Universitaria, 50679-901 Recife, PE (Brazil); Silva, M.P.C. [Departamento de Bioquimica, Universidade Federal de Pernambuco, Cidade Universitaria, 50679-901 Recife, PE (Brazil)

    2012-04-15

    Magnetic levan was synthesized by co-precipitating D-fructofuranosyl homopolysaccharide with a solution containing Fe{sup 2+} and Fe{sup 3+} in alkaline conditions at 100 Degree-Sign C. The magnetic levan particles were characterized by scanning electron microscopy (SEM), magnetization measurements, X-ray diffractometry (XRD) and infrared spectroscopy (IR). Afterwards, magnetic levan particles were functionalized by NaIO{sub 4} oxidation and used as matrices for trypsin covalent immobilization. Magnetite and magnetic levan particles were both heterogeneous in shape and levan-magnetite presented bigger sizes compared to magnetite according to SEM images. Magnetic levan particles exhibited a magnetization 10 times lower as compared to magnetite ones, probably, due to the coating layer. XRD diffractogram showed that magnetite is the dominant phase in the magnetic levan. Infrared spectroscopy showed characteristics absorption bands of levan and magnetite (O-H, C-O-C and Fe-O bonds). The immobilized trypsin derivative was reused 10 times and lost 16% of its initial specific activity only. Therefore, these magnetic levan particles can be proposed as an alternative matrices for enzyme immobilization. - Highlights: Black-Right-Pointing-Pointer The magnetic levan particles presented larger size variation than magnetite particles due to the changes produced by coating. Black-Right-Pointing-Pointer The utilization of magnetic levan particles showed to be efficacious for immobilization of enzymes as trypsin. Black-Right-Pointing-Pointer Magnetic particles can be planned as other matrix for immobilization of biomolecule in various division processes in biotechnology.

  7. Cessation of a salmon decline with control of parasites

    KAUST Repository

    Peacock, Stephanie J.; Krkošek, Martin; Proboszcz, Stan; Orr, Craig; Lewis, Mark A.

    2013-01-01

    (Oncorhynchus gorbuscha) from Pacific Canada indicates that adaptive changes in parasite management on salmon farms have yielded positive conservation outcomes. After four years of sea lice epizootics and wild salmon population decline, parasiticide application

  8. Radio telemetry data - Characterizing migration and survival for juvenile Snake River sockeye salmon between the upper Salmon River basin and Lower Granite Dam

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project estimates survival and characterizes the migration of juvenile sockeye salmon between the upper Salmon River basin in central Idaho and Lower Granite...

  9. A capillary monolithic trypsin reactor for efficient protein digestion in online and offline coupling to ESI and MALDI mass spectrometry.

    Science.gov (United States)

    Spross, Jens; Sinz, Andrea

    2010-02-15

    We describe the preparation of a capillary trypsin immobilized monolithic enzyme reactor (IMER) for a rapid and efficient digestion of proteins down to the femtomole level. Trypsin was immobilized on a poly(glycidyl methacrylate-co-acrylamide-co-ethylene glycol dimethycrylate) monolith using the glutaraldehyde technique. Digestion efficiencies of the IMER were evaluated using model proteins and protein mixtures as well as chemically cross-linked lysozyme regarding the addition of denaturants and increasing digestion temperature. The trypsin IMER described herein is applicable for the digestion of protein mixtures. Even at a 1000-fold molar excess of one protein, low-abundance proteins are readily identified, in combination with MS/MS analysis. An online setup of the IMER with reversed phase nano-HPLC separation and nano-ESI-MS/MS analysis was established. The great potential of the trypsin IMER for proteomics applications comprise short digestion times in the range of seconds to minutes, in addition to improved digestion efficiencies, compared to in-solution digestion.

  10. The Influence of Salmon Recolonization on Riparian Communities in the Cedar River, Washington, USA

    Science.gov (United States)

    Moravek, J.; Clipp, H.; Kiffney, P.

    2016-02-01

    Salmon are a valuable resource throughout the Pacific Northwest, but increasing human activity is degrading coastal ecosystems and threatening local salmon populations. Salmon conservation efforts often focus on habitat restoration, including the re-colonization of salmon into historically obstructed areas such as the Cedar River in Washington, USA. However, to assess the long term implications of salmon re-colonization on a landscape scale, it is critical to consider not only the river ecosystem but also the surrounding riparian habitat. Although prior studies suggest that salmon alter riparian food web dynamics, the riparian community on the Cedar River has not yet been characterized. To investigate possible connections between salmon and the riparian habitat after 12 years of re-colonization, we surveyed riparian spider communities along a gradient of salmon inputs (g/m2). In 10-m transects along the banks of the river, we identified spiders and spider webs, collected prey from webs, and characterized nearby aquatic macroinvertebrate communities. We found that the density of aquatic macroinvertebrates, as well as the density of spider prey, both had significant positive relationships with salmon inputs, supporting the hypothesis that salmon provide energy and nutrients for both aquatic and riparian food webs. We also found that spider diversity significantly decreased with salmon inputs, potentially due to confounding factors such as stream gradient or vegetation structure. Although additional information is needed to fully understand this relationship, the significant connection between salmon inputs and spider diversity is compelling motivation for further studies regarding the link between aquatic and riparian systems on the Cedar River. Understanding the connections between salmon and the riparian community is critical to characterizing the long term, landscape-scale implications of sustainable salmon management in the Pacific Northwest.

  11. Atlantic Salmon Telemetry Monitoring

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Annual telemetry data are collected as part of specific projects (assessments within watersheds) or as opportunistic efforts to characterize Atlantic salmon smolt...

  12. Atlantic Salmon Smolt Monitoring

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Annual data are collected as part of smolt trapping operations using fish trapping methods. Traps collect emigrating salmon smolts to identify cohort...

  13. Salmon River Habitat Enhancement. 1990 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, Mike

    1991-12-01

    The annual report contains three individual subproject sections detailing tribal fisheries work completed during the summer and fall of 1990. Subproject I contains summaries of evaluation/monitoring efforts associated with the Bear Valley Creek, Idaho enhancement project. Subproject II contains an evaluation of the Yankee Fork of the Salmon River habitat enhancement project. Subproject III concerns the East Fork of the Salmon River, Idaho.

  14. Quantification of fatty acids in salmon fillets conserved by different methods

    Directory of Open Access Journals (Sweden)

    Renata Menoci Gonçalves

    2017-09-01

    Full Text Available Lipid contents and the composition of fatty acids of fillets from Chilean salmon (Salmo salar were determined under different conservation methods: fresh salmon, frozen salmon, water-conserved canned salmon and frozen salmon in long-term storage. Fatty acid contents were determined by gas chromatography. The fillets had high lipid levels, ranging between 9.71 and 12.86%. All samples presented high levels of monounsaturated fatty acids, between 363.69 and 425.30 mg g-1 of total lipids, followed by polyunsaturated fatty acids (294.46 - 342.45 mg g-1 of total lipids and saturated fatty acids (203.32 - 223.17 mg g-1 of total lipids. Although samples revealed different lipid contents, all proved to be great sources of omega-3 fatty acids, regardless of the manner of conservation.

  15. Trypsin as enhancement in cyclical tracheal decellularization: Morphological and biophysical characterization

    Energy Technology Data Exchange (ETDEWEB)

    Giraldo-Gomez, D.M., E-mail: davidmauro2008@gmail.com [Posgrado en Ciencia e Ingeniería de Materiales, Universidad Nacional Autónoma de México (UNAM), Unidad de Posgrado Edificio “C” 1er Piso, Circuito de Posgrados, Avenida Universidad 3000, Ciudad Universitaria, Coyoacán, C.P. 04510, México D. F., México (Mexico); Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México (UNAM), Circuito Exterior, Avenida Universidad 3000, Ciudad Universitaria, Coyoacán, C.P. 04510, México D.F., México (Mexico); Leon-Mancilla, B. [Departamento de Cirugía, Facultad de Medicina, Universidad Nacional Autónoma de México (UNAM), Edificio “D” Planta Baja, Circuito Interior, Avenida Universidad 3000, Ciudad Universitaria, Coyoacán, C.P. 04510, México D.F., México (Mexico); Del Prado-Audelo, M.L. [Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México (UNAM), Circuito Exterior, Avenida Universidad 3000, Ciudad Universitaria, Coyoacán, C.P. 04510, México D.F., México (Mexico); and others

    2016-02-01

    There are different types of tracheal disorders (e.g. cancer, stenosis and fractures). These can cause respiratory failure and lead to death of patients. Several attempts have been made for trachea replacement in order to restore the airway, including anastomosis and implants made from synthetic or natural materials. Tracheal allotransplantation has shown high rejection rates, and decellularization has emerged as a possible solution. Decellularization involves the removal of antigens from cells in the organ or tissue, leaving a matrix that can be used as 3D cell-scaffold. Although this process has been used for tracheal replacement, it usually takes at least two months and time is critical for patients with tracheal disorders. Therefore, there is necessary to develop a tracheal replacement process, which is not only effective, but also quick to prepare. The aim of this research was to develop a faster trachea decellularization protocol using Trypsin enzyme and Ethylenediaminetetraacetic acid (EDTA) as decellularization agents. Three protocols of cyclic trachea decellularization (Protocols A, B, and C) were compared. Following Protocol A (previously described in the literature), 15 consecutive cycles were performed over 32 days. Protocol B (a variation of Protocol A) — EDTA being added — with 15 consecutive cycles performed over 60 days. Finally, Protocol C, with the addition of Trypsin as a decellularization agent, 5 consecutive cycles being performed over 10 days. For the three protocols, hematoxylin–eosin (H&E) staining and DNA residual content quantification were performed to establish the effectiveness of the decellularization process. Scanning Electron Microscopy (SEM) was used to observe the changes in porosity and microarrays. To evaluate the structural matrices integrity, Thermogravimetric Analysis (TGA) and biomechanical test were used. None of the protocols showed significant alteration or degradation in the components of the extracellular matrix

  16. Why are not there more Atlantic salmon (Salmo salar)

    Energy Technology Data Exchange (ETDEWEB)

    Parrish, D. L. [Vermont Univ., School of Natural Resources, Vermont Cooperative Fish and Wildlife Research Unit, Burlington, VT (United States); Behnke, R. J. [Colorado State Univ., Dept. of Fishery and Wildlife Biology, Fort Collins, CO (United States); Gephard, S. R. [Connecticut Dept. of Environmnetal Protection, Fisheries Div., Old Lyme, CT (United States); McCormick, S. D. [Anadromous Fish Research Center, USGS/Biological Resources Div., Turners Falls, MA (United States); Reeves, G. H. [USDA Forest Service, Corvallis, OR (United States)

    1998-12-31

    The causes of decline and extirpation of salmon on a global scale are investigated. In some cases single factors such as dams, pollution and dewatering, increased density of humans near salmon rivers, overfishing, changes in ocean conditions or intensive aquaculture could be identified as likely causes. The available evidence is not sufficient to link cause and effect for most declines because they are the result of multiple factors, and data that would help to discriminate factors on scales of space or time are lacking. For this reason, it is not possible to allocate the proportional impact of multiple factors that contribute to the the demise of salmon populations. More rigorous methodologies, including more effective sampling techniques, testing of multiple effects integrated across space and time, and adaptive management are needed to account for the continuing decline of salmon.

  17. The influence of fall-spawning coho salmon (Oncorhynchus kisutch) on growth and production of juvenile coho salmon rearing in beaver ponds on the Copper River Delta, Alaska.

    Science.gov (United States)

    Dirk W. Lang; Gordon H. Reeves; James D. Hall; Mark S. Wipfli

    2006-01-01

    This study examined the influence of fall-spawning coho salmon (Oncorhynchrcs kisutch) on the density, growth rate, body condition, and survival to outmigration of juvenile coho salmon on the Copper River Delta, Alaska, USA. During the fall of 1999 and 2000, fish rearing in beaver ponds that received spawning salmon were compared with fish from...

  18. Response of ecosystem metabolism to low densities of spawning Chinook salmon

    Science.gov (United States)

    Benjamin, Joseph R.; Bellmore, J. Ryan; Watson, Grace A.

    2016-01-01

    Marine derived nutrients delivered by large runs of returning salmon are thought to subsidize the in situ food resources that support juvenile salmon. In the Pacific Northwest, USA, salmon have declined to runs. We explored whether low densities (how recipient ecosystems respond to low levels of marine derived nutrients may inform nutrient augmentation studies aimed at enhancing fish populations.

  19. Environmental variability and chum salmon production at the northwestern Pacific Ocean

    Science.gov (United States)

    Kim, Suam; Kang, Sukyung; Kim, Ju Kyoung; Bang, Minkyoung

    2017-12-01

    Chum salmon, Oncorhynchus keta, are distributed widely in the North Pacific Ocean, and about 76% of chum salmon were caught from Russian, Japanese, and Korean waters of the northwestern Pacific Ocean during the last 20 years. Although it has been speculated that the recent increase in salmon production was aided by not only the enhancement program that targeted chum salmon but also by favorable ocean conditions since the early 1990s, the ecological processes for determining the yield of salmon have not been clearly delineated. To investigate the relationship between yield and the controlling factors for ocean survival of chum salmon, a time-series of climate indices, seawater temperature, and prey availability in the northwestern Pacific including Korean waters were analyzed using some statistical tools. The results of cross-correlation function (CCF) analysis and cumulative sum (CuSum) of anomalies indicated that there were significant environmental changes in the North Pacific during the last century, and each regional stock of chum salmon responded to the Pacific Decadal Oscillation (PDO) differently: for Russian stock, the correlations between PDO index and catch were significantly negative with a time-lag of 0 and 1 years; for Japanese stock, significantly positive with a timelag of 0-2 years; and for Korean stock, positive but no significant correlation. The results of statistical analyses with Korean chum salmon also revealed that a coastal seawater temperature over 14°C and the return rate of spawning adults to the natal river produced a significant negative correlation.

  20. Snake River Sockeye Salmon Habitat and Limnological Research : 2008 Annual Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Kohler, Andre E. [Shoshone-Bannock Tribes; Griswold, Robert G. [Biolines Environmental Consulting; Taki, Doug [Shoshone-Bannock Tribes

    2009-07-31

    In March 1990, the Shoshone-Bannock Tribes petitioned the National Marine Fisheries Service (NMFS) to list Snake River sockeye salmon (Oncorhynchus nerka) as endangered. Snake River sockeye salmon were officially listed as endangered in November 1991 under the Endangered Species Act (56 FR 58619). In 1991, the Snake River Sockeye Salmon Habitat and Limnological Research Project was implemented. This project is part of an interagency effort to prevent the extinction of the Redfish Lake stock of Snake River sockeye salmon. The Shoshone-Bannock Tribal goal for this project is two tiered: the immediate goal is to increase the population of Snake River sockeye salmon while preserving the unique genetic characteristics of the evolutionarily significant unit (ESU). The Tribes long term goal is to maintain a viable population that warrants delisting and provides Tribal harvest opportunities. The Bonneville Power Administration (BPA) provides funding for this interagency Recovery effort. Collaborators in the recovery effort include the National Oceanic and Atmospheric Administration (NOAA), the Idaho Department of Fish and Game (IDFG), the University of Idaho (UI), and the Shoshone-Bannock Tribes (SBT). This report summarizes activities conducted by Shoshone-Bannock Tribal Fisheries Department personnel during the 2008 calendar year. Project tasks include: (1) monitor limnological parameters of the Sawtooth Valley lakes to assess lake productivity; (2) conduct lake fertilization in Pettit and Alturas lakes; (3) reduce the number of mature kokanee salmon spawning in Alturas Lake Creek; (4) monitor, enumerate, and evaluate sockeye salmon smolt migration from Pettit and Alturas lakes; (5) monitor spawning kokanee salmon escapement and estimate fry recruitment in Fishhook and Alturas Lake creeks; (6) conduct sockeye and kokanee salmon population surveys; (7) evaluate potential competition and predation between stocked juvenile sockeye salmon and a variety of fish species in

  1. Purification, crystallization and X-ray characterization of a Kunitz-type trypsin inhibitor protein from the seeds of chickpea (Cicer arietinum)

    International Nuclear Information System (INIS)

    Sharma, Urvashi; Suresh, C. G.

    2011-01-01

    The purification, characterization and crystallization of a trypsin inhibitor protein isolated from chickpea seeds are reported. A Kunitz-type trypsin inhibitor protein (CPTI) purified from chickpea seeds was estimated to have a molecular mass of 18 kDa on SDS–PAGE. The IC 50 value of CPTI was determined to be 2.5 µg against trypsin. The inhibitory activity of CPTI is 114 TIU (trypsin inhibitory units) per milligram of protein, which is high compared with those of other known Kunitz-type trypsin inhibitors from legumes. CPTI crystallized in three different orthorhombic crystal forms: P2 1 2 1 2 form A, P2 1 2 1 2 form B and P2 1 2 1 2 1 . The crystals of P2 1 2 1 2 form A, with unit-cell parameters a = 37.2, b = 41.2, c = 104.6 Å, diffracted to 2.0 Å resolution at the home source and to 1.4 Å on beamline BM14 at the ESRF. Data were also collected from crystals grown in the presence of iodine. The Matthews coefficient for these crystals was calculated to be 2.37 Å 3 Da −1 , corresponding to a solvent content of 42%. The other two crystal forms (P2 1 2 1 2 form B and P2 1 2 1 2 1 ) diffracted comparatively poorly

  2. Linking individual migratory behaviour of Atlantic salmon to their genetic origin

    DEFF Research Database (Denmark)

    Jepsen, Niels; Eg Nielsen, Einar; Deacon, M.

    2005-01-01

    (Salmo salar) in a Danish lowland river. The river has a small population of native salmon, but salmon juveniles from Irish, Scottish and Swedish populations have been stocked and return as adults. A total of 39 salmon were caught by electrofishing and tagged by surgical implantation. A tissue sample......Many stocks of fish consist of mixtures of individuals originating from different populations. This is particularly true for many salmon and trout stocks, where fish of different genetic background are being found in the same rivers and/or lakes due to stocking activities or straying caused...... by increased aquaculture activities. The interpretation of results from studies of survival and behaviour of fish from such “mixed stocks” require information of the genetic background of individual fish. We used genetic analysis combined with radiotelemetry to study upstream migration of Atlantic salmon...

  3. Tissue astaxanthin and canthaxanthin distribution in rainbow trout (Oncorhynchus mykiss) and Atlantic salmon (Salmo salar).

    Science.gov (United States)

    Page, G I; Davies, S J

    2006-01-01

    A comparative investigation of tissue carotenoid distribution between rainbow trout, Oncorhynchus mykiss, and Atlantic salmon, Salmo salar, was undertaken to identify the relative efficiency of utilization of astaxanthin and canthaxanthin. Higher apparent digestibility coefficients (ADCs) (96% in trout vs. 28-31% in salmon; Ptrout vs. 5.5% in salmon; Ptrout. Astaxanthin deposition was higher than canthaxanthin in rainbow trout, while the reverse was true for Atlantic salmon, suggesting species-specificity in carotenoid utilization. The white muscle (95% in trout vs. 93% in salmon) and kidneys (0.5% in trout vs. 0.2% in salmon) represented higher proportions of the total body carotenoid pool in rainbow trout than in Atlantic salmon (Ptrout; Ptrout. Liver catabolism is suspected to be a critical determinant in carotenoid clearance, with higher catabolism expected in Atlantic salmon than in rainbow trout.

  4. Conservation and care: material politics and Atlantic salmon on Newfoundland’s Gander River

    Directory of Open Access Journals (Sweden)

    Jennifer Daniels

    2017-11-01

    Full Text Available Abstract This paper aims to contribute to an emerging and vibrant body of post-structural scholarship situated within science technology and society (STS on practices and their role in world making. Our focus is Atlantic salmon conservation in the Canadian province of Newfoundland and Labrador. We examine the different material and social orders that have over time connected human and salmon bodies. These different socio-material orders do not exist in harmony. On the contrary, they are in tension and reflect different visions/versions of how to conserve and care for Atlantic salmon. Our contribution is to interfere with the dominant narrative of Atlantic salmon conservation by drawing on the concept of care, and by introducing a new salmon that we call the willful salmon.

  5. Wild Steelhead Studies, Salmon and Clearwater Rivers, 1994 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Holubetz, Terry B; Leth, Brian D.

    1997-05-01

    To enumerate chinook salmon Oncorhynchus tshawytscha and steelhead O. mykiss adult escapements, weirs were operated in Marsh, Chamberlain, West Fork Chamberlain, and Running creeks. Beginning in late July 1994, a juvenile trap was installed in Running Creek to estimate juvenile outmigrants. Plans have been completed to install a weir in Rush Creek to enumerate steelhead adult escapement beginning in spring 1995. Design and agreements are being developed for Johnson Creek and Captain John Creek. Data collected in 1993 and 1994 indicate that spring chinook salmon and group-B steelhead populations and truly nearing extinction levels. For example, no adult salmon or steelhead were passed above the West Fork Chamberlain Creek weir in 1984, and only 6 steelhead and 16 chinook salmon were passed into the important spawning area on upper Marsh Creek. Group-A steelhead are considerably below desirable production levels, but in much better status than group-B stocks. Production of both group-A and group-B steelhead is being limited by low spawning escapements. Studies have not been initiated on wild summer chinook salmon stocks.

  6. Chinook salmon Genetic Stock Identification data - Genetic Stock Identification of Washington Chinook salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project evaluates data from coded wire tagging with that from parental based tagging to identify stock of origin for Chinook salmon landed in Washington state...

  7. Salmon and steelhead in the White Salmon River after the removal of Condit Dam–Planning efforts and recolonization results

    Science.gov (United States)

    Allen, Brady; Engle, Rod O; Zendt, Joseph S; Shrier, Frank C; Wilson, Jeremy T; Connolly, Patrick J.

    2016-01-01

    Condit Dam, at river kilometer 5.3 on the White Salmon River, Washington, was breached in 2011 and completely removed in 2012. This action opened habitat to migratory fish for the first time in 100 years. The White Salmon Working Group was formed to create plans for fish salvage in preparation for fish recolonization and to prescribe the actions necessary to restore anadromous salmonid populations in the White Salmon River after Condit Dam removal. Studies conducted by work group members and others served to inform management decisions. Management options for individual species were considered, including natural recolonization, introduction of a neighboring stock, hatchery supplementation, and monitoring natural recolonization for some time period to assess the need for hatchery supplementation. Monitoring to date indicates that multiple species and stocks of anadromous salmonids are finding and spawning in the now accessible and recovering habitat.

  8. Development and characterization of two cell lines from gills of Atlantic salmon

    Science.gov (United States)

    Gjessing, Mona C.; Aamelfot, Maria; Batts, William N.; Benestad, Sylvie L.; Dale, Ole B.; Thoen, Even; Weli, Simon C.; Winton, James R.

    2018-01-01

    Gill disease in Atlantic salmon, Salmo salar L., causes big losses in the salmon farming industry. Until now, tools to cultivate microorganisms causing gill disease and models to study the gill responses have been lacking. Here we describe the establishment and characterization of two cell lines from the gills of Atlantic salmon. Atlantic salmon gill cell ASG-10 consisted of cells staining for cytokeratin and e-cadherin and with desmosomes as seen by transmission electron microscopy suggesting the cells to be of epithelial origin. These structures were not seen in ASG-13. The cell lines have been maintained for almost 30 passages and both cell lines are fully susceptible to infection by infectious hematopoietic necrosis virus (IHNV), viral hemorrhagic septicemia virus (VHSV), infectious pancreatic necrosis virus (IPNV), Atlantic salmon reovirus TS (TSRV) and Pacific salmon paramyxovirus (PSPV). While infectious salmon anemia virus (ISAV) did not cause visible CPE, immunofluorescent staining revealed a sub-fraction of cells in both the ASG-10 and ASG-13 lines may be permissive to infection. ASG-10 is able to proliferate and migrate to close scratches in the monolayer within seven days in vitro contrary to ASG-13, which does not appear to do have the same proliferative and migratory ability. These cell lines will be useful in studies of gill diseases in Atlantic salmon and may represent an important contribution for alternatives to experimental animals and studies of epithelial–mesenchymal cell biology.

  9. Reduced trace element concentrations in fast-growing juvenile Atlantic salmon in natural streams.

    Science.gov (United States)

    Ward, Darren M; Nislow, Keith H; Chen, Celia Y; Folt, Carol L

    2010-05-01

    To assess the effect of rapid individual growth on trace element concentrations in fish, we measured concentrations of seven trace elements (As, Cd, Cs, Hg, Pb, Se, Zn) in stream-dwelling Atlantic salmon (Salmo salar) from 15 sites encompassing a 10-fold range in salmon growth. All salmon were hatched under uniform conditions, released into streams, and sampled approximately 120 days later for trace element analysis. For most elements, element concentrations in salmon tracked those in their prey. Fast-growing salmon had lower concentrations of all elements than slow growers, after accounting for prey concentrations. This pattern held for essential and nonessential elements, as well as elements that accumulate from food and those that can accumulate from water. At the sites with the fastest salmon growth, trace element concentrations in salmon were 37% (Cs) to 86% (Pb) lower than at sites where growth was suppressed. Given that concentrations were generally below levels harmful to salmon and that the pattern was consistent across all elements, we suggest that dilution of elements in larger biomass led to lower concentrations in fast-growing fish. Streams that foster rapid, efficient fish growth may produce fish with lower concentrations of elements potentially toxic for human and wildlife consumers.

  10. Price premium of organic salmon in Danish retail sale

    DEFF Research Database (Denmark)

    Ankamah Yeboah, Isaac; Nielsen, Max; Nielsen, Rasmus

    2016-01-01

    for organic salmon in Danish retail sale using consumer panel scanner data from households by applying a random effect hedonic price model that permits unobserved household heterogeneity. A price premium of 20% was identified for organic salmon. The magnitude of this premium is comparable to organic labeled...

  11. Costs of climate change: Economic value of Yakima River salmon

    International Nuclear Information System (INIS)

    Anderson, D.M.; Shankle, S.A.; Scott, M.J.; Neitzel, D.A.; Chatters, J.C.

    1992-07-01

    This work resulted from a continuing multidisciplinary analysis of species preservation and global change. The paper explores the economic cost of a potential regional warming as it affects one Pacific Northwest natural resource, the spring chinook salmon (Oncorhynchus tshcawytscha). Climate change and planned habitat improvements impact the production and economic value of soling chinook salmon of the Yakima River tributary of the Columbia River in eastern Washington. The paper presents a derivation of the total economic value of a chinook salmon, which includes the summation of the existence, commercial, recreational, and capital values of the fish. When currently available commercial, recreational, existence, and capital values for chinook salmon were applied to estimated population changes, the estimated change in the economic value per fish associated with reduction of one fish run proved significant

  12. 1992 Columbia River salmon flow measures Options Analysis/EIS

    International Nuclear Information System (INIS)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FSWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described

  13. 1992 Columbia River Salmon Flow Measures Options Analysis/EIS.

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FSWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described.

  14. Tracing salmon to their birthplace by activable tracer technique

    International Nuclear Information System (INIS)

    Shibuya, Masao

    1978-01-01

    Activable tracer technique was applied to trace the recurrent migration of white salmons, as a typical example of employing radioactivation analysis to the study of agricultural and marinefields. Europium was adopted because it is easy to use technically with less influence on fish body and easy to detect, and its remaining time is very long. Artificially hatched young white salmons were stocked in the Saibetsu River after being raised for a month with europium-containing feed. These stocked fish were labeled by fin-cutting method. Recurrent salmons (fin cutting-labeled fish) were then collected and dissected. The fishes were divided into otoliths, scales, flesh, internal organs, gills, bones, etc., and irradiated for 5 min in JRR-2 reactor of Japan Atomic Energy Research Institute. Europium was detected from the scales and otoliths of 3 to 4 year stocked adult fishes by γ-spectrometry of Eu. This proved the availability of activable tracer method for tracing the recurrent migration of salmons. (Kobatake, H.)

  15. Snake River Sockeye Salmon (Oncorhynchus Nerka) Habitat/Limnologic Research : Annual Report 1992.

    Energy Technology Data Exchange (ETDEWEB)

    Spaulding, Scott

    1993-05-01

    This report outlines long-term planning and monitoring activities that occurred in 1991 and 1992 in the Stanley Basin Lakes of the upper Salmon River, Idaho for the purpose of sockeye salmon nerka) recovery. Limnological monitoring and experimental sampling protocol, designed to establish a limnological baseline and to evaluate sockeye salmon production capability of the lakes, are presented. Also presented are recommended passage improvements for current fish passage barriers/impediments on migratory routes to the lakes. We initiated O. nerka population evaluations for Redfish and Alturas lakes; this included population estimates of emerging kokanee fry entering each lake in the spring and adult kokanee spawning surveys in tributary streams during the fall. Gill net evaluations of Alturas, Pettit, and Stanley lakes were done in September, 1992 to assess the relative abundance of fish species among the Stanley Basin lakes. Fish population data will be used to predict sockeye salmon production potential within a lake, as well as a baseline to monitor long-term fish community changes as a result of sockeye salmon recovery activities. Also included is a paper that reviews sockeye salmon enhancement activities in British Columbia and Alaska and recommends strategies for the release of age-0 sockeye salmon that will be produced from the current captive broodstock.

  16. Interactions between brown bears and chum salmon at McNeil River, Alaska

    Science.gov (United States)

    Peirce, Joshua M.; Otis, Edward O.; Wipfli, Mark S.; Follmann, Erich H.

    2013-01-01

    Predation on returning runs of adult salmon (Oncorhynchus spp.) can have a large influence on their spawning success. At McNeil River State Game Sanctuary (MRSGS), Alaska, brown bears (Ursus arctos) congregate in high numbers annually along the lower McNeil River to prey upon returning adult chum salmon (O. keta). Low chum salmon escapements into McNeil River since the late 1990s have been proposed as a potential factor contributing to concurrent declines in bear numbers. The objective of this study was to determine the extent of bear predation on chum salmon in McNeil River, especially on pre-spawning fish, and use those data to adjust the escapement goal for the river. In 2005 and 2006, 105 chum salmon were radiotagged at the river mouth and tracked to determine cause and location of death. Below the falls, predators consumed 99% of tagged fish, killing 59% of them before they spawned. Subsequently, the escapement goal was nearly doubled to account for this pre-spawning mortality and to ensure enough salmon to sustain both predators and prey. This approach to integrated fish and wildlife management at MRSGS can serve as a model for other systems where current salmon escapement goals may not account for pre-spawning mortality.

  17. Use of the neutron diffraction - H/D exchange technique to determine the conformational dynamics of trypsin

    International Nuclear Information System (INIS)

    Kossiakoff, A.A.

    1982-01-01

    Reported here are studies analyzing the extent and nature of the inherent conformational fluctuations in trypsin by neutron diffraction - hydrogen exchange techniques. The pattern of exchange investigates systematic relationships between exchangeable sites and the structural and chemical properties of the molecule. Our findings that pH 7, 20 0 and 1 year of soaking all sites of trypsin are fully exchanged except those which are especially well protected by the structure. Essentially all the sites in which the peptide hydrogens are bonded directly to water molecules - either in the bulk solvent regions or in interior clusters - are fully exchanged. 41 references, 10 figures

  18. Amino Acid Composition, Urease Activity and Trypsin Inhibitor Activity after Toasting of Soybean in Thick and Thin Layer

    OpenAIRE

    Krička, Tajana; Jurišić, Vanja; Voća, Neven; Ćurić, Duška; Brlek Savić, Tea; Matin, Ana

    2009-01-01

    The objective of this study was to determine amino acid content, urease activity and trypsin inhibitor activity in soybean grain for polygastric animals’ feed aft er toasting with the aim to introduce thick layer in toasting technology. Hence, soybean was toasted both in thick and thin layer at 130 oC during 10 minutes. In order to properly monitor the technological process of soybean thermal processing, it was necessary to study crude protein content, urease activity, trypsin inhibitor activ...

  19. Screening and purification of a novel trypsin inhibitor from Prosopis juliflora seeds with activity toward pest digestive enzymes.

    Science.gov (United States)

    Sivakumar, S; Franco, O L; Tagliari, P D; Bloch, C; Mohan, M; Thayumanavan, B

    2005-08-01

    Several pests are capable of decreasing crop production causing severe economical and social losses. Aiming to find novel molecules that could impede the digestion process of different pests, a screening of alpha-amylase and trypsin-like proteinase inhibitors was carried out in Prosopis juliflora, showing the presence of both in dry seeds. Furthermore, a novel trypsin inhibitor, with molecular mass of 13,292 Da, was purified showing remarkable in vitro activity against T. castaneum and C. maculatus.

  20. Involvement of hormones in olfactory imprinting and homing in chum salmon.

    Science.gov (United States)

    Ueda, Hiroshi; Nakamura, Shingo; Nakamura, Taro; Inada, Kaoru; Okubo, Takashi; Furukawa, Naohiro; Murakami, Reiichi; Tsuchida, Shigeo; Zohar, Yonathan; Konno, Kotaro; Watanabe, Masahiko

    2016-02-16

    The olfactory hypothesis for salmon imprinting and homing to their natal stream is well known, but the endocrine hormonal control mechanisms of olfactory memory formation in juveniles and retrieval in adults remain unclear. In brains of hatchery-reared underyearling juvenile chum salmon (Oncorhynchus keta), thyrotropin-releasing hormone gene expression increased immediately after release from a hatchery into the natal stream, and the expression of the essential NR1 subunit of the N-methyl-D-aspartate receptor increased during downstream migration. Gene expression of salmon gonadotropin-releasing hormone (sGnRH) and NR1 increased in the adult chum salmon brain during homing from the Bering Sea to the natal hatchery. Thyroid hormone treatment in juveniles enhanced NR1 gene activation, and GnRHa treatment in adults improved stream odour discrimination. Olfactory memory formation during juvenile downstream migration and retrieval during adult homing migration of chum salmon might be controlled by endocrine hormones and could be clarified using NR1 as a molecular marker.

  1. Adult Chinook Salmon Abundance Monitoring in Lake Creek, Idaho, Annual Report 2001.

    Energy Technology Data Exchange (ETDEWEB)

    Faurot, Dave

    2002-12-01

    Underwater time-lapse video technology has been used to monitor adult spring and summer chinook salmon (Oncorhynchus tshawytscha) escapement into the Secesh River and Lake Creek, Idaho, since 1998. Underwater time- lapse videography is a passive methodology that does not trap or handle this Endangered Species Act listed species. Secesh River chinook salmon represent a wild spawning aggregate that has not been directly supplemented with hatchery fish. The Secesh River is also a control stream under the Idaho Salmon Supplementation study. This project has successfully demonstrated the application of underwater video monitoring to accurately quantify chinook salmon abundance in Lake Creek in 1998, 1999 and 2001. The adult salmon spawner escapement estimate into Lake Creek in 2001 was 697 fish, the largest escapement since the project began. Jack salmon comprised 10% of the spring migration. Snow pack in the drainage was 38% of the average during the winter of 2000/2001. The first fish passage on Lake Creek was recorded on June 9, 19 days after installation of the fish counting station and two weeks earlier than previously reported. Peak net upstream movement of 52 adults occurred on June 22. Peak of total movement activity was July 3. The last fish passed through the Lake Creek fish counting station on September 6. Redd count expansion methods were compared to underwater video determined salmon spawner abundance in Lake Creek in 2001. Expanded index area redd count point estimates and intensive area redd counts in 2001, estimated from 1.3 percent fewer to 56 percent greater number of spawners than underwater video determined spawner abundance. Redd count expansion values had unknown variation associated with the point estimates. Fish per redd numbers in Lake Creek have varied widely. In 2001 there were 2.07 fish per redd. In 1999, there were 3.58 fish per redd, and in 1998, with no jacks returning to spawn, there were 1.02 fish per redd. Migrating salmon in Lake Creek

  2. Disease resistance is related to inherent swimming performance in Atlantic salmon

    OpenAIRE

    Castro, Vicente; Grisdale-Helland, Barbara; Jørgensen, Sven Martin; Helgerud, Jan; Claireaux, Guy; Farrell, Anthony P.; Krasnov, Aleksei; Helland, Ståle; Takle, Harald Rune

    2013-01-01

    Background Like humans, fish can be classified according to their athletic performance. Sustained exercise training of fish can improve growth and physical capacity, and recent results have documented improved disease resistance in exercised Atlantic salmon. In this study we investigated the effects of inherent swimming performance and exercise training on disease resistance in Atlantic salmon. Atlantic salmon were first classified as either poor or good according to their swimming per...

  3. Snake River Sockeye Salmon Habitat and Limnological Research : 2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Taki, Doug; Kohler, Andre E.; Griswold, Robert G.; Gilliland, Kim

    2006-07-14

    In March 1990, the Shoshone-Bannock Tribes petitioned the National Marine Fisheries Service (NMFS) to list Snake River sockeye salmon (Oncorhynchus nerka) as endangered. Snake River sockeye salmon were officially listed as endangered in November 1991 under the Endangered Species Act (56 FR 58619). In 1991, the Snake River Sockeye Salmon Habitat and Limnological Research Project was implemented. This project is part of an interagency effort to prevent the extinction of the Redfish Lake stock of Snake River sockeye salmon. The Shoshone-Bannock Tribal goal for this project is two tiered: The immediate goal is to increase the population of Snake River sockeye salmon while preserving the unique genetic characteristics of the Evolutionarily Significant Unit (ESU). The Tribes long term goal is to maintain a viable population that warrants delisting and provides Tribal harvest opportunities. The Bonneville Power Administration (BPA) provides funding for this interagency recovery. Collaborators in the recovery effort include the National Oceanic and Atmospheric Administration (NOAA), the Idaho Department of Fish and Game (IDFG), the University of Idaho (UI), and the Shoshone-Bannock Tribes (SBT). This report summarizes activities conducted by Shoshone-Bannock Tribal Fisheries Department personnel during the 2005 calendar year. Project tasks include: (1) monitor limnological parameters of the Sawtooth Valley lakes to assess lake productivity; (2) conduct lake fertilization in Pettit and Alturas lakes; (3) reduce the number of mature kokanee spawning in Fishhook and Alturas Lake creeks; (4) monitor and enumerate sockeye salmon smolt migration from Pettit and Alturas lakes; (5) monitor spawning kokanee escapement and estimate fry recruitment in Fishhook, Alturas Lake, and Stanley Lake creeks; (6) conduct sockeye and kokanee salmon population surveys; (7) evaluate potential competition and predation between stocked juvenile sockeye salmon and a variety of fish species in

  4. Marine-derived nutrients, bioturbation, and ecosystem metabolism: reconsidering the role of salmon in streams.

    Science.gov (United States)

    Holtgrieve, Gordon W; Schindler, Daniel E

    2011-02-01

    In coastal areas of the North Pacific Ocean, annual returns of spawning salmon provide a substantial influx of nutrients and organic matter to streams and are generally believed to enhance the productivity of recipient ecosystems. Loss of this subsidy from areas with diminished salmon runs has been hypothesized to limit ecosystem productivity in juvenile salmon rearing habitats (lakes and streams), thereby reinforcing population declines. Using five to seven years of data from an Alaskan stream supporting moderate salmon densities, we show that salmon predictably increased stream water nutrient concentrations, which were on average 190% (nitrogen) and 390% (phosphorus) pre-salmon values, and that primary producers incorporated some of these nutrients into tissues. However, benthic algal biomass declined by an order of magnitude despite increased nutrients. We also measured changes in stream ecosystem metabolic properties, including gross primary productivity (GPP) and ecosystem respiration (ER), from three salmon streams by analyzing diel measurements of oxygen concentrations and stable isotopic ratios (delta O-O2) within a Bayesian statistical model of oxygen dynamics. Our results do not support a shift toward higher primary productivity with the return of salmon, as is expected from a nutrient fertilization mechanism. Rather, net ecosystem metabolism switched from approximately net autotrophic (GPP > or = ER) to a strongly net heterotrophic state (GPP disturbance enhanced in situ heterotrophic respiration. Salmon also changed the physical properties of the stream, increasing air-water gas exchange by nearly 10-fold during peak spawning. We suggest that management efforts to restore salmon ecosystems should consider effects on ecosystem metabolic properties and how salmon disturbance affects the incorporation of marine-derived nutrients into food webs.

  5. 77 FR 12568 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2012-03-01

    ... Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery AGENCY: National Marine... Salmon Fishery. NMFS will hold a series of public meetings with Southeast Alaska purse seine salmon... to Paul Marx, Chief, Financial Services Division, NMFS, Attn: SE Alaska Purse Seine Salmon Buyback...

  6. Aqueous exposure to Aroclor 1254 modulates the mitogenic response of Atlantic salmon anterior kidney T-cells: Indications of short- and long-term immunomodulation

    International Nuclear Information System (INIS)

    Iwanowicz, Luke R.; Lerner, Darren T.; Blazer, Vicki S.; McCormick, Stephen D.

    2005-01-01

    Polychlorinated biphenyls (PCBs) exist as persistent organic pollutants in numerous river systems in the United States. Unfortunately, some of these rivers are sites of active Atlantic salmon restoration programs, and polychlorinated biphenyls have been implicated as ancillary factors contributing to failed salmon restoration. Here, we investigate the immediate and chronic effects of intermediate duration aqueous PCB exposure (1 or 10 μg L -1 Aroclor 1254) on the mitogen-stimulated lymphoproliferative response of Atlantic salmon anterior kidney leukocytes (AKLs). A short-term study was designed to examine immunomodulation in Atlantic salmon smolts immediately following 21 days of aqueous exposure, while a long-term study evaluated chronic impacts in the mitogen response in parr 15 months post-exposure as larvae. The proliferative response of AKLs to the mitogens concanavalin A (CON A), phytohemaglutinnin-P (PHA-P), pokeweed mitogen (PWM), and lipopolysaccharide were used as an indice of immunomodulation. The proliferative response to the T-cell mitogens CON A and PHA-P was significantly increased in the 10 μg L -1 group (n = 10; P = 0.043 and 0.002, respectively) immediately following exposure of smolts. Additionally, The PHA-P response was significantly increased in the 1 μg L -1 exposure group (n = 10, P = 0.036). In fish treated as larvae and tested 15 months later, the PHA-P sensitive populations exhibited elevated proliferation in the 1 and 10 μg L -1 groups (n = 12, P -1 treated groups. These results demonstrate an immunomodulatory effect of PCBs on T-cell mitogen sensitive populations of lymphocytes in Atlantic salmon as well as long-term immunomodulation in PHA-P and PWM sensitive populations

  7. Changes in antigenicity of porcine serum albumin in gamma-irradiated sausage extract by treatment with pepsin and trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Koth-Bong-Woo-Ri; Song, Eu-Jin [Department of Food Science and Technology/Institute of Food Science, Pukyong National University, Busan 608-737 (Korea, Republic of); Lee, So-Young [Traditional Food Research Group, Korea Food Research Institute, Seongnam 463-746 (Korea, Republic of); Park, Jin-Gyu [Radiation Food Science and Biotechnology, Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongup 580-185 (Korea, Republic of); Lee, Ju-Woon [National Federation of Fisheries Cooperatives, Fisheries Economic Institute, Seoul 138-827 (Korea, Republic of); Byun, Myung-Woo [Department of Culinary Nutrition, Woosong University, Daejon 300-718 (Korea, Republic of); Ahn, Dong-Hyun, E-mail: dhahn@pknu.ac.kr [Department of Food Science and Technology/Institute of Food Science, Pukyong National University, Busan 608-737 (Korea, Republic of)

    2011-11-15

    Pork is known as an allergenic food with porcine serum albumin (PSA, 66 kDa) representing the major allergen. This study was conducted to investigate the change in antigenicity of PSA in gamma-irradiated sausage extract treated with pepsin and trypsin. Sausage products (A and B) were irradiated at 1, 3, 10, and 20 kGy. After irradiation, sausage proteins were extracted and digested with pepsin (1:200, 30 min) and trypsin (1:300, 5, 30, 60, 90, and 120 min). The binding ability of PSA in extracts of the irradiated sausages (A and B) decreased by over 3 kGy relative to the binding ability of PSA in extracts of intact sausages and showed no notable differences when the dose of radiation ranged from 3 to 20 kGy. After treatment with pepsin and trypsin, the binding ability of PSA in extracts of the irradiated sausages was decreased more relative to that of intact sausages and showed no significant differences when the period of trypsin treatment is increased or when the dose of irradiation is increased. The sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) results indicated that there was no visible change in the intensity of the PSA band in extracts of the irradiated sausages. After pepsin and trypsin treatment, the intensity of PSA band faded with increasing doses of irradiation. In conclusion, antigenicity of PSA in pork sausages could be reduced by gamma irradiation. - Highlights: > Change in antigenicity of PSA in irradiated sausage extract (ISE) was examined. > Binding ability of PSA in ISE was decreased compared to intact extract. > Binding ability of PSA in ISE after enzyme treatments was also further decreased. > Intensity of PSA band in ISE after enzyme treatments became weak.

  8. Changes in antigenicity of porcine serum albumin in gamma-irradiated sausage extract by treatment with pepsin and trypsin

    International Nuclear Information System (INIS)

    Kim, Koth-Bong-Woo-Ri; Song, Eu-Jin; Lee, So-Young; Park, Jin-Gyu; Lee, Ju-Woon; Byun, Myung-Woo; Ahn, Dong-Hyun

    2011-01-01

    Pork is known as an allergenic food with porcine serum albumin (PSA, 66 kDa) representing the major allergen. This study was conducted to investigate the change in antigenicity of PSA in gamma-irradiated sausage extract treated with pepsin and trypsin. Sausage products (A and B) were irradiated at 1, 3, 10, and 20 kGy. After irradiation, sausage proteins were extracted and digested with pepsin (1:200, 30 min) and trypsin (1:300, 5, 30, 60, 90, and 120 min). The binding ability of PSA in extracts of the irradiated sausages (A and B) decreased by over 3 kGy relative to the binding ability of PSA in extracts of intact sausages and showed no notable differences when the dose of radiation ranged from 3 to 20 kGy. After treatment with pepsin and trypsin, the binding ability of PSA in extracts of the irradiated sausages was decreased more relative to that of intact sausages and showed no significant differences when the period of trypsin treatment is increased or when the dose of irradiation is increased. The sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) results indicated that there was no visible change in the intensity of the PSA band in extracts of the irradiated sausages. After pepsin and trypsin treatment, the intensity of PSA band faded with increasing doses of irradiation. In conclusion, antigenicity of PSA in pork sausages could be reduced by gamma irradiation. - Highlights: → Change in antigenicity of PSA in irradiated sausage extract (ISE) was examined. → Binding ability of PSA in ISE was decreased compared to intact extract. → Binding ability of PSA in ISE after enzyme treatments was also further decreased. → Intensity of PSA band in ISE after enzyme treatments became weak.

  9. Norwegian Salmon Goes to Market: The Case of the Austevoll Seafood Cluster

    Science.gov (United States)

    Phyne, John; Hovgaard, Gestur; Hansen, Gard

    2006-01-01

    This paper examines the impact of the globalisation of the farmed salmon commodity chain upon farmed salmon production in the western Norwegian municipality of Austevoll. On the basis of field research conducted in 2002 and 2003, we conclude that salmon farming in Austevoll has responded to the challenges of "buyer-driven" food chains by…

  10. Salmon Site Remedial Investigation Report

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  11. Salmon and steelhead genetics and genomics - Epigenetic and genomic variation in salmon and steelhead

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct analyses of epigenetic and genomic variation in Chinook salmon and steelhead to determine influence on phenotypic expression of life history traits. Genetic,...

  12. A highly redundant BAC library of Atlantic salmon (Salmo salar: an important tool for salmon projects

    Directory of Open Access Journals (Sweden)

    Koop Ben F

    2005-04-01

    Full Text Available Abstract Background As farming of Atlantic salmon is growing as an aquaculture enterprise, the need to identify the genomic mechanisms for specific traits is becoming more important in breeding and management of the animal. Traits of importance might be related to growth, disease resistance, food conversion efficiency, color or taste. To identify genomic regions responsible for specific traits, genomic large insert libraries have previously proven to be of crucial importance. These large insert libraries can be screened using gene or genetic markers in order to identify and map regions of interest. Furthermore, large-scale mapping can utilize highly redundant libraries in genome projects, and hence provide valuable data on the genome structure. Results Here we report the construction and characterization of a highly redundant bacterial artificial chromosome (BAC library constructed from a Norwegian aquaculture strain male of Atlantic salmon (Salmo salar. The library consists of a total number of 305 557 clones, in which approximately 299 000 are recombinants. The average insert size of the library is 188 kbp, representing 18-fold genome coverage. High-density filters each consisting of 18 432 clones spotted in duplicates have been produced for hybridization screening, and are publicly available 1. To characterize the library, 15 expressed sequence tags (ESTs derived overgos and 12 oligo sequences derived from microsatellite markers were used in hybridization screening of the complete BAC library. Secondary hybridizations with individual probes were performed for the clones detected. The BACs positive for the EST probes were fingerprinted and mapped into contigs, yielding an average of 3 contigs for each probe. Clones identified using genomic probes were PCR verified using microsatellite specific primers. Conclusion Identification of genes and genomic regions of interest is greatly aided by the availability of the CHORI-214 Atlantic salmon BAC

  13. Frequency of inhibitors of daphnid trypsin in the widely distributed cyanobacterial genus Planktothrix

    DEFF Research Database (Denmark)

    Rohrlack, T.; Christoffersen, K.; Friberg-Jensen, U.

    2005-01-01

    on the frequency of such compounds in the widely distributed cyanobacterial genus Planktothrix. Of the 89 Planktothrix strains analysed, about 70% produced inhibitors of daphnid trypsin. The strains tested positive represented three common Planktothrix species and were isolated from diverse localities...

  14. Color photographic index of fall Chinook salmon embryonic development and accumulated thermal units.

    Directory of Open Access Journals (Sweden)

    James W Boyd

    Full Text Available BACKGROUND: Knowledge of the relationship between accumulated thermal units and developmental stages of Chinook salmon embryos can be used to determine the approximate date of egg fertilization in natural redds, thus providing insight into oviposition timing of wild salmonids. However, few studies have documented time to different developmental stages of embryonic Chinook salmon and no reference color photographs are available. The objectives of this study were to construct an index relating developmental stages of hatchery-reared fall Chinook salmon embryos to time and temperature (e.g., degree days and provide high-quality color photographs of each identified developmental stage. METHODOLOGY/PRINCIPAL FINDINGS: Fall Chinook salmon eggs were fertilized in a hatchery environment and sampled approximately every 72 h post-fertilization until 50% hatch. Known embryonic developmental features described for sockeye salmon were used to describe development of Chinook salmon embryos. A thermal sums model was used to describe the relationship between embryonic development rate and water temperature. Mean water temperature was 8.0 degrees C (range; 3.9-11.7 degrees C during the study period. Nineteen stages of embryonic development were identified for fall Chinook salmon; two stages in the cleavage phase, one stage in the gastrulation phase, and sixteen stages in the organogenesis phase. The thermal sums model used in this study provided similar estimates of fall Chinook salmon embryonic development rate in water temperatures varying from 3.9-11.7 degrees C (mean=8 degrees C to those from several other studies rearing embryos in constant 8 degrees C water temperature. CONCLUSIONS/SIGNIFICANCE: The developmental index provides a reasonable description of timing to known developmental stages of Chinook salmon embryos and was useful in determining developmental stages of wild fall Chinook salmon embryos excavated from redds in the Columbia River. This index

  15. Tainting by short-term exposure of Atlantic salmon to water soluble petroleum hydrocarbons

    International Nuclear Information System (INIS)

    Ackman, R.G.; Heras, H.

    1992-01-01

    Experiments were conducted to examine the extent of tainting of salmon by exposure to the soluble fraction of petroleum hydrocarbons. The experiments were conducted on Atlantic salmon in tanks containing seawater artificially contaminated at three different concentrations with the soluble fraction of a North Sea crude. The salmon flesh was analyzed by gas chromatography and taste tests were conducted on cooked salmon samples to determine the extent of tainting. Salmon in control tanks with uncontaminated seawater had muscle accumulations of total hydrocarbons of ca 1 ppM. The muscle accumulations of total hydrocarbons in the salmon were 13.5 ppM, 25.6 ppM, and 31.3 ppM for water soluble fraction concentrations of 0.45, 0.87, and 1.54 ppM respectively. The threshold for taint was clearly inferred to be less than 0.45 ppM of water soluble fraction. 18 refs., 2 figs

  16. Linkages between Alaskan sockeye salmon abundance, growth at sea, and climate, 1955-2002

    Science.gov (United States)

    Ruggerone, G.T.; Nielsen, J.L.; Bumgarner, J.

    2007-01-01

    We tested the hypothesis that increased growth of salmon during early marine life contributed to greater survival and abundance of salmon following the 1976/1977 climate regime shift and that this, in turn, led to density-dependent reductions in growth during late marine stages. Annual measurements of Bristol Bay (Bering Sea) and Chignik (Gulf of Alaska) sockeye salmon scale growth from 1955 to 2002 were used as indices of body growth. During the first and second years at sea, growth of both stocks tended to be higher after the 1976-1977 climate shift, whereas growth during the third year and homeward migration was often below average. Multiple regression models indicated that return per spawner of Bristol Bay sockeye salmon and adult abundance of western and central Alaska sockeye salmon were positively correlated with growth during the first 2 years at sea and negatively correlated with growth during later life stages. After accounting for competition between Bristol Bay sockeye and Asian pink salmon, age-specific adult length of Bristol Bay salmon increased after the 1976-1977 regime shift, then decreased after the 1989 climate shift. Late marine growth and age-specific adult length of Bristol Bay salmon was exceptionally low after 1989, possibly reducing their reproductive potential. These findings support the hypothesis that greater marine growth during the first 2 years at sea contributed to greater salmon survival and abundance, which in turn led to density-dependent growth during later life stages when size-related mortality was likely lower. Our findings provide new evidence supporting the importance of bottom-up control in marine ecosystems and highlight the complex dynamics of species interactions that continually change as salmon grow and mature in the ocean. ?? 2007 Elsevier Ltd. All rights reserved.

  17. Quantifying Temperature Effects on Fall Chinook Salmon

    Energy Technology Data Exchange (ETDEWEB)

    Jager, Yetta [ORNL

    2011-11-01

    The motivation for this study was to recommend relationships for use in a model of San Joaquin fall Chinook salmon. This report reviews literature pertaining to relationships between water temperature and fall Chinook salmon. The report is organized into three sections that deal with temperature effects on development and timing of freshwater life stages, temperature effects on incubation survival for eggs and alevin, and temperature effects on juvenile survival. Recommendations are made for modeling temperature influences for all three life stages.

  18. Differential incorporation of natural spawners vs. artificially planted salmon carcasses in a stream food web: Evidence from delta 15N of juvenile coho salmon

    Science.gov (United States)

    Placement of salmon carcasses is a common restoration technique in Oregon and Washington streams, with the goal of improving food resources and productivity of juvenile salmon. To explore the effectiveness of this restoration technique, we measured the δ15N of juvenile coho salmo...

  19. TsAg5, a Taenia solium cysticercus protein with a marginal trypsin-like activity in the diagnosis of human neurocysticercosis.

    Science.gov (United States)

    Rueda, Analiz; Sifuentes, Cecilia; Gilman, Robert H; Gutiérrez, Andrés H; Piña, Ruby; Chile, Nancy; Carrasco, Sebastián; Larson, Sandra; Mayta, Holger; Verástegui, Manuela; Rodriguez, Silvia; Gutiérrez-Correa, Marcel; García, Héctor H; Sheen, Patricia; Zimic, Mirko

    2011-12-01

    Neurocysticercosis is an endemic parasitic disease caused by Taenia solium larva. Although the mechanism of infection is not completely understood, it is likely driven by proteolytic activity that degrades the intestinal wall to facilitate oncosphere penetration and further infection. We analyzed the publicly available T. solium EST/DNA library and identified two contigs comprising a full-length cDNA fragment very similar to Echinococcus granulosus Ag5 protein. The T. solium cDNA sequence included a proteolytic trypsin-like-domain in the C-terminal region, and a thrombospondin type-1 adherence-domain in the N-terminal region. Both the trypsin-like and adherence domains were expressed independently as recombinant proteins in bacterial systems. TsAg5 showed marginal trypsin-like activity and high sequence similarity to Ag5. The purified antigens were tested in a Western immunoblot assay to diagnose human neurocysticercosis. The sensitivity of the trypsin-like-domain was 96.36% in patients infected with extraparenchymal cysts, 75.44% in patients infected with multiple cysts, and 39.62% in patients with a single cyst. Specificity was 76.70%. The thrombospondin type-1 adherence-domain was not specific for neurocysticercosis. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Effect of sorbitol and glycerol on the stability of trypsin and difference between their stabilization effects in the various solvents.

    Science.gov (United States)

    Pazhang, Mohammad; Mehrnejad, Faramarz; Pazhang, Yaghub; Falahati, Hanieh; Chaparzadeh, Nader

    2016-01-01

    The effect of glycerol and sorbitol on the stability of porcine pancreas trypsin was investigated in this work. Molecular dynamics simulation and thermostability results showed that trypsin has two flexible regions, and polyols (sorbitol and glycerol) stabilize the enzyme by decreasing the flexibility of these regions. Radial distribution function results exhibited that sorbitol and glycerol were excluded from the first water layer of the enzyme, therefore decrease the flexibility of the regions by preferential exclusion. Also, results showed that the stabilization effect of sorbitol is more than glycerol. This observation could be because of the larger decrease in the fluctuations of trypsin in the presence of sorbitol. We also examined the role of solvent's hydrophobicity in enzyme stabilization by sorbitol and glycerol. To do so, the thermostability of trypsin was evaluated in the presence of solvents with different hydrophobicity (methanol, ethanol, isopropanol and n-propanol) in addition to the polyols. Our results depicted that glycerol is a better stabilizer than sorbitol in the presence of hydrophobic solvents (n-propanol), whereas sorbitol is a better stabilizer than glycerol in the presence of hydrophilic solvents (methanol). © 2015 International Union of Biochemistry and Molecular Biology, Inc.

  1. Systematic Design of Trypsin Cleavage Site Mutated Exendin4-Cysteine 1, an Orally Bioavailable Glucagon-Like Peptide-1 Receptor Agonist

    Directory of Open Access Journals (Sweden)

    Wenbo Sai

    2017-03-01

    Full Text Available Exendin-4 is a strong therapeutic candidate for the treatment of metabolic syndrome. Related receptor agonist drugs have been on the market since 2005. However, technical limitations and the pain caused by subcutaneous injection have severely limited patient compliance. The goal of the study is to investigate a biologically active exendin-4 analog could be administered orally. Using intraperitoneal glucose tolerance tests, we discovered that exendin4-cysteine administered by oral gavage had a distinct hypoglycemic effect in C57BL/6J mice. Using Rosetta Design and Amber, we designed and screened a series of exendin4-cysteine analogs to identify those that retained biological activity while resisting trypsin digestion. Trypsin Cleavage Site Mutated Exendin4-cysteine 1 (TSME-1, an analog whose bioactivity was similar to exendin-4 and was almost completely resistant to trypsin, was screened out. In addition, TSME-1 significantly normalized the blood glucose levels and the availability of TSME-1 was significantly higher than that of exendin-4 and exendin4-cysteine. Collectively orally administered TSME-1, a trypsin-resistant exendin-4 analog obtained by the system, is a strong candidate for future treatments of type 2 diabetes.

  2. Redfish Lake sockeye salmon captive broodstock rearing and research, 1994. Annual report

    International Nuclear Information System (INIS)

    Flagg, T.A.; McAuley, W.C.; Wastel, M.R.; Frost, D.A.; Mahnken, C.V.W.

    1996-03-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game (IDFG) and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are emerging as an important component of restoration efforts for ESA-listed salmon populations. Captive broodstock programs are a form of artificial propagation. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January to December 1994 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species

  3. Doubling sockeye salmon production in the Fraser River—Is this sustainable development?

    Science.gov (United States)

    Henderson, Michael A.; Healey, Michael C.

    1993-11-01

    We evaluate a proposal to double sockeye salmon production from the Fraser River and conclude that significant changes will be required to current management processes, particularly the way available catch is allocated, if the plan is to be consistent with five major principles embodied in the concept of sustainable development. Doubling sockeye salmon production will not, in itself, increase economic equity either regionally or globally. Developing nations may actually be hindered in their attempts to institute other, nonsalmon fisheries in the North Pacific Ocean as a result of the possible interception of salmon. Further, other users of the Fraser River basin will have to forgo opportunities so that salmon habitat can be conserved. If doubling sockeye salmon production is to meet the goal of doing more with less, it will be necessary to develop more efficient technologies to harvest the fish. If increasing salmon production is to reflect the integration of environmental and economic decision making at the highest level, then a serious attempt must be made to incorporate environmental assets into national economic accounting. Finally, to promote biodiversity and cultural self-sufficiency within the Fraser River basin, it will be important to safeguard the small, less-productive salmon stocks as well as the large ones and to allocate a substantial portion of the increased production to the Native Indian community.

  4. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1994 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    1996-03-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game (IDFG) and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are emerging as an important component of restoration efforts for ESA-listed salmon populations. Captive broodstock programs are a form of artificial propagation. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January to December 1994 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species.

  5. Conformational Network and Residence Time Estimation of Trypsin-Benzamidine Unbinding Pathways

    OpenAIRE

    Dickson, Alex; Lotz, Samuel D.

    2016-01-01

    In this poster we present results from molecular dynamics sampling of benzamidine unbinding from trypsin. We give background on the weighted ensemble technique used (WExplore) and the Markovian state model construction. Our network shows three unique unbinding pathways including a never before observed unbinding pathway. We also estimate residence time to within one order of magnitude to the experimental value.

  6. Radioimmunoassay of trypsin in dried blood importance for the neonatal detection of cystic fibrosis

    International Nuclear Information System (INIS)

    Travert, G.; Mustin, C.; Fernandez, Y.

    1981-01-01

    The demonstration of very high levels of immunoreactive trypsin in the blood of newborn infants with cystic fibrosis has provided a new way of detecting the disease soon after birth. A radioimmunoassay of trypsin in the eluate of blood dried on filter paper has now been developed. The sensitivity and accuracy of the method, as well as the good correlation observed between the values obtained and those of the conventional plasma assay, indicate that it is reliable and well adapted to the newborn. The new assay can easily be inserted into the present system of neonatal disease detection. A preliminary assessment of more than 5000 tests enables the authors to report an early diagnosis of proven cystic fibrosis and to discuss an essential aspect of mass-detection methods: the indicence of false-positive results [fr

  7. Trypsinization and the radiosensitivity of mitotic and log phase Chinese hamster V79 cells exposed to 250 kVp X-rays

    International Nuclear Information System (INIS)

    Reddy, N.M.S.; Stevenson, A.F.G.; Lange, C.S.

    1989-01-01

    The authors studied the influence of trypsin-induced morphological changes on the x-radiosensitivity of cells plated at either low (4-600/cm 2 ) or high (2 x 10 4 /cm 2 ) density and grown overnight before treatments. Trypsin treatment induced contraction and rounding of spread cells. The results suggest that: (1) trypsin-induced cell contraction affects the ability of cells to repair radiation damage, (2) spread cells are better able to repair potential lethal damage (PLD) than rounded cells, (3) immediate plating survival of cells in high-density cultures may not represent their intrinsic radiosensitivity and (4) cell-to-cell contact is not necessary for log phase cells to repair PLD. (author)

  8. Research on Captive Broodstock Programs for Pacific Salmon, 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry A. (National Marine Fisheries Service)

    2005-11-01

    The success of captive broodstock programs depends on high in-culture survival, appropriate development of the reproductive system, and the behavior and survival of cultured salmon after release, either as adults or juveniles. Continuing captive broodstock research designed to improve technology is being conducted to cover all major life history stages of Pacific salmon. Accomplishments detailed in this report and those since the last project review period (FY 2003) are listed below by major objective. Objective 1: (i) Developed tools for monitoring the spawning success of captively reared Chinook salmon that can now be used for evaluating the reintroduction success of ESA-listed captive broodstocks in their natal habitats. (ii) Developed an automated temperature controlled rearing system to test the effects of seawater rearing temperature on reproductive success of Chinook salmon. Objective 2: (i) Determined that Columbia River sockeye salmon imprint at multiple developmental stages and the length of exposure to home water is important for successful imprinting. These results can be utilized for developing successful reintroduction strategies to minimize straying by ESA-listed sockeye salmon. (ii) Developed behavioral and physiological assays for imprinting in sockeye salmon. Objective 3: (i) Developed growth regime to reduce age-two male maturation in spring Chinook salmon, (ii) described reproductive cycle of returning hatchery Snake River spring Chinook salmon relative to captive broodstock, and (iii) found delays in egg development in captive broodstock prior to entry to fresh water. (iv) Determined that loss of Redfish Lake sockeye embryos prior to hatch is largely due to lack of egg fertilization rather than embryonic mortality. Objective 4 : (i) Demonstrated safety and efficacy limits against bacterial kidney disease (BKD) in fall Chinook of attenuated R. salmoninarum vaccine and commercial vaccine Renogen, (ii) improved prophylactic and therapeutic

  9. A modeled comparison of direct and food web-mediated impacts of common pesticides on Pacific salmon.

    Directory of Open Access Journals (Sweden)

    Kate H Macneale

    Full Text Available In the western United States, pesticides used in agricultural and urban areas are often detected in streams and rivers that support threatened and endangered Pacific salmon. Although concentrations are rarely high enough to cause direct salmon mortality, they can reach levels sufficient to impair juvenile feeding behavior and limit macroinvertebrate prey abundance. This raises the possibility of direct adverse effects on juvenile salmon health in tandem with indirect effects on salmon growth as a consequence of reduced prey abundance. We modeled the growth of ocean-type Chinook salmon (Oncorhynchus tshawytscha at the individual and population scales, investigating insecticides that differ in how long they impair salmon feeding behavior and in how toxic they are to salmon compared to macroinvertebrates. The relative importance of these direct vs. indirect effects depends both on how quickly salmon can recover and on the relative toxicity of an insecticide to salmon and their prey. Model simulations indicate that when exposed to a long-acting organophosphate insecticide that is highly toxic to salmon and invertebrates (e.g., chlorpyrifos, the long-lasting effect on salmon feeding behavior drives the reduction in salmon population growth with reductions in prey abundance having little additional impact. When exposed to short-acting carbamate insecticides at concentrations that salmon recover from quickly but are lethal to invertebrates (e.g., carbaryl, the impacts on salmon populations are due primarily to reductions in their prey. For pesticides like carbaryl, prey sensitivity and how quickly the prey community can recover are particularly important in determining the magnitude of impact on their predators. In considering both indirect and direct effects, we develop a better understanding of potential impacts of a chemical stressor on an endangered species and identify data gaps (e.g., prey recovery rates that contribute uncertainty to these

  10. An injectable acoustic transmitter for juvenile salmon

    Science.gov (United States)

    Deng, Z. D.; Carlson, T. J.; Li, H.; Xiao, J.; Myjak, M. J.; Lu, J.; Martinez, J. J.; Woodley, C. M.; Weiland, M. A.; Eppard, M. B.

    2015-01-01

    Salmon recovery and the potential detrimental effects of dams on fish have been attracting national attention due to the environmental and economic implications. In recent years acoustic telemetry has been the primary method for studying salmon passage. However, the size of the existing transmitters limits the minimum size of fish that can be studied, introducing a bias to the study results. We developed the first acoustic fish transmitter that can be implanted by injection instead of surgery. The new injectable transmitter lasts four times longer and weighs 30% less than other transmitters. Because the new transmitter costs significantly less to use and may substantially reduce adverse effects of implantation and tag burden, it will allow for study of migration behavior and survival of species and sizes of fish that have never been studied before. The new technology will lead to critical information needed for salmon recovery and the development of fish-friendly hydroelectric systems.

  11. Salmon: Robust Proxy Distribution for Censorship Circumvention

    Directory of Open Access Journals (Sweden)

    Douglas Frederick

    2016-10-01

    Full Text Available Many governments block their citizens’ access to much of the Internet. Simple workarounds are unreliable; censors quickly discover and patch them. Previously proposed robust approaches either have non-trivial obstacles to deployment, or rely on low-performance covert channels that cannot support typical Internet usage such as streaming video. We present Salmon, an incrementally deployable system designed to resist a censor with the resources of the “Great Firewall” of China. Salmon relies on a network of volunteers in uncensored countries to run proxy servers. Although any member of the public can become a user, Salmon protects the bulk of its servers from being discovered and blocked by the censor via an algorithm for quickly identifying malicious users. The algorithm entails identifying some users as especially trustworthy or suspicious, based on their actions. We impede Sybil attacks by requiring either an unobtrusive check of a social network account, or a referral from a trustworthy user.

  12. High feline trypsin-like immunoreactivity in a cat with pancreatitis and hepatic lipidosis.

    Science.gov (United States)

    Bruner, J M; Steiner, J M; Williams, D A; Van Alstine, W G; Blevins, W

    1997-06-15

    A 1.5-year-old domestic shorthair cat was examined because of vomiting and icterus. Clinicopathologic abnormalities included high alanine transaminase, alkaline phosphatase, and gamma-glutamyltransferase activities and high total bilirubin concentration. During abdominal ultrasonography, the left limb and body of the pancreas appeared hypoechoic, and a small quantity of peritoneal effusion was seen. The liver was diffusely hyperechoic, with echogenicity similar to that of the spleen, indicating hepatic lipidosis. Feline trypsin-like immunoreactivity was high, suggesting that the cat also had pancreatitis. The cat was treated with crystalloid fluids and was fed a protein-restricted diet via a percutaneous endoscopically placed gastrostomy tube. The cat's condition continued to deteriorate despite medical treatment, and it was euthanatized. Necropsy confirmed the clinical suspicion of acute pancreatitis and hepatic lipidosis. This case suggests that measurement of trypsin-like immunoreactivity may be useful in cats suspected of having pancreatitis.

  13. Structural and Chemical Characterization of Silica Spheres before and after Modification by Silanization for Trypsin Immobilization

    Directory of Open Access Journals (Sweden)

    Eduardo F. Barbosa

    2017-01-01

    Full Text Available In the last decades, silica particles of a variety of sizes and shapes have been characterized and chemically modified for several applications, from chromatographic separation to dental supplies. The present study proposes the use of aminopropyl triethoxysilane (APTS silanized silica particles to immobilize the proteolytic enzyme trypsin for the development of a bioreactor. The major advantage of the process is that it enables the polypeptides hydrolysis interruption simply by removing the silica particles from the reaction bottle. Silanized silica surfaces showed significant morphological changes at micro- and nanoscale level. Chemical characterization showed changes in elemental composition, chemical environment, and thermal degradation. Their application as supports for trypsin immobilization showed high immobilization efficiency at reduced immobilization times, combined with more acidic conditions. Indirect immobilization quantification by reversed-phase ultrafast high performance liquid chromatography proved to be a suitable approach due to its high linearity and sensitivity. Immobilized trypsin activities on nonmodified and silanized silica showed promising features (e.g., selective hydrolysis for applications in proteins/peptides primary structure elucidation for proteomics. Silanized silica system produced some preferential targeting peptides, probably due to the hydrophobicity of the nanoenvironment conditioned by silanization.

  14. Analysis of the production of salmon fillet - Prediction of production yield

    DEFF Research Database (Denmark)

    Johansson, Gine Ørnholt; Guðjónsdóttir, María; Nielsen, Michael Engelbrecht

    2017-01-01

    The aim was to investigate the influence of raw material variation in Atlantic salmon from aquaculture on filleting yield, and to develop a decision tool for choosing the appropriate raw material for optimized yield. This was achieved by tracking salmon on an individual level (n = 60) through...... a primary production site. The majority of the salmon exhibited a heavier right fillet compared to the left fillet after filleting. No explicit explanation was found for this observation although the heading procedure was shown to have a large impact. A Partial Least Square model was built to predict....... This may facilitate optimal planning of the production of salmon fillets by ordering and assigning the right batch to the right product category to obtain an optimal yield and quality....

  15. 77 FR 75570 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Salmon

    Science.gov (United States)

    2012-12-21

    .... 120330244-2673-02] RIN 0648-BB77 Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Salmon AGENCY... Plan for Salmon Fisheries in the EEZ off the Coast of Alaska (FMP). Amendment 12 comprehensively revises and updates the FMP to reflect the North Pacific Fishery Management Council's (Council) salmon...

  16. The effect of bound to dialdehudecellulose protein concentration on the activity of immobilized trypsin after γ-irradiation and in process of storage

    International Nuclear Information System (INIS)

    Belov, A.A.; Ryl'tsev, V.V.; Ignatyuk, T.E.; Filatov, V.N.

    1994-01-01

    It is found the complex effect of the bound enzyme concentration on the proteolytic activity of trypsin immobilized to dialdehydecellulose (preriodate oxidation) after γ-irradiation and in process of storage. It is shown the occurance of three stages of immobilized enzyme inactivation in process of immobilization and storage. The velocity of inactivation did not depend on bound trypsin concentration. The ratio of proteolytic activity of samples before and after γ-irradiation was increased with the increase of immobilized to carrier enzyme concentration and was not change (in range of experiment error) in process of storage. The results were compared with that of cryctlline trypsin

  17. Conformational flexibility in the catalytic triad revealed by the high-resolution crystal structure of Streptomyces erythraeus trypsin in an unliganded state

    Energy Technology Data Exchange (ETDEWEB)

    Blankenship, Elise; Vukoti, Krishna [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Miyagi, Masaru, E-mail: mxm356@cwru.edu [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Lodowski, David T., E-mail: mxm356@cwru.edu [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States)

    2014-03-01

    This work reports the first sub-angstrom resolution structure of S. erythraeus trypsin. The detailed model of a prototypical serine protease at a catalytically relevant pH with an unoccupied active site is presented and is compared with other high-resolution serine protease structures. With more than 500 crystal structures determined, serine proteases make up greater than one-third of all proteases structurally examined to date, making them among the best biochemically and structurally characterized enzymes. Despite the numerous crystallographic and biochemical studies of trypsin and related serine proteases, there are still considerable shortcomings in the understanding of their catalytic mechanism. Streptomyces erythraeus trypsin (SET) does not exhibit autolysis and crystallizes readily at physiological pH; hence, it is well suited for structural studies aimed at extending the understanding of the catalytic mechanism of serine proteases. While X-ray crystallographic structures of this enzyme have been reported, no coordinates have ever been made available in the Protein Data Bank. Based on this, and observations on the extreme stability and unique properties of this particular trypsin, it was decided to crystallize it and determine its structure. Here, the first sub-angstrom resolution structure of an unmodified, unliganded trypsin crystallized at physiological pH is reported. Detailed structural analysis reveals the geometry and structural rigidity of the catalytic triad in the unoccupied active site and comparison to related serine proteases provides a context for interpretation of biochemical studies of catalytic mechanism and activity.

  18. Conformational flexibility in the catalytic triad revealed by the high-resolution crystal structure of Streptomyces erythraeus trypsin in an unliganded state

    International Nuclear Information System (INIS)

    Blankenship, Elise; Vukoti, Krishna; Miyagi, Masaru; Lodowski, David T.

    2014-01-01

    This work reports the first sub-angstrom resolution structure of S. erythraeus trypsin. The detailed model of a prototypical serine protease at a catalytically relevant pH with an unoccupied active site is presented and is compared with other high-resolution serine protease structures. With more than 500 crystal structures determined, serine proteases make up greater than one-third of all proteases structurally examined to date, making them among the best biochemically and structurally characterized enzymes. Despite the numerous crystallographic and biochemical studies of trypsin and related serine proteases, there are still considerable shortcomings in the understanding of their catalytic mechanism. Streptomyces erythraeus trypsin (SET) does not exhibit autolysis and crystallizes readily at physiological pH; hence, it is well suited for structural studies aimed at extending the understanding of the catalytic mechanism of serine proteases. While X-ray crystallographic structures of this enzyme have been reported, no coordinates have ever been made available in the Protein Data Bank. Based on this, and observations on the extreme stability and unique properties of this particular trypsin, it was decided to crystallize it and determine its structure. Here, the first sub-angstrom resolution structure of an unmodified, unliganded trypsin crystallized at physiological pH is reported. Detailed structural analysis reveals the geometry and structural rigidity of the catalytic triad in the unoccupied active site and comparison to related serine proteases provides a context for interpretation of biochemical studies of catalytic mechanism and activity

  19. The tragedy of the commodity and the farce of AquAdvantage Salmon.

    Science.gov (United States)

    Clausen, Rebecca; Longo, Stefano B

    2012-01-01

    The US Food and Drug Administration is expected to approve AquAdvantage Salmon as the first genetically modified animal for human consumption. The genetic modifications allow the proprietary fish to grow at a rate twice as fast as a wild salmon, leading to greater ‘efficiency’ in terms of reduced costs and reduced time to market. This article provides an analysis of the ways in which AquAdvantage Salmon exemplifies capitalist market forces controlling and guiding the terms of salmon recovery and conservation. The authors trace historical developments within the salmon industry to demonstrate how capitalist commodity production has impacted fishing communities. They reject the oft-cited ‘tragedy of the commons’ hypothesis offered to explain fisheries crises. In its place, they offer the conceptual framework of the ‘tragedy of the commodity’ to explore how capitalist market forces and complicit state regulations amplify rather than resolve global environmental problems.

  20. An annotated bibliography for lamprey habitat in the White Salmon River, Washington

    Science.gov (United States)

    Allen, M. Brady

    2012-01-01

    The October 2011 decommissioning of Condit Dam on the White Salmon River at river kilometer (rkm) 5.3 removed a significant fish passage barrier from the White Salmon River basin for the first time in nearly a century. This affords an opportunity to regain a potentially important drainage basin for Pacific lamprey (Entosphenus tridentatus) production. In anticipation of Pacific lamprey recolonization or reintroduction, aquatic resource managers, such as the Yakama Nation (YN), are planning to perform surveys in the White Salmon River and its tributaries. The likely survey objectives will be to investigate the presence of lamprey, habitat conditions, and habitat availability. In preparation for this work, a compilation and review of the relevant aquatic habitat and biological information on the White Salmon River was conducted. References specific to the White Salmon River were collected and an annotated bibliography was produced including reports containing:

  1. Preparation of polymer brushes grafted graphene oxide by atom transfer radical polymerization as a new support for trypsin immobilization and efficient proteome digestion.

    Science.gov (United States)

    Guo, Cong; Zhao, Xinyuan; Zhang, Wanjun; Bai, Haihong; Qin, Weijie; Song, Haifeng; Qian, Xiaohong

    2017-08-01

    Highly efficient protein digestion is one of the key issues in the "bottom-up" strategy-based proteomic studies. Compared with the time-consuming solution-based free protease digestion, immobilized protease digestion offers a promising alternative with obviously improved sample processing throughput. In this study, we proposed a new immobilized protease digestion strategy using two kinds of polymer-grafted graphene oxide (GO) conjugated trypsin. The polymer brush grafted GO was prepared using in situ polymer growth on initiator-functionalized GO using surface-initiated atom transfer radical polymerization (SI-ATRP) and characterized by AFM, TEM, TGA, and XPS. The polymer brush grafted GO supports three-dimensional trypsin immobilization, which not only increases the loading amount but also improves accessibility towards protein substrates. Both of the two types of immobilized trypsin provide 700 times shorter digestion time, while maintaining comparable protein/peptide identification scale compared with that of free trypsin digestion. More interestingly, combined application of the two types of immobilized trypsin with different surface-grafted polymers leads to at least 18.3/31.3% enhancement in protein/peptide identification compared with that obtained by digestion using a single type, indicating the potential of this digestion strategy for deeper proteome coverage using limited mass spectrometer machine hour. We expect these advantages may find valuable application in high throughput clinical proteomic studies, which often involve processing of a large number of samples. Graphical abstract Preparation of polymer brushes grafted and trypsin immobilized graphene oxide and its application in proteome digestion and mass spectrometry identification.

  2. Ecological costs and benefits correlated with trypsin protease inhibitor production in Nicotiana attenuata

    NARCIS (Netherlands)

    Glawe, G.A.; Zavala, J.A.; Kessler, A.; Van Dam, N.M.; Baldwin, I.T.

    2003-01-01

    Genotypes of the wild tobacco Nicotiana attenuata from different geographic regions in North America vary considerably in the level of constitutive and inducible trypsin protease inhibitors (TrypPIs), a potent direct defense, as well as in the production of herbivore-induced volatiles that function

  3. Chemical properties and colors of fermenting materials in salmon fish sauce production

    Directory of Open Access Journals (Sweden)

    Mitsutoshi Nakano

    2018-02-01

    Full Text Available This data article reports the chemical properties (moisture, pH, salinity, and soluble solid content and colors of fermenting materials in salmon fish sauce products. The fish sauce was produced by mixing salt with differing proportions of raw salmon materials and fermenting for three months; the salmon materials comprised flesh, viscera, an inedible portion, and soft roe. Chemical properties and colors of the unrefined fish sauce (moromi, and the refined fish sauce, were analyzed at one, two, and three months following the start of fermentation. Data determined for all products are provided in table format. Keywords: Fish sauce, Chum salmon, Fermentation, Chemical properties, Color

  4. Efficacy and toxicity of iodine disinfection of Atlantic salmon eggs

    Science.gov (United States)

    Chalupnicki, M.A.; Ketola, H.G.; Starliper, C.E.; Gallagher, D.

    2011-01-01

    Recent interest in the restoration of Atlantic salmon Salmo salar in the Great Lakes has given rise to new culture techniques and management programs designed to reduce pathogen transmission while stabilizing and enhancing wild populations. We examined the toxicity of iodine to Atlantic salmon eggs and its effectiveness as a disinfectant against bacteria on egg surfaces. We spawned and fertilized eight gravid Atlantic salmon from Cayuga Lake, New York, and exposed their eggs to 10 concentrations of iodine (5, 10, 50, 75, 100, 500, 750, 1,000, 5,000, and 7,500 mg/L) for 30 min during water hardening. An additional subsample of unfertilized eggs was also exposed to some of the same concentrations of iodine (5, 10, 50, 75, and 100 mg/L) to determine the efficiency of disinfection. Viable eggs were only obtained from four females. Survival of eggs to the eyed stage and hatch tended to be reduced at iodine concentrations of 50 and 75 mg/L and was significantly reduced at concentrations of 100 mg/L iodine or more. We calculated the concentrations of iodine that killed 50% of the Atlantic salmon eggs at eye-up and hatch to be 175 and 85 mg/L, respectively. Aeromonas veronii, A. schubertii, A. hydrophila, A. caviae, Plesiomonas shiggeloides, and Citrobacter spp. were the predominant bacteria present on the surface of green eggs and were significantly reduced by an iodine immersion. The use of iodine as a disinfectant on Atlantic salmon eggs was effective at low concentrations (50–75 mg/L), for which toxicity to Atlantic salmon was minimal.

  5. 77 FR 21716 - Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Salmon

    Science.gov (United States)

    2012-04-11

    .... 120330244-2242-01] RIN 0648-BB77 Fisheries of the Exclusive Economic Zone Off Alaska; Pacific Salmon AGENCY... to the Fishery Management Plan for Salmon Fisheries in the EEZ off the Coast of Alaska (FMP). If... Management Council's (Council's) salmon management policy and to comply with Federal law. This proposed rule...

  6. Comparing life history characteristics of Lake Michigan’s naturalized and stocked Chinook Salmon

    Science.gov (United States)

    Kerns, Janice A; Rogers, Mark W.; Bunnell, David B.; Claramunt, Randall M.; Collingsworth, Paris D.

    2016-01-01

    Lake Michigan supports popular fisheries for Chinook Salmon Oncorhynchus tshawytscha that have been sustained by stocking since the late 1960s. Natural recruitment of Chinook Salmon in Lake Michigan has increased in the past few decades and currently contributes more than 50% of Chinook Salmon recruits. We hypothesized that selective forces differ for naturalized populations born in the wild and hatchery populations, resulting in divergent life history characteristics with implications for Chinook Salmon population production and the Lake Michigan fishery. First, we conducted a historical analysis to determine if life history characteristics changed through time as the Chinook Salmon population became increasingly naturalized. Next, we conducted a 2-year field study of naturalized and hatchery stocked Chinook Salmon spawning populations to quantify differences in fecundity, egg size, timing of spawning, and size at maturity. In general, our results did not indicate significant life history divergence between naturalized and hatchery-stocked Chinook Salmon populations in Lake Michigan. Although historical changes in adult sex ratio were correlated with the proportion of naturalized individuals, changes in weight at maturity were better explained by density-dependent factors. The field study revealed no divergence in fecundity, timing of spawning, or size at maturity, and only small differences in egg size (hatchery > naturalized). For the near future, our results suggest that the limited life history differences observed between Chinook Salmon of naturalized and hatchery origin will not lead to large differences in characteristics important to the dynamics of the population or fishery.

  7. Chinook Salmon Adult Abundance Monitoring in Lake Creek, Idaho, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Faurot, Dave; Kucera, Paul

    2003-11-01

    Underwater time- lapse video technology has been used to monitor adult spring and summer chinook salmon (Oncorhynchus tshawytscha) escapement into the Secesh River and Lake Creek, Idaho, since 1998. Underwater time-lapse videography is a passive methodology that does not trap or handle this Endangered Species Act listed species. Secesh River chinook salmon represent a wild spawning aggregate that has not been directly supplemented with hatchery fish. The Secesh River is also a control stream under the Idaho Salmon Supplementation study. This project has successfully demonstrated the application of underwater video monitoring to accurately quantify chinook salmon abundance in Lake Creek in 1998, 1999, 2001 and 2002. The adult salmon spawner escapement into Lake Creek in 2002 was 410 fish. Jack salmon comprised 7.1 percent of the run. Estimated hatchery composition was 6.1 percent of the spawning run. The first fish passage on Lake Creek was recorded on June 26, 15 days after installation of the fish counting station. Peak net upstream movement of 41 adults occurred on July 8. Peak of total movement activity was August 18. The last fish passed through the Lake Creek fish counting station on September 2. Snow pack in the drainage was 91% of the average during the winter of 2001/2002. Video determined salmon spawner abundance was compared to redd count expansion method point estimates in Lake Creek in 2002. Expanded index area redd count and extensive area redd count point estimates in 2002, estimated from one percent fewer to 56 percent greater number of spawners than underwater video determined spawner abundance. Redd count expansion methods varied from two percent fewer to 55 percent greater in 2001, 11 to 46 percent fewer in 1999 and 104 to 214 percent greater in 1998. Redd count expansion values had unknown variation associated with the point estimates. Fish per redd numbers determined by video abundance and multiple pass redd counts of the larger extensive survey

  8. Captive Rearing Program for Salmon River Chinook Salmon, 2000 Project Progress Report.

    Energy Technology Data Exchange (ETDEWEB)

    Venditti, David A.

    2002-04-01

    During 2000, the Idaho Department of Fish and Game (IDFG) continued to develop techniques to rear chinook salmon Oncorhynchus tshawytscha to sexual maturity in captivity and to monitor their reproductive performance under natural conditions. Eyed-eggs were collected to establish captive cohorts from three study streams and included 503 eyed-eggs from East Fork Salmon River (EFSR), 250 from the Yankee Fork Salmon River, and 304 from the West Fork Yankee Fork Salmon River (WFYF). After collection, the eyed-eggs were immediately transferred to the Eagle Fish Hatchery, where they were incubated and reared by family group. Juveniles collected the previous summer were PIT and elastomer tagged and vaccinated against vibrio Vibrio spp. and bacterial kidney disease before the majority (approximately 75%) were transferred to the National Marine Fisheries Service, Manchester Marine Experimental Station for saltwater rearing through sexual maturity. Smolt transfers included 158 individuals from the Lemhi River (LEM), 193 from the WFYF, and 372 from the EFSR. Maturing fish transfers from the Manchester facility to the Eagle Fish Hatchery included 77 individuals from the LEM, 45 from the WFYF, and 11 from the EFSR. Two mature females from the WFYF were spawned in captivity with four males in 2000. Only one of the females produced viable eggs (N = 1,266), which were placed in in-stream incubators by personnel from the Shoshone-Bannock Tribe. Mature adults (N = 70) from the Lemhi River were released into Big Springs Creek to evaluate their reproductive performance. After release, fish distributed themselves throughout the study section and displayed a progression of habitat associations and behavior consistent with progressing maturation and the onset of spawning. Fifteen of the 17 suspected redds spawned by captive-reared parents in Big Springs Creek were hydraulically sampled to assess survival to the eyed stage of development. Eyed-eggs were collected from 13 of these, and

  9. Sexual difference in PCB concentrations of coho salmon (Oncorhynchus kisutch)

    Science.gov (United States)

    Madenjian, Charles P.; Schrank, Candy S.; Begnoche, Linda J.; Elliott, Robert F.; Quintal, Richard T.

    2010-01-01

    We determined polychlorinated biphenyl (PCB) concentrations in 35 female coho salmon (Oncorhynchus kisutch) and 60 male coho salmon caught in Lake Michigan (Michigan and Wisconsin, United States) during the fall of 1994 and 1995. In addition, we determined PCB concentrations in the skin-on fillets of 26 female and 19 male Lake Michigan coho salmon caught during the fall of 2004 and 2006. All coho salmon were age-2 fish. These fish were caught prior to spawning, and therefore release of eggs could not account for sexual differences in PCB concentrations because female coho salmon spawn only once during their lifetime. To investigate whether gross growth efficiency (GGE) differed between the sexes, we applied bioenergetics modeling. Results showed that, on average, males were 19% higher in PCB concentration than females, based on the 1994–1995 dataset. Similarly, males averaged a 20% higher PCB concentration in their skin-on fillets compared with females. According to the bioenergetics modeling results, GGE of adult females was less than 1% higher than adult male GGE. Thus, bioenergetics modeling could not explain the 20% higher PCB concentration exhibited by the males. Nonetheless, a sexual difference in GGE remained a plausible explanation for the sexual difference in PCB concentrations.

  10. [Exogenous Sr2+ sedimentation on otolith of chum salmon embryos].

    Science.gov (United States)

    Wang, Chen; Liu, Wei; Zhan, Pei-rong; Wang, Ji-long; Li, Pei-lun

    2015-10-01

    To explore the exogenous Sr2+ sedimentation on otolith of chum salmon embryos, chum salmon embryos were exposed to culture water contained Sr2+ at Sr2+ concentration of 50, 100, 200 or 400 mg . L-1 for 48 h to imitate Sr2+ sedimentation. After a culturing period of 12 d and 100 d, the otoliths of the chum salmon were taken to detect exogenous Sr2+ sedimentation with electro-probe microanalyzer (EPMA). The results showed that obvious deep red strontium signatures were produced in the otolith of chum salmon at different concentrations of Sr2+. The mean and extreme values of peak strontium area were not stable for the same Sr2+ dose, but the lowest of all the peak values was 35.1 times as much as that of control. Overall, the strontium value increased with the increase of Sr2+concentration. The strontium peak had no signs of abating after a culture period of 100 d. The results also showed that strontium was gradually deposited in the otolith, and had obvious hysteresis to immersion. Strontium sedimentation could also return to a normal level after the peak. These characteristics accorded exactly with the requirement of discharge tag technology, which indicated that exogenous Sr2+ was suitable in the marking of salmon otolith.

  11. Snake River Sockeye Salmon Habitat and Limnological Research; 2003 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Taki, Doug; Kohler, Andre E. (Shoshone-Bannock Tribes, Fort Hall, ID); Griswold, Robert G. (Biolines, Stanley, ID)

    2004-01-01

    In March 1990, the Shoshone-Bannock Tribes petitioned the National Marine Fisheries Service (NMFS) to list the Snake River sockeye salmon (Oncorhynchus nerka) as endangered. As a result of that petition, the Snake River sockeye salmon was officially listed as endangered in November 1991 under the Endangered Species Act (56 FR 58619). In 1991, the Snake River Sockeye Salmon Habitat and Limnological Research Program was implemented (Project Number 1991-071-00). This project is part of an interagency effort to prevent the extinction of the Redfish Lake stock of sockeye salmon. The Shoshone-Bannock Tribal goal for this project is two tiered: The immediate goal is to increase the population of Snake River sockeye salmon while preserving the unique genetic characteristics of the Evolutionarily Significant Unit (ESU). The Tribes long term goal is to maintain a viable population that warrants delisting and provides Tribal harvest opportunities. The Bonneville Power Administration (BPA) provides funding for this interagency recovery program through the Northwest Power and Conservation Council Fish and Wildlife Program (NPCCFWP). Collaborators in the recovery effort include the National Oceanic and Atmospheric Administration (NOAA), the Idaho Department of Fish and Game (IDFG), the University of Idaho (UI), and the Shoshone-Bannock Tribes (SBT). This report summarizes activities conducted by Shoshone-Bannock Tribal Fisheries Department personnel during the 2003 calendar year. Project objectives include: (1) monitor limnological parameters of the Sawtooth Valley lakes to assess lake productivity; (2) reduce the number of mature kokanee spawning in Fishhook Creek; (3) monitor sockeye salmon smolt migration from the captive rearing program release of juveniles into Pettit and Alturas lakes; (4) monitor spawning kokanee escapement and estimate fry recruitment in Fishhook, Alturas Lake, and Stanley Lake creeks; (5) conduct sockeye and kokanee salmon population surveys; (6

  12. Aqueous exposure to Aroclor 1254 modulates the mitogenic response of Atlantic salmon anterior kidney T-cells: indications of short- and long-term immunomodulation.

    Science.gov (United States)

    Iwanowicz, Luke R; Lerner, Darren T; Blazer, Vicki S; McCormick, Stephen D

    2005-05-15

    Polychlorinated biphenyls (PCBs) exist as persistent organic pollutants in numerous river systems in the United States. Unfortunately, some of these rivers are sites of active Atlantic salmon restoration programs, and polychlorinated biphenyls have been implicated as ancillary factors contributing to failed salmon restoration. Here, we investigate the immediate and chronic effects of intermediate duration aqueous PCB exposure (1 or 10 microgL-1 Aroclor 1254) on the mitogen-stimulated lymphoproliferative response of Atlantic salmon anterior kidney leukocytes (AKLs). A short-term study was designed to examine immunomodulation in Atlantic salmon smolts immediately following 21 days of aqueous exposure, while a long-term study evaluated chronic impacts in the mitogen response in parr 15 months post-exposure as larvae. The proliferative response of AKLs to the mitogens concanavalin A (CON A), phytohemaglutinnin-P (PHA-P), pokeweed mitogen (PWM), and lipopolysaccharide were used as an indice of immunomodulation. The proliferative response to the T-cell mitogens CON A and PHA-P was significantly increased in the 10 microgL-1 group (n=10; P=0.043 and 0.002, respectively) immediately following exposure of smolts. Additionally, The PHA-P response was significantly increased in the 1 microgL-1 exposure group (n=10, P=0.036). In fish treated as larvae and tested 15 months later, the PHA-P sensitive populations exhibited elevated proliferation in the 1 and 10 microgL-1 groups (n=12, P<0.04) relative to the vehicle control while the PWM response was significantly increased (n=12, P=0.036) only in the 10 microgL-1 treated groups. These results demonstrate an immunomodulatory effect of PCBs on T-cell mitogen sensitive populations of lymphocytes in Atlantic salmon as well as long-term immunomodulation in PHA-P and PWM sensitive populations.

  13. Adaptation Turning Points in River Restoration? The Rhine salmon case

    NARCIS (Netherlands)

    Bölscher, T.; Slobbe, van E.J.J.; Vliet, van M.T.H.; Werners, S.E.

    2013-01-01

    Abstract: Bringing a sustainable population of Atlantic salmon (Salmo salar) back into the Rhine, after the species became extinct in the 1950s, is an important environmental ambition with efforts made both by governments and civil society. Our analysis finds a significant risk of failure of salmon

  14. Evaluation of the Contribution of Fall Chinook Salmon Reared at Columbia River Hatcheries to the Pacific Salmon Fisheries, 1989 Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Vreeland, Robert R.

    1989-10-01

    In 1979 this study was initiated to determine the distribution, contribution, and value of artificially propagated fall chinook salmon from the Columbia River. Coded wire tagging (CWT) of hatchery fall chinook salmon began in 1979 with the 1978 brood and was completed in 1982 with the 1981 brood of fish at rearing facilities on the Columbia River system. From 18 to 20 rearing facilities were involved in the study each brood year. Nearly 14 million tagged fish, about 4% of the production, were released as part of this study over the four years, 1979 through 1982. Sampling for recoveries of these tagged fish occurred from 1980 through 1986 in the sport and commercial marine fisheries from Alaska through California, Columbia River fisheries, and returns to hatcheries and adjacent streams. The National Marine Fisheries Service coordinated this study among three fishery agencies: US Fish and Wildfire Service, Oregon Department of Fish and Wildlife, and Washington Department of Fisheries. The objectives of this study were to determine the distribution, fishery contribution, survival, and value of the production of fall chinook salmon from each rearing facility on the Columbia River system to Pacific coast salmon fisheries. To achieve these objectives fish from each hatchery were given a distinctive CWT. 81 refs., 20 figs., 68 tabs.

  15. Free polyunsaturated fatty acids cause taste deterioration of salmon during frozen storage

    DEFF Research Database (Denmark)

    Refsgaard, Hanne; Brockhoff, P.M.B.; Jensen, Benny

    2000-01-01

    Increased intensity of train oil taste, bitterness, and metal taste are the most pronounced sensory changes during frozen storage of salmon (Refsgaard, H. H. F.; Brockhoff, P. B.; Jensen, B. Sensory and Chemical Changes in Farmed Atlantic Salmon (Salmo salar) during Frozen Storage. J. Agric. Food...... Chem. 1998a, 46, 3473-3479). Addition of each of the unsaturated fatty acids: palmitoleic acid (16:1, n - 7), linoleic acid (C18:2, it - 6), eicosapentaenoic acid (EPA; C20:5, it - 3) and docosahexaenoic acid (DHA; C22:6, n. - 3) to fresh minced salmon changed the sensory perception and increased...... the intensity of train oil taste, bitterness, and metal taste. The added level of each fatty acid (similar to 1 mg/g salmon meat) was equivalent to the concentration of the fatty acids determined in salmon stored as fillet at -10 degrees C for 6 months. The effect of addition of the fatty acids on the intensity...

  16. 76 FR 36896 - Salmon-Challis National Forest, ID; Forestwide Invasive Plant Treatment Environmental Impact...

    Science.gov (United States)

    2011-06-23

    ... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, ID; Forestwide Invasive... to the biological diversity and ecological integrity within and outside the Salmon-Challis National... loss of recreational opportunities. Within the 3,108,904 acres of the of the Salmon-Challis National...

  17. Accelerated recovery of Atlantic salmon (Salmo salar) from effects of crowding by swimming.

    Science.gov (United States)

    Veiseth, Eva; Fjaera, Svein Olav; Bjerkeng, Bjørn; Skjervold, Per Olav

    2006-07-01

    The effects of post-crowding swimming velocity (0, 0.35, and 0.70 m/s) and recovery time (1.5, 6, and 12 h) on physiological recovery and processing quality parameters of adult Atlantic salmon (Salmo salar) were determined. Atlantic salmon crowded to a density similar to that of a commercial slaughter process (>200 kg/m(3), 40 min) were transferred to a swimming chamber for recovery treatment. Osmolality and concentrations of cortisol, glucose and lactate in blood plasma were used as physiological stress indicators, whereas image analyses of extent and duration of rigor contraction, and fillet gaping were used as measures of processing quality. Crowded salmon had a 5.8-fold higher plasma cortisol concentration than control salmon (Prigor mortis contraction. However, subjecting crowded salmon to active swimming for 6 h before slaughter delayed the onset of rigor mortis contraction from 2.5 to 7.5 h post mortem. The extent of rigor mortis contraction was also affected by crowding and post-stress swimming activity (Prigor mortis contraction, which has a positive technological implication for the salmon processing industry.

  18. Research on Captive Broodstock Programs for Pacific Salmon, 2001-2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Berejikian, Barry; Tezak, E.; Endicott, Rick

    2002-08-01

    The efficacy of captive broodstock programs depends on high in-culture survival and the fitness of cultured salmon after release, either as adults or juveniles. Continuing captive broodstock research designed to improve technology is being conducted to cover all major life history stages of Pacific salmon. The following summarizes some of the work performed and results from the FY 2001 performance period: (1) The incidence of male maturation of age-1 chinook salmon was significantly reduced by reducing growth in the first year of rearing. (2) Experimentally manipulated growth rates of captively-reared coho salmon had significant effects on female maturation rate, egg size, and fecundity, and the effects were stage-specific (i.e., pre-smolt vs. post-smolt). (3) A combination of Renogen and MT239 vaccination of yearling chinook salmon given an acute R. salmoninarum challenge had a significantly longer survival time than the mock-vaccinated group. The survival time was marginally higher than was seen in acutely challenged fish vaccinated with either Renogen or MT239 alone and suggests that a combination vaccine of Renogen and MT239 may be useful as both a prophylactic and therapeutic agent against BKD. (4) Full-sib (inbred) groups of chinook salmon have thus far exhibited lower ocean survival than half-sib and non-related groups. Effects of inbreeding on fluctuating asymmetry did not follow expected patterns. (5) Sockeye salmon were exposed to specific odorants at either the alevin/emergent fry stage or the smolt stage to determine the relative importance of odorant exposure during key developmental periods and the importance of exposure duration. (6) Experimental studies to determine the effects of exercise conditioning on steelhead reproductive behavior and the effects of male body size on chinook salmon fertilization success during natural spawning were completed.

  19. The refined 2.0 A X-ray crystal structure of the complex formed between bovine beta-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topological similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes.

    Science.gov (United States)

    Bode, W; Greyling, H J; Huber, R; Otlewski, J; Wilusz, T

    1989-01-02

    The stoichiometric complex formed between bovine beta-trypsin and the Cucurbita maxima trypsin inhibitor I (CMTI-I) was crystallized and its X-ray crystal structure determined using Patterson search techniques. Its structure has been crystallographically refined to a final R value of 0.152 (6.0-2.0 A). CMTI-I is of ellipsoidal shape; it lacks helices or beta-sheets, but consists of turns and connecting short polypeptide stretches. The disulfide pairing is CYS-3I-20I, Cys-10I-22I and Cys-16I-28I. According to the polypeptide fold and disulfide connectivity its structure resembles that of the carboxypeptidase A inhibitor from potatoes. Thirteen of the 29 inhibitor residues are in direct contact with trypsin; most of them are in the primary binding segment Val-2I (P4)-Glu-9I (P4') which contains the reactive site bond Arg-5I-Ile-6I and is in a conformation observed also for other serine proteinase inhibitors.

  20. Juvenile Chinook Salmon mortality in a Snake River Reservoir: Smallmouth Bass predation revisited

    Science.gov (United States)

    Erhardt, John M.; Tiffan, Kenneth F.; Connor, William P.

    2018-01-01

    Predation by nonnative fishes has been identified as a contributing factor in the decline of juvenile salmonids in the Columbia River basin. We examined the diet composition of Smallmouth Bass Micropterus dolomieu and estimated the consumption and predation loss of juvenile Chinook Salmon Oncorhynchus tshawytscha in Lower Granite Reservoir on the Snake River. We examined 4,852 Smallmouth Bass stomachs collected from shoreline habitats during April–September 2013–2015. Chinook Salmon were the second most commonly consumed fish by all size‐classes of Smallmouth Bass (≥150 mm TL) throughout the study. Over the 3 years studied, we estimated that a total of 300,373 Chinook Salmon were consumed by Smallmouth Bass in our 22‐km study area, of which 97% (291,884) were subyearlings (age 0) based on length frequency data. A majority of the loss (61%) occurred during June, which coincided with the timing of hatchery releases of subyearling fall Chinook Salmon. Compared to an earlier study, mean annual predation loss increased more than 15‐fold from 2,670 Chinook Salmon during 1996–1997 to 41,145 Chinook Salmon during 2013–2015 (in reaches that could be compared), despite lower contemporary Smallmouth Bass abundances. This increase can be explained in part by increases in Smallmouth Bass consumption rates, which paralleled increases in subyearling Chinook Salmon densities—an expected functional response by an opportunistic consumer. Smallmouth Bass are currently significant predators of subyearling Chinook Salmon in Lower Granite Reservoir and could potentially be a large source of unexplained mortality.

  1. Do beaver dams reduce habitat connectivity and salmon productivity in expansive river floodplains?

    Science.gov (United States)

    Malison, Rachel L; Kuzishchin, Kirill V; Stanford, Jack A

    2016-01-01

    Beaver have expanded in their native habitats throughout the northern hemisphere in recent decades following reductions in trapping and reintroduction efforts. Beaver have the potential to strongly influence salmon populations in the side channels of large alluvial rivers by building dams that create pond complexes. Pond habitat may improve salmon productivity or the presence of dams may reduce productivity if dams limit habitat connectivity and inhibit fish passage. Our intent in this paper is to contrast the habitat use and production of juvenile salmon on expansive floodplains of two geomorphically similar salmon rivers: the Kol River in Kamchatka, Russia (no beavers) and the Kwethluk River in Alaska (abundant beavers), and thereby provide a case study on how beavers may influence salmonids in large floodplain rivers. We examined important rearing habitats in each floodplain, including springbrooks, beaver ponds, beaver-influenced springbrooks, and shallow shorelines of the river channel. Juvenile coho salmon dominated fish assemblages in all habitats in both rivers but other species were present. Salmon density was similar in all habitat types in the Kol, but in the Kwethluk coho and Chinook densities were 3-12× lower in mid- and late-successional beaver ponds than in springbrook and main channel habitats. In the Kol, coho condition (length: weight ratios) was similar among habitats, but Chinook condition was highest in orthofluvial springbrooks. In the Kwethluk, Chinook condition was similar among habitats, but coho condition was lowest in main channel versus other habitats (0.89 vs. 0.99-1.10). Densities of juvenile salmon were extremely low in beaver ponds located behind numerous dams in the orthofluvial zone of the Kwethluk River floodplain, whereas juvenile salmon were abundant in habitats throughout the entire floodplain in the Kol River. If beavers were not present on the Kwethluk, floodplain habitats would be fully interconnected and theoretically

  2. Evidence for a Peripheral Olfactory Memory in Imprinted Salmon

    Science.gov (United States)

    Nevitt, Gabrielle A.; Dittman, Andrew H.; Quinn, Thomas P.; Moody, William J., Jr.

    1994-05-01

    The remarkable homing ability of salmon relies on olfactory cues, but its cellular basis is unknown. To test the role of peripheral olfactory receptors in odorant memory retention, we imprinted coho salmon (Oncorhynchus kisutch) to micromolar concentrations of phenyl ethyl alcohol during parr-smolt transformation. The following year, we measured phenyl ethyl alcohol responses in the peripheral receptor cells using patch clamp. Cells from imprinted fish showed increased sensitivity to phenyl ethyl alcohol compared either to cells from naive fish or to sensitivity to another behaviorally important odorant (L-serine). Field experiments verified an increased behavioral preference for phenyl ethyl alcohol by imprinted salmon as adults. Thus, some component of the imprinted olfactory homestream memory appears to be retained peripherally.

  3. Collagenolytic serine protease PC and trypsin PC from king crab Paralithodes camtschaticus: cDNA cloning and primary structure of the enzymes

    Directory of Open Access Journals (Sweden)

    Rebrikov Denis V

    2004-01-01

    Full Text Available Abstract Background In this paper, we describe cDNA cloning of a new anionic trypsin and a collagenolytic serine protease from king crab Paralithodes camtschaticus and the elucidation of their primary structures. Constructing the phylogenetic tree of these enzymes was undertaken in order to prove the evolutionary relationship between them. Results The mature trypsin PC and collagenolytic protease PC contain 237 (Mcalc 24.8 kDa and 226 amino acid residues (Mcalc 23.5 kDa, respectively. Alignments of their amino acid sequences revealed a high degree of the trypsin PC identity to the trypsin from Penaeus vannamei (approximately 70% and of the collagenolytic protease PC identity to the collagenase from fiddler crab Uca pugilator (76%. The phylogenetic tree of these enzymes was constructed. Conclusions Primary structures of the two mature enzymes from P. camtschaticus were obtained and compared with those of other proteolytic proteins, including some enzymes from brachyurans. A phylogenetic analysis was also carried out. These comparisons revealed that brachyurins are closely related to their vertebrate and bacterial congeners, occupy an intermediate position between them, and their study significantly contributes to the understanding of the evolution and function of serine proteases.

  4. Effect of Inclusion of Salmon Roe on Characteristics of Salmon Baby Food Products

    Science.gov (United States)

    Baby food was formulated from sockeye salmon (puree alone, puree +chunks, puree +pink row, puree +pink row +chunks, puree +red row, puree +red roe +chunks). In the 1st study, physical (pH, instrumental color, water activity) and descriptive sensory (odor, flavor, texture, visual color) characteristi...

  5. Regional-Scale Declines in Productivity of Pink and Chum Salmon Stocks in Western North America

    Science.gov (United States)

    Malick, Michael J.; Cox, Sean P.

    2016-01-01

    Sockeye salmon (Oncorhynchus nerka) stocks throughout the southern part of their North American range have experienced declines in productivity over the past two decades. In this study, we tested the hypothesis that pink (O. gorbuscha) and chum (O. keta) salmon stocks have also experienced recent declines in productivity by investigating temporal and spatial trends in productivity of 99 wild North American pink and chum salmon stocks. We used a combination of population dynamics and time series models to quantify individual stock trends as well as common temporal trends in pink and chum salmon productivity across local, regional, and continental spatial scales. Our results indicated widespread declines in productivity of wild chum salmon stocks throughout Washington (WA) and British Columbia (BC) with 81% of stocks showing recent declines in productivity, although the exact form of the trends varied among regions. For pink salmon, the majority of stocks in WA and BC (65%) did not have strong temporal trends in productivity; however, all stocks that did have trends in productivity showed declining productivity since at least brood year 1996. We found weaker evidence of widespread declines in productivity for Alaska pink and chum salmon, with some regions and stocks showing declines in productivity (e.g., Kodiak chum salmon stocks) and others showing increases (e.g., Alaska Peninsula pink salmon stocks). We also found strong positive covariation between stock productivity series at the regional spatial scale for both pink and chum salmon, along with evidence that this regional-scale positive covariation has become stronger since the early 1990s in WA and BC. In general, our results suggest that common processes operating at the regional or multi-regional spatial scales drive productivity of pink and chum salmon stocks in western North America and that the effects of these process on productivity may change over time. PMID:26760510

  6. AFSC/ABL: Adult Pink Salmon Predation in Prince William Sound and Southeast Alaska, 2009-2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The project objectives were to assess potential salmon predation impact on juvenile salmon and herring by: (1) comparing diets of adult pink salmon during their...

  7. Proton NMR studies of Cucurbita maxima trypsin inhibitors: Evidence for pH-dependent conformational change and his25 - try27 interaction

    Energy Technology Data Exchange (ETDEWEB)

    Krishnamoorthi, R.; Chanlan Sun Lin; Yuxi Gong (Kansas State Univ., Manhattan (United States)); VanderVelde, D. (Univ. of Kansas, Lawrence (United States)); Hahn, K. (Univ. of Colorado, Denver (United States))

    1992-01-28

    A pH-dependent His25-Tyr27 interaction was demonstrated in the case of Cucurbita maxima trypsin inhibitors (CMTI-I and CMTI-III) by means of nuclear magnetic resonance (NMR) spectroscopy. pH titration, line widths, peak shapes, deuterium exchange kinetics, and two-dimensional nuclear Overhauser effect spectroscopy (NOESY) were employed to characterize a conformational change involving Tyr27, which was shown to be triggered by deprotonation of His25 around pH 6. A hydrogen bond is proposed to be formed between N{sub {epsilon}} of His25 and OH of Tyr27, as a distance between the atoms, His25 N{epsilon} and Tyr25 OH, of 3.02 {angstrom} is consistent with a model built with NOE-derived distance constraints. The presently characterized relative orientations of His25 and Tyr27 are of functional significance, as these residues make contact with the enzyme in the enzyme-inhibitor complex. Furthermore, trypsin assay and inhibitor-binding studies showed that conformations of trypsin and the squash inhibitor complex. Furthermore, trypsin assay and inhibitor-binding studies showed that conformations of trypsin and the squash inhibitor were functionally relevant only in the pH range 6-8. The pK{sub a} of His25 was determined and found to be influenced by Glu9/Lys substitution and by the hydrolysis of the reactive-site peptide bond between Arg5 and Ile6. As these sites are located far (>10 {angstrom}) from His25, the results point out conformational changes that are propagated to a distant site in the protein molecule.

  8. Modelling the return distribution of salmon farming companies : a quantile regression approach

    OpenAIRE

    Jacobsen, Fredrik

    2017-01-01

    The salmon farming industry has gained increased attention from investors, portfolio managers, financial analysts and other stakeholders the recent years. Despite this development, very little is known about the risk and return of salmon farming company stocks, and especially how the relationship between risk and return varies under different market conditions, given the volatile nature of the salmon farming industry. We approach this problem by using quantile regression to examine the relati...

  9. Chemical data for 7 streams in Salmon River Basin - Importance of biotic and abiotic features of salmon habitat implications for juvenile Chinook and steelhead growth and survival

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is a large-scale, long-term comparative study that includes many streams (20+ streams in the Salmon River Basin, Idaho, including a few non-salmon streams for...

  10. DANUBE SALMON (HUCHO HUCHO L.. THEMATIC BIBLIOGRAPHY

    Directory of Open Access Journals (Sweden)

    I. Hrytsynyak

    2015-09-01

    Full Text Available Purpose. Creating of the thematic bibliographic list of publications dedicated to ecological and zoogeographical, morphological and biological, physiological, biochemical and genetic characteristics of the Danube salmon, as well as to its cultivation in Ukraine and abroad. Methodology. In the process of systematic search complete and selective methods were applied. The bibliographic core have been formed by the literature from the fund of scientific library of the Institute of Fisheries NAAS. Findings. There was composed the thematic list of publications in a quantity of 100 sources, containing characteristics of Danube salmon as representative of salmonids. Literary sources was arranged in alphabetical order by author or title, and described according to DSTU 7.1:2006 «System of standards on information, librarianship and publishing. Bibliographic entry. Bibliographic description. General requirements and rules», as well as in accordance with the requirements of APA style – international standard of references. Practical value. The list may be useful for scientists, practitioners, students, whose area of interests covers the questions of breeding, and researching of the salmon biological features.

  11. Migration trends of Sockeye Salmon at the northern edge of their distribution

    Science.gov (United States)

    Carey, Michael P.; Zimmerman, Christian E.; Keith, Kevin D.; Schelske, Merlyn; Lean, Charles; Douglas, David C.

    2017-01-01

    Climate change is affecting arctic and subarctic ecosystems, and anadromous fish such as Pacific salmon Oncorhynchus spp. are particularly susceptible due to the physiological challenge of spawning migrations. Predicting how migratory timing will change under Arctic warming scenarios requires an understanding of how environmental factors drive salmon migrations. Multiple mechanisms exist by which environmental conditions may influence migrating salmon, including altered migration cues from the ocean and natal river. We explored relationships between interannual variability and annual migration timing (2003–2014) of Sockeye Salmon O. nerka in a subarctic watershed with environmental conditions at broad, intermediate, and local spatial scales. Low numbers of Sockeye Salmon have returned to this high-latitude watershed in recent years, and run size has been a dominant influence on the migration duration and the midpoint date of the run. The duration of the migration upriver varied by as much as 25 d across years, and shorter run durations were associated with smaller run sizes. The duration of the migration was also extended with warmer sea surface temperatures in the staging area and lower values of the North Pacific Index. The midpoint date of the total run was earlier when the run size was larger, whereas the midpoint date was delayed during years in which river temperatures warmed earlier in the season. Documenting factors related to the migration of Sockeye Salmon near the northern limit of their range provides insights into the determinants of salmon migrations and suggests processes that could be important for determining future changes in arctic and subarctic ecosystems.

  12. Bedform morphology of salmon spawning areas in a large gravel-bed river

    Energy Technology Data Exchange (ETDEWEB)

    Hanrahan, Timothy P.

    2007-05-01

    While the importance of river channel morphology to salmon spawning habitat is increasingly recognized, quantitative measures of the relationships between channel morphology and habitat use are lacking. Such quantitative measures are necessary as management and regulatory agencies within the Pacific Northwestern region of the USA, and elsewhere, seek to quantify potential spawning habitat and develop recovery goals for declining salmon populations. The objective of this study was to determine if fall Chinook salmon (Oncorhynchus tshawytscha) spawning areas in the Snake River, Idaho, USA, were correlated with specific bed form types at the pool-riffle scale. A bed form differencing technique was used to objectively quantify the longitudinal riverbed profile into four distinct pool-riffle units that were independent of discharge. The vertical location of thalweg points within these units was quantified with a riffle proximity index. Chinook salmon spawning areas were mapped and correlated with the pool-riffle units through the use of cross-tabulation tables. The results indicate that 84% of fall Chinook salmon spawning areas were correlated with riffles (Chi-square=152.1, df=3, p<0.001), with 53% of those areas located on the upstream side of riffle crests. The majority of Snake River fall Chinook salmon spawning occurred at a vertical location within 80% of the nearest riffle crest elevation. The analyses of bed form morphology will assist regional fish mangers in quantifying existing and potential fall Chinook salmon spawning habitat, and will provide a quantitative framework for evaluating general ecological implications of channel morphology in large gravel-bed rivers.

  13. Comparison of various molecular forms of bovine trypsin: Correlation of infrared spectra with X-ray crystal structures

    Energy Technology Data Exchange (ETDEWEB)

    Prestrelski, S.J. (Mount Sinai School of Medicine of the City Univ. of New York (USA)); Byler, D.M. (U.S. Department of Agriculture, Philadelphia, PA (USA)); Liebman, M.N. (AMOCO Technology Corporation, Naperville, IL (USA))

    1991-01-01

    Fourier-transform infrared spectroscopy is a valuable method for the study of protein conformation in solution primarily because of the sensitivity to conformation of the amide I band (1700-1620 cm{sup {minus}1}) which arises from the backbone C{double bond}O stretching vibration. Combined with resolution-enhancement techniques such as derivative spectroscopy and self-deconvolution, plus the application of iterative curve-fitting techniques, this method provides a wealth of information concerning protein secondary structure. Further extraction of conformational information from the amide I band is dependent upon discerning the correlations between specific conformation types and component bands in the amide I region. In this paper the authors report spectra-structure correlations derived from conformational perturbations in bovine trypsin which arise from autolytic processing, zymogen activation, and active-site inhibition. IR spectra were collected for the single-chain ({beta}-trypsin) and once-cleaved, double-chain ({alpha}-trypsin) forms as well as at various times during the course of autolysis and also for zymogen, trypsinogen, and {beta}-trypsin inhibited with diisopropyl fluorophosphate. Spectral differences among the various molecular forms were interpreted in light of previous biochemical studies of autolysis and the known three-dimensional structures of the zymogen, the active enzyme, and the DIP-inhibited form. The spectroscopic results from these proteins in D{sub 2}O imply that certain loop structures may absorb in the region of 1655 cm{sup {minus}1}. They estimate that this approach to data analysis and interpretation is sensitive to changes of 0.01 unit or less in the relative integrated intensities of component bands in spectra whose peaks are well resolved.

  14. Impact of early salmon louse, Lepeophtheirus salmonis, infestation and differences in survival and marine growth of sea-ranched Atlantic salmon, Salmo salar L., smolts 1997–2009

    Science.gov (United States)

    Skilbrei, O T; Finstad, B; Urdal, K; Bakke, G; Kroglund, F; Strand, R

    2013-01-01

    The impact of salmon lice on the survival of migrating Atlantic salmon smolts was studied by comparing the adult returns of sea-ranched smolts treated for sea lice using emamectin benzoate or substance EX with untreated control groups in the River Dale in western Norway. A total of 143 500 smolts were released in 35 release groups in freshwater from 1997 to 2009 and in the fjord system from 2007 to 2009. The adult recaptures declined gradually with release year and reached minimum levels in 2007. This development corresponded with poor marine growth and increased age at maturity of ranched salmon and in three monitored salmon populations and indicated unfavourable conditions in the Norwegian Sea. The recapture rate of treated smolts was significantly higher than the controls in three of the releases performed: the only release in 1997, one of three in 2002 and the only group released in sea water in 2007. The effect of treating the smolts against salmon lice was smaller than the variability in return rates between release groups, and much smaller that variability between release years, but its overall contribution was still significant (P < 0.05) and equivalent to an odds ratio of the probability of being recaptured of 1.17 in favour of the treated smolts. Control fish also tended to be smaller as grilse (P = 0.057), possibly due to a sublethal effect of salmon lice. PMID:23311746

  15. Identification of a sex-linked SNP marker in the salmon louse (Lepeophtheirus salmonis using RAD sequencing.

    Directory of Open Access Journals (Sweden)

    Stephen N Carmichael

    Full Text Available The salmon louse (Lepeophtheirus salmonis (Krøyer, 1837 is a parasitic copepod that can, if untreated, cause considerable damage to Atlantic salmon (Salmo salar Linnaeus, 1758 and incurs significant costs to the Atlantic salmon mariculture industry. Salmon lice are gonochoristic and normally show sex ratios close to 1:1. While this observation suggests that sex determination in salmon lice is genetic, with only minor environmental influences, the mechanism of sex determination in the salmon louse is unknown. This paper describes the identification of a sex-linked Single Nucleotide Polymorphism (SNP marker, providing the first evidence for a genetic mechanism of sex determination in the salmon louse. Restriction site-associated DNA sequencing (RAD-seq was used to isolate SNP markers in a laboratory-maintained salmon louse strain. A total of 85 million raw Illumina 100 base paired-end reads produced 281,838 unique RAD-tags across 24 unrelated individuals. RAD marker Lsa101901 showed complete association with phenotypic sex for all individuals analysed, being heterozygous in females and homozygous in males. Using an allele-specific PCR assay for genotyping, this SNP association pattern was further confirmed for three unrelated salmon louse strains, displaying complete association with phenotypic sex in a total of 96 genotyped individuals. The marker Lsa101901 was located in the coding region of the prohibitin-2 gene, which showed a sex-dependent differential expression, with mRNA levels determined by RT-qPCR about 1.8-fold higher in adult female than adult male salmon lice. This study's observations of a novel sex-linked SNP marker are consistent with sex determination in the salmon louse being genetic and following a female heterozygous system. Marker Lsa101901 provides a tool to determine the genetic sex of salmon lice, and could be useful in the development of control strategies.

  16. Deepening Thermocline Displaces Salmon Catch On The Oregon Coast

    Science.gov (United States)

    Harrison, C. S.; Lawson, P.

    2015-12-01

    Establishing a linkage between fish stock distributions and physical oceanography at a fine scale provides insights into the dynamic nature of near-shore ocean habitats. Characterization of habitat preferences adds to our understanding of the ecosystem, and may improve forecasts of distribution for harvest management. The Project CROOS (Collaborative Research on Oregon Ocean Salmon) Chinook salmon catch data set represents an unprecedented high-resolution record of catch location and depth, with associated in-situ temperature measurements and stock identification derived from genetic data. Here we connect this data set with physical ocean observations to gain understanding of how circulation affects salmon catch distributions. The CROOS observations were combined with remote and in situ observations of temperature, as well as a data assimilative regional ocean model that incorporates satellite and HF radar data. Across the CROOS data set, catch is primarily located within the upwelling front over the seamounts and reef structures associated with Heceta and Stonewall Banks along the shelf break. In late September of 2014 the anomalously warm "blob" began to arrive on the Oregon coast coincident with a strong downwelling event. At this time the thermocline deepened from 20 to 40 m, associated with a deepening of salmon catch depth. A cold "bulb" of water over Heceta Bank may have provided a thermal refuge for salmon during the initial onshore movement of the anomalously warm water. These observations suggest that a warming ocean, and regional warming events in particular, will have large effects on fish distributions at local and regional scales, in turn impacting fisheries.

  17. 76 FR 329 - Proposed Information Collection; Comment Request; Reporting Requirements for the Ocean Salmon...

    Science.gov (United States)

    2011-01-04

    ... Collection; Comment Request; Reporting Requirements for the Ocean Salmon Fishery Off the Coasts of Washington..., designated regulatory areas in the commercial ocean salmon fishery off the coasts of Washington, Oregon, and... requirements to land salmon within specific time frames and in specific areas may be implemented in the...

  18. Quantification of trypsin with a radioimmunoassay in herring larvae (Clupea harengus L.) compared with a highly sensitive fluorescence technique to determine tryptic enzyme activity

    International Nuclear Information System (INIS)

    Ueberschaer, B.; Pedersen, B.H.; Hjelmeland, K.

    1993-01-01

    Enzymatic activity and quantity of the protease trypsin were measured in individual herring larvae (Clupea harengus L.). The enzymatic activity assay was done by a fluorescence technique, and a radioimmunoassay was used for quantification of trypsin. The results are compared and the differences between the techniques discussed. Both methods have similar results, as high or low values in trypsin quantity were reflected in high or low values of tryptic activity. Quantity and activity were linearly and positively correlated, but small differences between methods were found at the lowest detection limits. Both techniques reflect the high variability between individual larvae. (orig.)

  19. From the viral perspective: infectious salmon anemia virus (ISAV) transcriptome during the infective process in Atlantic salmon (Salmo salar).

    Science.gov (United States)

    Valenzuela-Miranda, Diego; Cabrejos, María Eugenia; Yañez, José Manuel; Gallardo-Escárate, Cristian

    2015-04-01

    The infectious salmon anemia virus (ISAV) is a severe disease that mainly affects the Atlantic salmon (Salmo salar) aquaculture industry. Although several transcriptional studies have aimed to understand Salmon-ISAV interaction through the evaluation of host-gene transcription, none of them has focused their attention upon the viral transcriptional dynamics. For this purpose, RNA-Seq and RT-qPCR analyses were conducted in gills, liver and head-kidney of S. salar challenged by cohabitation with ISAV. Results evidence the time and tissue transcript patterns involved in the viral expression and how the transcription levels of ISAV segments are directly linked with the protein abundance found in other virus of the Orthomyxoviridae family. In addition, RT-qPCR result evidenced that quantification of ISAV through amplification of segment 3 would result in a more sensitive approach for detection and quantification of ISAV. This study offers a more comprehensive approach regarding the ISAV infective process and gives novel knowledge for its molecular detection. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Harvest Management and Recovery of Snake River Salmon Stocks : Recovery Issues for Threatened and Endangered Snake River Salmon : Technical Report 7 of 11.

    Energy Technology Data Exchange (ETDEWEB)

    Lestelle, Lawrence C.; Gilbertson, Larry G.

    1993-06-01

    Management measures to regulate salmon fishing harvest have grown increasingly complex over the past decade in response to the needs for improved protection for some salmon runs and to alter harvest sharing between fisheries. The development of management plans that adequately address both needs is an immensely complicated task, one that involves a multitude of stocks, each with its own migration patterns and capacity to sustain exploitation. The fishing industry that relies on these fish populations is also highly diverse. The management task is made especially difficult because the stocks are often intermingled on the fishing grounds, creating highly mixed aggregates of stocks and species on which the fisheries operate. This situation is the one confronting harvest managers attempting to protect Snake River salmon. This report provides an overview of some of the factors that will need to be addressed in assessing the potential for using harvest management measures in the recovery of Snake River salmon stocks. The major sections of the report include the following: perspectives on harvest impacts; ocean distribution and in-river adult migration timing; description of management processes and associated fisheries of interest; and altemative harvest strategies.

  1. Movement and habitat studies of chinook salmon and white sturgeon. [Oncorhynchus tshawytscha, Acipenser transmontanus

    Energy Technology Data Exchange (ETDEWEB)

    Haynes, J.M.

    1978-09-01

    Swimming depths of adult chinook salmon (Oncorhynchus tshawytscha), in relation to hydroelectric dam created gas supersaturation levels in the Snake River, were evaluated using pressure-sensitive radiofrequency transmitters. Gas saturation levels in spring 1976 ranged from 120 to 130% and chinook salmon depth of travel averaged 6.4 m. In fall 1976 and spring 1977, when gas saturation levels were below 108%, average salmon depths of travel were 3.0 and 4.0 m, respectively. In all cases, average depth of travel was below the critical zone (110% effective saturation), but spring 1976 chinook salmon traveled significantly deeper than fall 1976 and spring 1977 salmon. Internal and external radio transmitter attachment techniques were compared and results indicated the methods are equally reliable given proper insertion and attachment procedures. Percent returning and travel times to upstream dams were compared between equal numbers of radiotagged and spaghetti-anchor tagged control salmon. There were no significant differences in percent return or travel times between control and externally tagged salmon, but procedural difficulties involving internally tagged salmon altered their behavior to preclude such comparisons. Presence and operation of hydroelectric dams delayed salmon passage through the river and appeared to alter upstream migratory behavior. Movements of radiotagged white sturgeon (Acipenser transmontanus) from 1975 through 1977 were highly seasonal, beginning in June and ending in October. River temperatures apparently influenced both seasonal and diurnal movement activities. Movements began in June after water temperatures passed 13/sup 0/C and ceased when temperatures reached 13/sup 0/C (again) in autumn each year. Information derived from sturgeon carrying temperature sensing transmitters, combined with position determinations, indicated apparent diurnal movement cycles for sturgeon.

  2. Serum trypsin inhibitory capacity in hemodialysis patients

    International Nuclear Information System (INIS)

    Hashemi, Mohammad; Mehrabifar, Hamid; Homayooni, Fatemeh; Naderi, Mohammad; Montazerifar, Farzaneh; Ghavami, Saeid

    2009-01-01

    It has been established that overproduction of reactive oxygen species (ROS) occurs during hemodialysis causing oxidation of proteins. Alpha-1-antitrypsin is the major circulating anti-protease which contains methionine in the active site. The aim of the present study was to measure the level of serum trypsin inhibitory capacity (sTIC) in hemodialysis patients. This case-control study was performed in 52 hemodialysis patients and 49 healthy controls. sTIC was measured by enzymatic assay. The sTIC was significantly (P< 0.001) lower in hemodialysis patients (1.87 + - 0.67 micron mol/min/mL) than healthy controls (2.83 + - 0.44 micron mol/min/L). Reduction of sTIC may be due to the oxidation of methionine residue in the reactive site of alpha-1 antitrypsin. (author)

  3. Tracing salmon-derived nutrients and contaminants in freshwater food webs across a pronounced spawner density gradient.

    Science.gov (United States)

    Gregory-Eaves, Irene; Demers, J Marc J; Kimpe, Lynda; Krümmel, Eva M; Macdonald, Robie W; Finney, Bruce P; Blais, Jules M

    2007-06-01

    Many have demonstrated that anadromous Pacific salmon are significant vectors of nutrients from the ocean to freshwaters. Recently. however, it has been recognized that salmon spawners also input significant quantities of contaminants. The objectives of this paper are to delineate the extent to which salmon-derived nutrients are integrated into the freshwater food web using delta(15)N and delta(13)C and to assess the influence of the salmon pathway in the accumulation of contaminants in rainbow trout (Oncorhynchus mykiss). We found that the delta(15)N and delta(13)C of food web components were related positively and significantly to sockeye salmon (Oncorhynchus nerka) spawner density. Contaminant concentrations in rainbow trout also positively and significantly were related to sockeye salmon spawner density. These data suggest that the anadromous salmon nutrient and contaminant pathways are related and significantly impact the contaminant burden of resident fish.

  4. Stress and reproductive hormones in grizzly bears reflect nutritional benefits and social consequences of a salmon foraging niche.

    Science.gov (United States)

    Bryan, Heather M; Darimont, Chris T; Paquet, Paul C; Wynne-Edwards, Katherine E; Smits, Judit E G

    2013-01-01

    Physiological indicators of social and nutritional stress can provide insight into the responses of species to changes in food availability. In coastal British Columbia, Canada, grizzly bears evolved with spawning salmon as an abundant but spatially and temporally constrained food source. Recent and dramatic declines in salmon might have negative consequences on bear health and ultimately fitness. To examine broadly the chronic endocrine effects of a salmon niche, we compared cortisol, progesterone, and testosterone levels in hair from salmon-eating bears from coastal BC (n = 75) with the levels in a reference population from interior BC lacking access to salmon (n = 42). As predicted, testosterone was higher in coastal bears of both sexes relative to interior bears, possibly reflecting higher social density on the coast mediated by salmon availability. We also investigated associations between the amount of salmon individual bears consumed (as measured by stable isotope analysis) and cortisol and testosterone in hair. Also as predicted, cortisol decreased with increasing dietary salmon and was higher after a year of low dietary salmon than after a year of high dietary salmon. These findings at two spatial scales suggest that coastal bears might experience nutritional or social stress in response to on-going salmon declines, providing novel insights into the effects of resource availability on fitness-related physiology.

  5. Stress and reproductive hormones in grizzly bears reflect nutritional benefits and social consequences of a salmon foraging niche.

    Directory of Open Access Journals (Sweden)

    Heather M Bryan

    Full Text Available Physiological indicators of social and nutritional stress can provide insight into the responses of species to changes in food availability. In coastal British Columbia, Canada, grizzly bears evolved with spawning salmon as an abundant but spatially and temporally constrained food source. Recent and dramatic declines in salmon might have negative consequences on bear health and ultimately fitness. To examine broadly the chronic endocrine effects of a salmon niche, we compared cortisol, progesterone, and testosterone levels in hair from salmon-eating bears from coastal BC (n = 75 with the levels in a reference population from interior BC lacking access to salmon (n = 42. As predicted, testosterone was higher in coastal bears of both sexes relative to interior bears, possibly reflecting higher social density on the coast mediated by salmon availability. We also investigated associations between the amount of salmon individual bears consumed (as measured by stable isotope analysis and cortisol and testosterone in hair. Also as predicted, cortisol decreased with increasing dietary salmon and was higher after a year of low dietary salmon than after a year of high dietary salmon. These findings at two spatial scales suggest that coastal bears might experience nutritional or social stress in response to on-going salmon declines, providing novel insights into the effects of resource availability on fitness-related physiology.

  6. Sneaker Males Affect Fighter Male Body Size and Sexual Size Dimorphism in Salmon.

    Science.gov (United States)

    Weir, Laura K; Kindsvater, Holly K; Young, Kyle A; Reynolds, John D

    2016-08-01

    Large male body size is typically favored by directional sexual selection through competition for mates. However, alternative male life-history phenotypes, such as "sneakers," should decrease the strength of sexual selection acting on body size of large "fighter" males. We tested this prediction with salmon species; in southern populations, where sneakers are common, fighter males should be smaller than in northern populations, where sneakers are rare, leading to geographical clines in sexual size dimorphism (SSD). Consistent with our prediction, fighter male body size and SSD (fighter male∶female size) increase with latitude in species with sneaker males (Atlantic salmon Salmo salar and masu salmon Oncorhynchus masou) but not in species without sneakers (chum salmon Oncorhynchus keta and pink salmon Oncorhynchus gorbuscha). This is the first evidence that sneaker males affect SSD across populations and species, and it suggests that alternative male mating strategies may shape the evolution of body size.

  7. Monitoring of morphology and physical properties of cultured cells using a micro camera and a quartz crystal with transparent indium tin oxide electrodes after injections of glutaraldehyde and trypsin

    International Nuclear Information System (INIS)

    Kang, Hyen-Wook; Ida, Kazumi; Yamamoto, Yuji; Muramatsu, Hiroshi

    2008-01-01

    For investigating the effects of chemical stimulation to cultured cells, we have developed a quartz crystal sensor system with a micro charge-coupled device (CCD) camera that enables microphotograph imaging simultaneously with quartz crystal measurement. Human hepatoma cell line (HepG2) cells were cultured on the quartz crystal through a collagen film. The electrode of the quartz crystal was made of indium tin oxide (ITO) transparent electrodes that enable to obtain a transparent mode photograph. Glutaraldehyde and trypsin were injected to the chamber of the cells, respectively. The response of the quartz crystal was monitored and microphotographs were recorded, and the resonance frequency and resonance resistance were analyzed with an F-R diagram that plotted the resonance frequency and resonance resistance. In the case of the glutaraldehyde injection, the cells responded in two steps that included the fast response of the cross-linking reaction and the successive internal change in the cells. In the case of the trypsin injection, the responses included two processes. In the first step, cell adhesion factors were cleaved and the cell structure became round, and in the next step, the cells were deposited on the quartz crystal surface and the surface of the cells was directly in contact with the quartz crystal surface

  8. 76 FR 54216 - Pacific Fishery Management Council (Council); Work Session To Review Proposed Salmon Methodology...

    Science.gov (United States)

    2011-08-31

    ... Fishery Management Council (Council); Work Session To Review Proposed Salmon Methodology Changes AGENCY.... ACTION: Notice of a public meeting. SUMMARY: The Pacific Fishery Management Council's Salmon Technical Team (STT), Scientific and Statistical Committee (SSC) Salmon Subcommittee, and Model Evaluation...

  9. 77 FR 13072 - Salmon-Challis National Forest, Butte, Custer and Lemhi Counties, ID, Supplemental Environmental...

    Science.gov (United States)

    2012-03-05

    ... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, Butte, Custer and Lemhi Counties, ID, Supplemental Environmental Impact Statement to the 2009 Salmon- Challis National Forest... of intent to prepare a supplemental environmental impact statement. SUMMARY: The Salmon-Challis...

  10. Snake River Sockeye Salmon Captive Broodstock Program; Research Element, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Willard, Catherine; Hebdon, J. Lance; Castillo, Jason (Idaho Department of Fish and Game, Boise, ID)

    2004-06-01

    On November 20, 1991, the National Oceanic Atmospheric Administration listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Shoshone-Bannock Tribes and Idaho Department of Fish and Game initiated the Snake River Sockeye Salmon Sawtooth Valley Project to conserve and rebuild populations in Idaho. Restoration efforts are focusing on Redfish, Pettit, and Alturas lakes within the Sawtooth Valley. The first release of hatchery-produced juvenile sockeye salmon from the captive broodstock program occurred in 1994. The first anadromous adult returns from the captive broodstock program were recorded in 1999 when six jacks and one jill were captured at IDFG's Sawtooth Fish Hatchery. In 2002, progeny from the captive broodstock program were released using four strategies: age-0 presmolts were released to Alturas, Pettit, and Redfish lakes in August and to Pettit and Redfish lakes in October, age-1 smolts were released to Redfish Lake Creek in May, eyed-eggs were planted in Pettit Lake in December, and hatchery-produced and anadromous adult sockeye salmon were released to Redfish Lake for volitional spawning in September. Oncorhynchus nerka population monitoring was conducted on Redfish, Alturas, and Pettit lakes using a midwater trawl in September 2002. Age-0, age-1, and age-2 O. nerka were captured in Redfish Lake, and population abundance was estimated at 50,204 fish. Age-0, age-1, age-2, and age-3 kokanee were captured in Alturas Lake, and population abundance was estimated at 24,374 fish. Age-2 and age-3 O. nerka were captured in Pettit Lake, and population abundance was estimated at 18,328 fish. The ultimate goal of the Idaho Department of Fish and Game (IDFG) captive broodstock development and evaluation efforts is to recover sockeye salmon runs in Idaho waters. Recovery is defined as reestablishing sockeye salmon runs and providing for utilization of sockeye salmon and kokanee resources by anglers

  11. Effect of habitat improvement on Atlantic salmon in the regulated river Suldalslaagen

    International Nuclear Information System (INIS)

    Raastad, J.E.; Lillehammer, A.; Lillehammer, L.; Eie, J.A.

    1993-01-01

    The River Suldaalslagen, which holds a population of large Atlantic salmon, has been regulated twice for hydropower production. The first regulation occurred in 1968 and the second in 1980. Present problems include the reduced density of benthic fauna, the reduced growth rate of young salmon, the low survival of 0 + fish and the increased time required for smoltification. A programme of habitat restoration includes building a rearing channel system where water flow and the substrate can be controlled. The salmon fry are stocked in the rearing channel and in an adjacent tributary stream. The effects on macrobenthos of introduced dead organic material were also studied. Improvement of physical habitat increased the density of benthic animals, and the survival of 1 + salmon was about 30%. Experiments that included adding 115 g wheat/m 2 resulted in a threefold increase in benthic fauna compared with a control area. The largest increase in numbers was Chironomidae in August-September, when benthic Crustacea also showed a significant increase. An increase in macrobenthos is expected to increase the growth and survival of young salmon fry. (Author)

  12. 76 FR 29707 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2011-05-23

    ... Salmon Fishery AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... loan for the Southeast Alaska Purse Seine Salmon Fishery (Reduction Fishery). The fee system involves...: SE Alaska Purse Seine Salmon Rulemaking, 1315 East-West Highway, Silver Spring, MD 20910...

  13. 77 FR 58526 - Pacific Fishery Management Council; Public Meeting; Work Session To Review Proposed Salmon...

    Science.gov (United States)

    2012-09-21

    ... Fishery Management Council; Public Meeting; Work Session To Review Proposed Salmon Methodology Changes...), Commerce. ACTION: Notice of a public meeting. SUMMARY: The Pacific Fishery Management Council's Salmon Technical Team (STT), Scientific and Statistical Committee (SSC) Salmon Subcommittee, and Model Evaluation...

  14. Trypsin inhibitory activity of artemisinin and its biotransformed product

    International Nuclear Information System (INIS)

    Shahwar, D.; Raza, M.A.

    2013-01-01

    Summary: Artemisinin (1 ), a sesquiterpene lactone is an important constituent of anti-malarial drugs. In the present study, it was extracted from aerial parts of Artemisia roxburghiana Besser. Biotransformation of artemisinin ( 1 ) was carried out in the culture of Aspergillus niger GC-4 which yielded 5-hydroxy artemisinin (2 ) The structures of 1-2 were confirmed through spectral studies. Both compounds were screened against trypsin using colorimetric method. The biotransformed product 2 showed significant protease inhibitory activity with 53.5 +- 1.6% inhibition and IC/sub 50/ = 0.29 +- 0.02 mM as compared to artemisinin (20.4 +- 0.3% inhibition). (author)

  15. Using cure models for analyzing the influence of pathogens on salmon survival

    Science.gov (United States)

    Ray, Adam R; Perry, Russell W.; Som, Nicholas A.; Bartholomew, Jerri L

    2014-01-01

    Parasites and pathogens influence the size and stability of wildlife populations, yet many population models ignore the population-level effects of pathogens. Standard survival analysis methods (e.g., accelerated failure time models) are used to assess how survival rates are influenced by disease. However, they assume that each individual is equally susceptible and will eventually experience the event of interest; this assumption is not typically satisfied with regard to pathogens of wildlife populations. In contrast, mixture cure models, which comprise logistic regression and survival analysis components, allow for different covariates to be entered into each part of the model and provide better predictions of survival when a fraction of the population is expected to survive a disease outbreak. We fitted mixture cure models to the host–pathogen dynamics of Chinook Salmon Oncorhynchus tshawytscha and Coho Salmon O. kisutch and the myxozoan parasite Ceratomyxa shasta. Total parasite concentration, water temperature, and discharge were used as covariates to predict the observed parasite-induced mortality in juvenile salmonids collected as part of a long-term monitoring program in the Klamath River, California. The mixture cure models predicted the observed total mortality well, but some of the variability in observed mortality rates was not captured by the models. Parasite concentration and water temperature were positively associated with total mortality and the mortality rate of both Chinook Salmon and Coho Salmon. Discharge was positively associated with total mortality for both species but only affected the mortality rate for Coho Salmon. The mixture cure models provide insights into how daily survival rates change over time in Chinook Salmon and Coho Salmon after they become infected with C. shasta.

  16. Understanding the Complexities of Communicating Management Decisions on the Subsistence Use of Yukon River Salmon

    Science.gov (United States)

    Brooks, J. F.; Trainor, S.

    2017-12-01

    Over 20,000 residents in Alaska and Yukon Territory rely upon the Yukon River to provide them harvests of Pacific salmon each year. Salmon are a highly valued food resource and the practice of salmon fishing along the Yukon is deep rooted in local cultures and traditions. Potential future impacts of climate change on the health of Yukon River salmon stocks could be significant. Collaborative managerial processes which incorporate the viewpoints of subsistence stakeholders will be crucial in enabling communities and managerial institutions to adapt and manage these impacts. However, the massive extent of the Yukon River makes it difficult for communities rich with highly localized knowledge to situate themselves within a drainage-wide context of resource availability, and to fully understand the implications that management decisions may have for their harvest. Differences in salmon availability and abundance between the upper and lower Yukon, commercial vs. subsistence fishery interests, and enforcement of the international Pacific Salmon Treaty further complicate understanding and makes the topic of salmon as a subsistence resource a highly contentious issue. A map which synthesizes the presence and absence of Pacific salmon throughout the entire Yukon River drainage was requested by both subsistence fishers and natural resource managers in Alaska in order to help facilitate productive conversations about salmon management decisions. Interviews with Alaskan stakeholders with managerial, biological, and subsistence harvest backgrounds were carried out and a literature review was conducted in order to understand what such a map should and could accomplish. During the research process, numerous data gaps concerning the distribution of salmon along the Yukon River were discovered, and insights about the complexities involved in translating science when it is situated within a charged political, economic, and cultural context were revealed. Preliminary maps depicting

  17. An Evidence-Based Evaluation of the Cumulative Effects of Tidal Freshwater and Estuarine Ecosystem Restoration on Endangered Juvenile Salmon in the Columbia River: Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Diefenderfer, Heida L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Johnson, Gary E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Thom, Ronald M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Borde, Amy B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Woodley, Christa M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Weitkamp, Laurie A. [Marine Sciences lab., Sequim, WA (United States); Buenau, Kate E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kropp, Roy K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2013-12-01

    The listing of 13 salmon and steelhead stocks in the Columbia River basin (hereafter collectively referred to as “salmon”) under the Endangered Species Act of 1973, as amended, has stimulated tidal wetland restoration in the lower 235 kilometers of the Columbia River and estuary for juvenile salmon habitat functions. The purpose of the research reported herein was to evaluate the effect on listed salmon of the restoration effort currently being conducted under the auspices of the federal Columbia Estuary Ecosystem Restoration Program (CEERP). Linking changes in the quality and landscape pattern of tidal wetlands in the lower Columbia River and estuary (LCRE) to salmon recovery is a complex problem because of the characteristics of the ecosystem, the salmon, the restoration actions, and available sampling technologies. Therefore, we designed an evidence-based approach to develop, synthesize, and evaluate information to determine early-stage (~10 years) outcomes of the CEERP. We developed an ecosystem conceptual model and from that, a primary hypothesis that habitat restoration activities in the LCRE have a cumulative beneficial effect on juvenile salmon. There are two necessary conditions of the hypothesis: • habitat-based indicators of ecosystem controlling factors, processes, and structures show positive effects from restoration actions, and • fish-based indicators of ecosystem processes and functions show positive effects from restoration actions and habitats undergoing restoration. Our evidence-based approach to evaluate the primary hypothesis incorporated seven lines of evidence, most of which are drawn from the LCRE. The lines of evidence are spatial and temporal synergies, cumulative net ecosystem improvement, estuary-wide meta-analysis, offsite benefits to juvenile salmon, landscape condition evaluation, and evidence-based scoring of global literature. The general methods we used to develop information for the lines of evidence included field

  18. 76 FR 61985 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2011-10-06

    ... Salmon Fishery AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... Southeast Alaska Purse Seine Salmon Fishery (Reduction Fishery). The fee system involves future landings of... Alaska Purse Seine Salmon Rulemaking, 1315 East-West Highway, Silver Spring, MD 20910 or by calling...

  19. RESTORING WILD SALMON TO THE PACIFIC NORTHWEST: FRAMING THE RISK QUESTION

    Science.gov (United States)

    In the Pacific Northwest of the United States, it is urgent to assess accurately the various options proposed to restore wild salmon. For the past 125 years, a variety of analytic approaches have been employed to assess the ecological consequences of salmon management options. ...

  20. Purification, crystallization and X-ray characterization of a Kunitz-type trypsin inhibitor protein from the seeds of chickpea (Cicer arietinum).

    Science.gov (United States)

    Sharma, Urvashi; Suresh, C G

    2011-06-01

    A Kunitz-type trypsin inhibitor protein (CPTI) purified from chickpea seeds was estimated to have a molecular mass of 18 kDa on SDS-PAGE. The IC(50) value of CPTI was determined to be 2.5 µg against trypsin. The inhibitory activity of CPTI is 114 TIU (trypsin inhibitory units) per milligram of protein, which is high compared with those of other known Kunitz-type trypsin inhibitors from legumes. CPTI crystallized in three different orthorhombic crystal forms: P2(1)2(1)2 form A, P2(1)2(1)2 form B and P2(1)2(1)2(1). The crystals of P2(1)2(1)2 form A, with unit-cell parameters a = 37.2, b = 41.2, c = 104.6 Å, diffracted to 2.0 Å resolution at the home source and to 1.4 Å on beamline BM14 at the ESRF. Data were also collected from crystals grown in the presence of iodine. The Matthews coefficient for these crystals was calculated to be 2.37 Å(3) Da(-1), corresponding to a solvent content of 42%. The other two crystal forms (P2(1)2(1)2 form B and P2(1)2(1)2(1)) diffracted comparatively poorly.

  1. Effects of salinity on trace elements in otoliths of Masu salmon

    International Nuclear Information System (INIS)

    Nagata, Yoshihisa; Arai, Nobuaki; Sakamoto, Wataru; Tago, Yasuhiko; Yoshida, Koji

    1997-01-01

    PIXE was adopted for analysis of trace elements in otoliths of Masu salmon Oncorhynchus masou masou to examine relationship between trace elements and environmental salinity. The otoliths were removed from salmon juveniles reared in four values of salinity and wild ones. The otolith Sr concentrations of reared individuals are positively related to salinity and there is significant difference between freshwater and seawater. The otoliths of smolts contain more Sr than those of parrs. It seems that the Sr concentrations in otoliths of Masu salmon reflect salinity where they had stayed and show the migration pattern. (author)

  2. AFSC/ABL: Chum salmon bycatch genetic stock identification 1994-1995 Bering Sea

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In some years, the Bering Sea trawl fishery incidentally harvests (bycatch) large numbers of chum salmon. Because chum salmon were declining in some western Alaska...

  3. Human and bovine spinal disc mechanics subsequent to trypsin injection

    Directory of Open Access Journals (Sweden)

    Jeremy Alsup

    2017-10-01

    The Translational Potential of this Article: Preclinical testing of novel spinal devices is essential to the design validation and regulatory processes, but current testing techniques rely on cadaveric testing of primarily older spines with essentially random amounts of disc degeneration. The present work investigates the viability of using trypsin injections to create a more uniform preclinical model of disc degeneration from a mechanics perspective, for the purpose of testing spinal devices. Such a model would facilitate translation of new spinal technologies to clinical practice.

  4. Evidence for geomagnetic imprinting as a homing mechanism in Pacific salmon.

    Science.gov (United States)

    Putman, Nathan F; Lohmann, Kenneth J; Putman, Emily M; Quinn, Thomas P; Klimley, A Peter; Noakes, David L G

    2013-02-18

    In the final phase of their spawning migration, Pacific salmon use chemical cues to identify their home river, but how they navigate from the open ocean to the correct coastal area has remained enigmatic. To test the hypothesis that salmon imprint on the magnetic field that exists where they first enter the sea and later seek the same field upon return, we analyzed a 56-year fisheries data set on Fraser River sockeye salmon, which must detour around Vancouver Island to approach the river through either a northern or southern passageway. We found that the proportion of salmon using each route was predicted by geomagnetic field drift: the more the field at a passage entrance diverged from the field at the river mouth, the fewer fish used the passage. We also found that more fish used the northern passage in years with warmer sea surface temperature (presumably because fish were constrained to more northern latitudes). Field drift accounted for 16% of the variation in migratory route used, temperature 22%, and the interaction between these variables 28%. These results provide the first empirical evidence of geomagnetic imprinting in any species and imply that forecasting salmon movements is possible using geomagnetic models. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Predation by northern squawfish on live and dead juvenile chinook salmon

    International Nuclear Information System (INIS)

    Gadomski, D.M.; Hall-Griswold, J.A.

    1992-01-01

    Northern squawfish Ptychocheilus oregonensis is a major predator of juvenile salmonids Oncorhynchus spp. migrating downstream through the Columbia River. High predation rates occur just below dams. If northern squawfish selectively consume salmonids killed or injured during dam passage, previous estimates of predation mortality may be too high. We conducted laboratory experiments that indicate northern squawfish prefer dead juvenile chinook salmon O. tshawytscha over live individuals. When equal numbers of dead and live chinook salmon were offered to northern squawfish maintained on a natural photoperiod (15 h light: 9 h darkness), significantly more (P < 0.05) dead than live fish were consumed, both in 1,400-L circular tanks and in an 11,300-L raceway (62% and 79% of prey consumed were dead, respectively). When dead and live juvenile chinook salmon were provided in proportions more similar to those below dams (20% dead, 80% live), northern squawfish still selected for dead prey (36% of fish consumed were dead). In additional experiments, northern squawfish were offered a proportion of 20% dead juvenile chinook salmon during 4-h periods of either light or darkness. The predators were much more selective for dead chinook salmon during bright light (88% of fish consumed were dead) than during darkness (31% were dead)

  6. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1993 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    1994-11-01

    The National Marine Fisheries Service (NMFS), in cooperation with Idaho and BPA, has established captive broodstocks to aid recovery of endangered Snake River sockeye salmon. NMFS is currently maintaining four separate Redfish Lake sockeye Salmon captive broodstocks; all these broodstocks are being reared full-term to maturity in fresh (well) water. Experiments are also being conducted on nonendangered 1990 and 1991-brood Lake Wenatchee (WA) sockeye salmon to compare effects on survival and reproduction to maturity in fresh water and seawater; for both brood-years, fish reared in fresh water were larger than those reared in seawater. Data from captive rearing experiments suggest a ranking priority of circular tanks supplied with pathogen-free fresh water, circular tanks supplied with pumped/filtered/uv-sterilized seawater, and seawater net-pens for rearing sockeye salmon to maturity.

  7. Evaluating the consequences of salmon nutrients for riparian organisms: Linking condition metrics to stable isotopes.

    Science.gov (United States)

    Vizza, Carmella; Sanderson, Beth L; Coe, Holly J; Chaloner, Dominic T

    2017-03-01

    Stable isotope ratios (δ 13 C and δ 15 N) have been used extensively to trace nutrients from Pacific salmon, but salmon transfer more than carbon and nitrogen to stream ecosystems, such as phosphorus, minerals, proteins, and lipids. To examine the importance of these nutrients, metrics other than isotopes need to be considered, particularly when so few studies have made direct links between these nutrients and how they affect riparian organisms. Our study specifically examined δ 13 C and δ 15 N of riparian organisms from salmon and non-salmon streams in Idaho, USA, at different distances from the streams, and examined whether the quality of riparian plants and the body condition of invertebrates varied with access to these nutrients. Overall, quality and condition metrics did not mirror stable isotope patterns. Most notably, all riparian organisms exhibited elevated δ 15 N in salmon streams, but also with proximity to both stream types suggesting that both salmon and landscape factors may affect δ 15 N. The amount of nitrogen incorporated from Pacific salmon was low for all organisms (1950s. In addition, our results support those of other studies that have cautioned that inferences from natural abundance isotope data, particularly in conjunction with mixing models for salmon-derived nutrient percentage estimates, may be confounded by biogeochemical transformations of nitrogen, physiological processes, and even historical legacies of nitrogen sources. Critically, studies should move beyond simply describing isotopic patterns to focusing on the consequences of salmon-derived nutrients by quantifying the condition and fitness of organisms putatively using those resources.

  8. Behavioral thermoregulation by juvenile spring and fall chinook salmon, Oncorhynchus tshawytscha, during smoltification

    Science.gov (United States)

    Sauter, S.T.; Crawshaw, L.I.; Maule, A.G.

    2001-01-01

    Fall chinook salmon evolved to emigrate during the summer months. The shift in the temperature preference we observed in smolting fall chinook but not spring chinook salmon may reflect a phylogenetic adaptation to summer emigration by (1) providing directional orientation as fall chinook salmon move into the marine environment, (2) maintaining optimal gill function during emigration and seawater entry, and/or (3) resetting thermoregulatory set-points to support physiological homeostasis once smolted fish enter the marine environment. Phylogenetically determined temperature adaptations and responses to thermal stress may not protect fall chinook salmon from the recent higher summer water temperatures, altered annual thermal regimes, and degraded cold water refugia that result from hydropower regulation of the Columbia and Snake rivers. The long-term survival of fall chinook salmon will likely require restoration of normal annual thermographs and rigorous changes in land use practices to protect critical thermal refugia and control maximum summer water temperatures in reservoirs.

  9. Increased mitochondrial DNA diversity in ancient Columbia River basin Chinook salmon Oncorhynchus tshawytscha.

    Directory of Open Access Journals (Sweden)

    Bobbi M Johnson

    Full Text Available The Columbia River and its tributaries provide essential spawning and rearing habitat for many salmonid species, including Chinook salmon (Oncorhynchus tshawytscha. Chinook salmon were historically abundant throughout the basin and Native Americans in the region relied heavily on these fish for thousands of years. Following the arrival of Europeans in the 1800s, salmon in the basin experienced broad declines linked to overfishing, water diversion projects, habitat destruction, connectivity reduction, introgression with hatchery-origin fish, and hydropower development. Despite historical abundance, many native salmonids are now at risk of extinction. Research and management related to Chinook salmon is usually explored under what are termed "the four H's": habitat, harvest, hatcheries, and hydropower; here we explore a fifth H, history. Patterns of prehistoric and contemporary mitochondrial DNA variation from Chinook salmon were analyzed to characterize and compare population genetic diversity prior to recent alterations and, thus, elucidate a deeper history for this species. A total of 346 ancient and 366 contemporary samples were processed during this study. Species was determined for 130 of the ancient samples and control region haplotypes of 84 of these were sequenced. Diversity estimates from these 84 ancient Chinook salmon were compared to 379 contemporary samples. Our analysis provides the first direct measure of reduced genetic diversity for Chinook salmon from the ancient to the contemporary period, as measured both in direct loss of mitochondrial haplotypes and reductions in haplotype and nucleotide diversity. However, these losses do not appear equal across the basin, with higher losses of diversity in the mid-Columbia than in the Snake subbasin. The results are unexpected, as the two groups were predicted to share a common history as parts of the larger Columbia River Basin, and instead indicate that Chinook salmon in these subbasins

  10. Reactive-site hydrolyzed Cucurbita maxima trypsin inhibitor-V: function, thermodynamic stability, and NMR solution structure.

    Science.gov (United States)

    Cai, M; Gong, Y; Prakash, O; Krishnamoorthi, R

    1995-09-26

    Reactive-site (Lys44-Asp45 peptide bond) hydrolyzed Cucurbita maxima trypsin inhibitor-V (CMTI-V*) was prepared and characterized: In comparison to the intact form, CMTI-V* exhibited markedly reduced inhibitory properties and binding affinities toward trypsin and human blood coagulation factor XIIa. The equilibrium constant of trypsin-catalyzed hydrolysis, Khyd, defined as [CMTI-V*]/[CMTI-V], was measured to be approximately 9.4 at 25 degrees C (delta G degrees = -1.3 kcal.mol-1). From the temperature dependence of delta G degrees, the following thermodynamic parameters were estimated: delta H degrees = 1.6 kcal.mol-1 and delta S degrees = 9.8 eu. In order to understand the functional and thermodynamic differences between the two forms, the three-dimensional solution structure of CMTI-V* was determined by a combined approach of NMR, distance geometry, and simulated annealing methods. Thus, following sequence-specific and stereospecific resonance assignments, including those of beta-, gamma-, delta-, and epsilon-hydrogens and valine methyl hydrogens, 809 interhydrogen distances and 123 dihedral angle constraints were determined, resulting in the computation and energy-minimization of 20 structures for CMTI-V*. The average root mean squared deviation in position for equivalent atoms between the 20 individual structures and the mean structure obtained by averaging their coordinates is 0.67 +/- 0.15 A for the main chain atoms and 1.19 +/- 0.23 A for all the non-hydrogen atoms of residues 5-40 and residues 48-67.(ABSTRACT TRUNCATED AT 250 WORDS)

  11. Purification and characterization of a novel trypsin-like protease from green-seeded chickpea (Cicer arientum).

    Science.gov (United States)

    Shamsi, Tooba Naz; Parveen, Romana; Sen, Priyankar; Fatima, Sadaf

    2017-05-28

    The present study describes the purification and physicochemical and biochemical characterization of trypsin-like protease from green-seeded chickpea (Cicer arientum). The crude extract of chickpea trypsin (CpT) was obtained by homogenization followed by differential ammonium sulfate precipitation. The CpT was purified by ion-exchange chromatography on diethylaminoethyl (DEAE) column, pre-equilibrated with 20 mM tris-CaCl 2 buffer (pH 8.2) with a flow rate of 0.5 mL min -1 . The molecular weight and purity of ∼23 kDa of CpT were determined by sodium dodecyl sulfate polyacrylamide gel electrophoresis. Activity of protease was determined using Nα-benzoyl-DL-arginine-p-nitroanilide as chromogenic substrate and CpT purified showed a specific inhibitor activity of 26978.7697 U mg -1 , fold purity of 9.8, and the yield of 70.2%. The characterization was performed for thermal stability, pH profile, and effect of various inhibitors on enzymatic activity. The protein isolated showed stability in the neutral to mild alkaline pH range and thermostability up to 50°C. CpT confirmed its serine nature as it was appreciably inhibited by serine protease inhibitors (maximum 6%), whereas metalloprotease inhibitors barely affected the activity of the enzyme (85%). To the best of our knowledge, it is first reported on purification of protease with trypsin-like properties, from this source.

  12. 77 FR 41754 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2012-07-16

    ... Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery AGENCY: National Marine... program in the Southeast Alaska purse seine salmon fishery. NMFS conducted a referendum to approve the..., Chief, Financial Services Division, NMFS, Attn: SE Alaska Purse Seine Salmon Buyback, 1315 East-West...

  13. 77 FR 26744 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2012-05-07

    ... Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery AGENCY: National Marine... of reduction payment tender of Southeast Alaska purse seine salmon permits. SUMMARY: The National... Southeast Alaska purse seine salmon fishery. The program authorizes NMFS to make payments to permit holders...

  14. Wild Steelhead and introduced spring Chinook Salmon in the Wind River, Washington: Overlapping populations and interactions

    Science.gov (United States)

    Jezorek, I.G.; Connolly, P.J.

    2010-01-01

    We investigated interactions of introduced juvenile spring Chinook salmon Oncorhynchus tshawytscha with wild juvenile steelhead O. mykiss in the upper Wind River watershed (rkm 24.6 to rkm 43.8), Washington. Our objective was to determine if the presence of introduced spring Chinook salmon influenced populations of wild juvenile steelhead and if other biotic or abiotic factors influenced distribution and populations of these species. We snorkeled to assess distribution and abundance in one to six stream reaches per year during 2001 through 2007. Juvenile steelhead were found in each sampled reach each year, but juvenile Chinook salmon were not. The upstream extent of distribution of juvenile Chinook salmon varied from rkm 29.7 to 42.5. Our analyses suggest that juvenile Chinook salmon distribution was much influenced by flow during the spawning season. Low flow appeared to limit access of escaped adult Chinook salmon to upper stream reaches. Abundance of juvenile Chinook salmon was also influenced by base flow during the previous year, with base flow occurring post spawn in late August or early September. There were no relationships between juvenile Chinook salmon abundance and number of Chinook salmon spawners, magnitude of winter flow that might scour redds, or abundance of juvenile steelhead. Abundance of age-0 steelhead was influenced primarily by the number of steelhead spawners the previous year, and abundance of age-1 steelhead was influenced primarily by abundance of age-0 steelhead the previous year. Juvenile steelhead abundance did not show a relationship with base or peak flows, nor with number of escaped Chinook salmon adults during the previous year. We did not detect a negative influence of the relatively low abundance of progeny of escaped Chinook salmon on juvenile steelhead abundance. This low abundance of juvenile Chinook salmon was persistent throughout our study and is likely a result of hatchery management and habitat conditions. Should one or

  15. Effect of Prudhoe Bay crude oil on the homing of coho salmon in marine waters

    International Nuclear Information System (INIS)

    Nakatani, R.E.; Nevissi, A.E.

    1991-01-01

    Resource managers and the fishing industry have expressed concern that a crude-oil spill occurring in the pathway of a salmon run may destroy the ability of the maturing salmon to reach the home stream. To address this concern, groups of mature 3-year-old and precocious 2-year-old coho salmon Oncorhynchus kisutch were tagged and exposed in seawater for 1 hr to sublethal concentration of Prudhoe Bay crude oil, dispersed oil, or seawater oil dispersant alone, and then were released in seawater about 5 km from their home stream. The results show that the coho salmon's homing success and speed of return to the home stream were not affected by any of the treatments. The longevity or holding tests, in which coho salmon were held in saltwater netpens after experimental treatments, showed that the larger 3-year-old coho salmon were more sensitive to the stress of confinement than the smaller 2-year-old fish

  16. Chum and pink salmon genetics - Genetic and life history variation of southern chum and pink salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The distribution of genetic and life history variation in chum (Oncorhynchus keta) and pink (O. gorbuscha) salmon in their southern range in North America is key to...

  17. Global assessment of extinction risk to populations of Sockeye salmon Oncorhynchus nerka.

    Directory of Open Access Journals (Sweden)

    Peter S Rand

    Full Text Available BACKGROUND: Concern about the decline of wild salmon has attracted the attention of the International Union for the Conservation of Nature (IUCN. The IUCN applies quantitative criteria to assess risk of extinction and publishes its results on the Red List of Threatened Species. However, the focus is on the species level and thus may fail to show the risk to populations. The IUCN has adapted their criteria to apply to populations but there exist few examples of this type of assessment. We assessed the status of sockeye salmon Oncorhynchus nerka as a model for application of the IUCN population-level assessments and to provide the first global assessment of the status of an anadromous Pacific salmon. METHODS/PRINCIPAL FINDINGS: We found from demographic data that the sockeye salmon species is not presently at risk of extinction. We identified 98 independent populations with varying levels of risk within the species' range. Of these, 5 (5% are already extinct. We analyzed the risk for 62 out of 93 extant populations (67% and found that 17 of these (27% are at risk of extinction. The greatest number and concentration of extinct and threatened populations is in the southern part of the North American range, primarily due to overfishing, freshwater habitat loss, dams, hatcheries, and changing ocean conditions. CONCLUSIONS/SIGNIFICANCE: Although sockeye salmon are not at risk at the species-level, about one-third of the populations that we analyzed are at risk or already extinct. Without an understanding of risk to biodiversity at the level of populations, the biodiversity loss in salmon would be greatly underrepresented on the Red List. We urge government, conservation organizations, scientists and the public to recognize this limitation of the Red List. We also urge recognition that about one-third of sockeye salmon global population diversity is at risk of extinction or already extinct.

  18. Effects of habitat features on size-biased predation on salmon by bears.

    Science.gov (United States)

    Andersson, Luke C; Reynolds, John D

    2017-05-01

    Predators can drive trait divergence among populations of prey by imposing differential selection on prey traits. Habitat characteristics can mediate predator selectivity by providing refuge for prey. We quantified the effects of stream characteristics on biases in the sizes of spawning salmon caught by bears (Ursus arctos and U. americanus) on the central coast of British Columbia, Canada by measuring size-biased predation on spawning chum (Oncorhynchus keta) and pink (O. gorbuscha) salmon in 12 streams with varying habitat characteristics. We tested the hypotheses that bears would catch larger than average salmon (size-biased predation) and that this bias toward larger fish would be higher in streams that provide less protection to spawning salmon from predation (e.g., less pools, wood, undercut banks). We then we tested for how such size biases in turn translate into differences among populations in the sizes of the fish. Bears caught larger-than-average salmon as the spawning season progressed and as predicted, this was most pronounced in streams with fewer refugia for the fish (i.e., wood and undercut banks). Salmon were marginally smaller in streams with more pronounced size-biased predation but this predictor was less reliable than physical characteristics of streams, with larger fish in wider, deeper streams. These results support the hypothesis that selective forces imposed by predators can be mediated by habitat characteristics, with potential consequences for physical traits of prey.

  19. Polychlorinated biphenyl (PCB) load, lipid reserves and biotransformation activity in migrating Atlantic salmon from River Moerrum, Sweden

    International Nuclear Information System (INIS)

    Hansson, Maria C.; Persson, Maria E.; Larsson, Per; Schantz, Torbjoern von

    2009-01-01

    Atlantic salmon accumulate high levels of contaminants such as polychlorinated biphenyls (PCBs) in their lipids during the adult growth phase spent at sea. The lipids are later utilized during migration for swimming and biological adaptations. We hypothesize that migrating salmons' biotransformation processes are affected by the high levels of built-up PCBs compared to salmon that in a pre-migrational stage. For these analyses we sampled adult Atlantic salmon during migration in the Swedish River Moerrum and measured the 21 most common PCB congeners (ΣPCB) and lipid levels in muscle tissue, aryl hydrocarbon receptor (AHR2) and cytochrome P4501A1 (CYP1A1) transcript levels as well as ethoxyresorufin-O-deethylase activity (EROD) in liver. We also determined which AHR2 genotypes the salmon carried. We show that EROD activity is correlated to CYP1A1 level but not to ΣPCB concentration. ΣPCB concentration does not predict levels of neither the AHR2 nor CYP1A1 genes. We find no associations between specific AHR2 transcription levels and AHR2 genotypes or a correlation between AHR2 and CYP1A1 transcription levels, which is in direct contrast to pre-migrational adult salmon from the Baltic Sea. When we compare River Moerrum to salmon we have previously sampled in the Baltic Sea we show that migrating salmon have significantly lower lipid levels in their muscles; higher muscle concentrations of ΣPCB on a lipid basis; and significantly lower CYP1A1 and EROD levels compared to salmon from the Baltic Sea. Also, transcript levels of three out of four AHR2 genes are significantly different. In conclusion, migrating Swedish Atlantic salmon carry higher concentrations of PCBs in their lipids compared to salmon in the Baltic Sea, but have lower activation of biotransformation genes and enzymes. Our results indicate that accumulated pollutants from the Baltic Sea are deactivated inside the migrating salmon's lipid tissues and increase in concentration when migration is initiated

  20. Temperature-associated population diversity in salmon confers benefits to mobile consumers

    Science.gov (United States)

    Ruff, Casey P.; Schindle, Daniel E.; Armstrong, Jonathan B.; Bentle, Kale T.; Brooks, Gabriel T.; Holtgrieve, Gordon W.; McGlauflin, Molly T.; Torgersen, Christian E.; Seeb, James E.

    2011-01-01

    Habitat heterogeneity can generate intraspecific diversity through local adaptation of populations. While it is becoming increasingly clear that population diversity can increase stability in species abundance, less is known about how population diversity can benefit consumers that can integrate across population diversity in their prey. Here we demonstrate cascading effects of thermal heterogeneity on trout–salmon interactions in streams where rainbow trout rely heavily on the seasonal availability of anadromous salmon eggs. Water temperature in an Alaskan stream varied spatially from 5°C to 17.5°C, and spawning sockeye salmon showed population differentiation associated with this thermal heterogeneity. Individuals that spawned early in cool regions of the 5 km long stream were genetically differentiated from those spawning in warmer regions later in the season. Sockeye salmon spawning generates a pulsed resource subsidy that supports the majority of seasonal growth in stream-dwelling rainbow trout. The spatial and temporal structuring of sockeye salmon spawn timing in our focal stream extended the duration of the pulsed subsidy compared to a thermally homogeneous stream with a single population of salmon. Further, rainbow trout adopted movement strategies that exploited the multiple pulses of egg subsidies in the thermally heterogeneous stream. Fish that moved to track the resource pulse grew at rates about 2.5 times higher than those that remained stationary or trout in the reference stream with a single seasonal pulse of eggs. Our results demonstrate that habitat heterogeneity can have important effects on the population diversity of dominant species, and in turn, influence their value to species that prey upon them. Therefore, habitat homogenization may have farther-reaching ecological effects than previously considered.

  1. Effect of habitat improvement on Atlantic salmon in the regulated river Suldalslaagen

    Energy Technology Data Exchange (ETDEWEB)

    Raastad, J.E.; Lillehammer, A.; Lillehammer, L. (Oslo Univ. (Norway). Zoological Museum); Kaasa, H. (Statkraft, Hoevik (Norway)); Eie, J.A. (Norwegian Water Resources and Energy Administration, Oslo (Norway))

    1993-05-01

    The River Suldaalslagen, which holds a population of large Atlantic salmon, has been regulated twice for hydropower production. The first regulation occurred in 1968 and the second in 1980. Present problems include the reduced density of benthic fauna, the reduced growth rate of young salmon, the low survival of 0[sup +] fish and the increased time required for smoltification. A programme of habitat restoration includes building a rearing channel system where water flow and the substrate can be controlled. The salmon fry are stocked in the rearing channel and in an adjacent tributary stream. The effects on macrobenthos of introduced dead organic material were also studied. Improvement of physical habitat increased the density of benthic animals, and the survival of 1[sup +] salmon was about 30%. Experiments that included adding 115 g wheat/m[sup 2] resulted in a threefold increase in benthic fauna compared with a control area. The largest increase in numbers was Chironomidae in August-September, when benthic Crustacea also showed a significant increase. An increase in macrobenthos is expected to increase the growth and survival of young salmon fry. (Author)

  2. GABAergic anxiolytic drug in water increases migration behaviour in salmon

    Science.gov (United States)

    Hellström, Gustav; Klaminder, Jonatan; Finn, Fia; Persson, Lo; Alanärä, Anders; Jonsson, Micael; Fick, Jerker; Brodin, Tomas

    2016-12-01

    Migration is an important life-history event in a wide range of taxa, yet many migrations are influenced by anthropogenic change. Although migration dynamics are extensively studied, the potential effects of environmental contaminants on migratory physiology are poorly understood. In this study we show that an anxiolytic drug in water can promote downward migratory behaviour of Atlantic salmon (Salmo salar) in both laboratory setting and in a natural river tributary. Exposing salmon smolt to a dilute concentration of a GABAA receptor agonist (oxazepam) increased migration intensity compared with untreated smolt. These results implicate that salmon migration may be affected by human-induced changes in water chemical properties, such as acidification and pharmaceutical residues in wastewater effluent, via alterations in the GABAA receptor function.

  3. 78 FR 33810 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2013-06-05

    ... Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery AGENCY: National Marine... reduction loan for the fishing capacity reduction program in the Southeast Alaska purse seine salmon fishery... July 22, 2012. Since then, all harvesters of Southeast Alaska purse seine salmon must pay the fee and...

  4. 77 FR 19004 - Fishing Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery

    Science.gov (United States)

    2012-03-29

    ... Capacity Reduction Program for the Southeast Alaska Purse Seine Salmon Fishery AGENCY: National Marine... Salmon Fishery. DATES: Comments must be submitted on or before 5 p.m. EST April 13, 2012. ADDRESSES: Send... Seine Salmon Buyback, 1315 East-West Highway, Silver Spring, MD 20910 (see FOR FURTHER INFORMATION...

  5. Potentiometric determination of trypsin using a polymeric membrane polycation-sensitive electrode based on current-controlled reagent delivery.

    Science.gov (United States)

    Chen, Yan; Ding, Jiawang; Qin, Wei

    2012-12-01

    A potentiometric biosensor for the determination of trypsin is described based on current-controlled reagent delivery. A polymeric membrane protamine-sensitive electrode with dinonylnaphthalene sulfonate as cation exchanger is used for in situ generation of protamine. Diffusion of protamine across the polymeric membrane can be controlled precisely by applying an external current. The hydrolysis catalyzed with trypsin in sample solution decreases the concentration of free protamine released at the sample-membrane interface and facilitates the stripping of protamine out of the membrane surface via the ion-exchange process with sodium ions from the sample solution, thus decreasing the membrane potential, by which the protease can be sensed potentiometrically. The influences of anodic current amplitude, current pulse duration and protamine concentration in the inner filling solution on the membrane potential response have been studied. Under optimum conditions, the proposed protamine-sensitive electrode is useful for continuous and reversible detection of trypsin over the concentration range of 0.5-5UmL(-1) with a detection limit of 0.3UmL(-1). The proposed detection strategy provides a rapid and reagentless way for the detection of protease activities and offers great potential in the homogeneous immunoassays using proteases as labels. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Post-Closure Inspection, Sampling, and Maintenance Report for the Salmon, Mississippi, Site Calendar Year 2011

    Energy Technology Data Exchange (ETDEWEB)

    None

    2012-03-01

    This report summarizes the 2011 annual inspection, sampling, measurement, and maintenance activities performed at the Salmon, Mississippi, Site (Salmon site1). The draft Long-Term Surveillance and Maintenance Plan for the Salmon Site, Lamar County, Mississippi (DOE 2007) specifies the submittal of an annual report of site activities with the results of sample analyses. The Salmon site consists of 1,470 acres. The site is located in Lamar County, Mississippi, approximately 10 miles west of Purvis, Mississippi, and about 21 miles southwest of Hattiesburg, Mississippi.

  7. Chemical properties and colors of fermenting materials in salmon fish sauce production.

    Science.gov (United States)

    Nakano, Mitsutoshi; Sagane, Yoshimasa; Koizumi, Ryosuke; Nakazawa, Yozo; Yamazaki, Masao; Watanabe, Toshihiro; Takano, Katsumi; Sato, Hiroaki

    2018-02-01

    This data article reports the chemical properties (moisture, pH, salinity, and soluble solid content) and colors of fermenting materials in salmon fish sauce products. The fish sauce was produced by mixing salt with differing proportions of raw salmon materials and fermenting for three months; the salmon materials comprised flesh, viscera, an inedible portion, and soft roe. Chemical properties and colors of the unrefined fish sauce ( moromi ), and the refined fish sauce, were analyzed at one, two, and three months following the start of fermentation. Data determined for all products are provided in table format.

  8. Lower Columbia River salmon business plan for terminal fisheries. Final report

    International Nuclear Information System (INIS)

    1996-07-01

    Salmon fishing in the Northwest requires a public-private partnership. The public through its decision-makers, agencies, and laws states it will do all that is necessary to protect and preserve the valuable salmon resource. Yet, the public side of the partnership is broken. The Columbia River salmon fishing industry, with over 140 years of documented history, is at a crossroads. This report explores a variety of issues, concerns, and ideas related to terminal fishery development. In some cases recommendations are made. In addition, options are explored with an understanding that those designated as decision-makers must make decisions following considerable discussion and reflection

  9. Lower Columbia River Salmon Business Plan for Terminal Fisheries : Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Salmon For All

    1996-07-01

    Salmon fishing in the Northwest requires a public-private partnership. The public through its decision-makers, agencies, and laws states it will do all that is necessary to protect and preserve the valuable salmon resource. Yet, the public side of the partnership is broken. The Columbia River salmon fishing industry, with over 140 years of documented history, is at a crossroads. This report explores a variety of issues, concerns, and ideas related to terminal fishery development. In some cases recommendations are made. In addition, options are explored with an understanding that those designated as decision-makers must make decisions following considerable discussion and reflection.

  10. Sensory and chemical changes in farmed Atlantic salmon ( Salmo salar ) during frozen storage

    DEFF Research Database (Denmark)

    Refsgaard, Hanne; Brockhoff, P.B.; Jensen, Benny

    1998-01-01

    Farmed Atlantic salmon (Salmo salar) were stored as fillets at -10 and -20 degrees C and whole at -30 degrees C. The most pronounced sensory changes were first recognized by the assessors, when the salmon samples were in the oral cavity, and were significant increases in train oil taste, metal...... during storage. The content of lipid hydroperoxides and free fatty acids also increased during storage, and the changes were fastest in salmon stored at -10 degrees C. A decrease in highly unsaturated fatty acids was observed in salmon stored at -10 and -20 degrees C. Peroxide values and the content...... of free fatty acids were shown by a partial least-squares analysis to be the best of the instrumental data in describing the sensory changes....

  11. 1992 Columbia River Salmon Flow Measures Options Analysis/EIS : Appendices.

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described. The document concludes with an evaluation of the potential effects that could result from implementing proposed actions. The conclusions are based on evaluation of existing data, utilization of numerical models, and application of logical inference. This volume contains the appendices.

  12. 1992 Columbia River salmon flow measures Options Analysis/EIS: Appendices

    International Nuclear Information System (INIS)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described. The document concludes with an evaluation of the potential effects that could result from implementing proposed actions. The conclusions are based on evaluation of existing data, utilization of numerical models, and application of logical inference. This volume contains the appendices

  13. AFSC/ABL: Chum salmon allozyme baseline

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Allozymes from 46 loci were analyzed from chum salmon (Oncorhynchus keta) collected at 61 locations in southeast Alaska and northern British Columbia. Of the 42...

  14. Pacific Northwest Salmon Habitat Project Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In the Pacific Northwest Salmon Habitat Project Database Across the Pacific Northwest, both public and private agents are working to improve riverine habitat for a...

  15. Land use, fishing, climate change, and decline of Thompson River, British Columbia, coho salmon

    Energy Technology Data Exchange (ETDEWEB)

    Bradford, M. J.; Irvine, J. R. [Fisheries and Oceans Canada, Pacific Biological Station, Nanaimo, BC (Canada)

    2000-01-01

    Reasons for the decline in abundance of Pacific salmon population in the Thompson River watershed in British Columbia was investigated. Results suggests that the decline could be the result of a declining trend in productivity related to changes in ocean conditions, overfishing, and changes in the freshwater habitat. The abundance of salmon correlated with agricultural land use, road density, and qualitative changes in stream habitat status; logging appeared to have had no such effect. It was concluded that salmon populations will continue to decline unless limits on fishing are strictly enforced, and unless salmon producing watersheds are restored and ocean conditions are significantly improved . 12 refs., 2 figs.

  16. Snake River Sockeye Salmon Captive Broodstock Program; Hatchery Element, 2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Dan J.; Heindel, Jeff A.; Redding, Jeremy (Idaho Department of Fish and Game, Boise, ID)

    2006-05-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and the National Marine Fisheries Service initiated efforts to conserve and rebuild populations in Idaho. Initial steps to recover sockeye salmon included the establishment of a captive broodstock program at the Idaho Department of Fish and Game Eagle Fish Hatchery. Sockeye salmon broodstock and culture responsibilities are shared with the National Oceanic and Atmospheric Administration at two locations adjacent to Puget Sound in Washington State. Activities conducted by the Shoshone-Bannock Tribes and the National Oceanic and Atmospheric Administration are reported under separate cover. Idaho Department of Fish and Game monitoring and evaluation activities of captive broodstock program fish releases (annual report to the Bonneville Power Administration for the research element of the program) are also reported separately. Captive broodstock program activities conducted between January 1, 2004 and December 31, 2004 for the hatchery element of the program are presented in this report. In 2004, twenty-seven anadromous sockeye salmon returned to the Sawtooth Valley. Traps on Redfish Lake Creek and the upper Salmon River at the Sawtooth Fish Hatchery intercepted one and four adults, respectively. Additionally, one adult sockeye salmon was collected at the East Fork Salmon River weir, 18 were seined from below the Sawtooth Fish Hatchery weir, one adult sockeye salmon was observed below the Sawtooth Fish Hatchery weir but not captured, and two adult sockeye salmon were observed in Little Redfish Lake but not captured. Fish were captured/collected between July 24 and September 14, 2004. The captured/collected adult sockeye salmon (12 females and 12 males) originated from a variety of release strategies and were transferred to

  17. Antibodies recognizing both IgM isotypes in Atlantic salmon

    DEFF Research Database (Denmark)

    Hedfors, Ida Aagård; Bakke, Hege; Skjødt, Karsten

    2012-01-01

    these molecules. The present study aimed at identifying tools to separate IgM positive (IgM(+)) B cells from IgM negative (IgM(-)) non-B cell populations using flow cytometry. Several monoclonal antibodies (mAbs), and one polyclonal antibody (pAb) to both rainbow trout (Oncorhynchus mykiss) and Atlantic salmon...... (Salmo salar) IgM, either commercially available or locally produced were tested for their recognition of Atlantic salmon IgM(+) cells. Leukocytes were isolated from peripheral blood (PB), spleen (S) and head kidney (HK) and stained with all mAbs and the pAb, to possibly verify the approximate number...... of IgM(+) cells in the respective tissues in salmon. To our surprise, this seemingly simple task did not reveal similar staining patterns for all antibodies as expected, but rather large differences in the number of positively stained cells were discovered. In short, positively stained cells by each...

  18. Salmon Habitat Modeling Using VELMA

    Science.gov (United States)

    An EPA Western Ecology Division (WED) watershed modeling team has developed a watershed simulation model, VELMA, that state and federal agencies are interested in using for salmon recovery planning in the Pacific Northwest. Team member Bob McKane has been invited to serve on an e...

  19. Spawning salmon disrupt trophic coupling between wolves and ungulate prey in coastal British Columbia

    Directory of Open Access Journals (Sweden)

    Darimont Chris T

    2008-09-01

    Full Text Available Abstract Background As a cross-boundary resource subsidy, spawning salmon can strongly affect consumer and ecosystem ecology. Here we examine whether this marine resource can influence a terrestrial wolf-deer (Canis lupus-Odocoileus hemionus predator-prey system in coastal British Columbia, Canada. Data on resource availability and resource use among eight wolf groups for three seasons over four years allow us to evaluate competing hypotheses that describe salmon as either an alternate resource, consumed in areas where deer are scarce, or as a targeted resource, consumed as a positive function of its availability. Faecal (n = 2203 wolf scats and isotopic analyses (n = 60 wolf hair samples provide independent data sets, also allowing us to examine how consistent these common techniques are in estimating foraging behaviour. Results At the population level during spring and summer, deer remains occurred in roughly 90 and 95% of faeces respectively. When salmon become available in autumn, however, the population showed a pronounced dietary shift in which deer consumption among groups was negatively correlated (r = -0.77, P 13C isotopic signatures (r = 0.78; P = 0.008, which were calculated by intra-hair comparisons between segments grown during summer and fall. The magnitude of this seasonal isotopic shift, our proxy for salmon use, was related primarily to estimates of salmon availability, not deer availability, among wolf groups. Conclusion Concordance of faecal and isotopic data suggests our intra-hair isotopic methodology provides an accurate proxy for salmon consumption, and might reliably track seasonal dietary shifts in other consumer-resource systems. Use of salmon by wolves as a function of its abundance and the adaptive explanations we provide suggest a long-term and widespread association between wolves and salmon. Seasonally, this system departs from the common wolf-ungulate model. Broad ecological implications include the potential

  20. Resistance and Protective Immunity in Redfish Lake Sockeye Salmon Exposed to M Type Infectious Hematopoietic Necrosis Virus (IHNV)

    Science.gov (United States)

    Kurath, Gael; Garver, Kyle; Purcell, Maureen K.; LaPatra, Scott E.

    2010-01-01

    Differential virulence of infectious hematopoietic necrosis virus (IHNV) isolates from the U and M phylogenetic subgroups is clearly evident in the Redfish Lake (RFL) strain of sockeye salmon Oncorhynchus nerka. In these fish, experimental immersion challenges with U isolates cause extremely high mortality and M isolates cause low or no mortality. When survivors of M virus immersion challenges were exposed to a secondary challenge with virulent U type virus they experienced high mortality, indicating that the primary M challenge did not elicit protective immunity. Delivery of a moderate dose (2 × 104 plaque-forming units [PFU]/fish) of virus by intraperitoneal injection challenge did not overcome RFL sockeye salmon resistance to M type IHNV. Injection challenge with a high dose (5 × 106 PFU/fish) of M type virus caused 10% mortality, and in this case survivors did develop protective immunity against a secondary U type virus challenge. Thus, although it is possible for M type IHNV to elicit cross-protective immunity in this disease model, it does not develop after immersion challenge despite entry, transient replication of M virus to low levels, stimulation of innate immune genes, and development of neutralizing antibodies in some fish.

  1. A trypsin inhibitor from Tecoma stans leaves inhibits growth and promotes ATP depletion and lipid peroxidation in Candida albicans and Candida krusei

    Directory of Open Access Journals (Sweden)

    Leydianne Leite de Siqueira Patriota

    2016-04-01

    Full Text Available Tecoma stans (yellow elder has shown medicinal properties and antimicrobial activity. Previous reports on antifungal activity of T. stans preparations and presence of trypsin inhibitor activity from T. stans leaves stimulated the investigation reported here. In this work, we proceeded to the purification and characterization of a trypsin inhibitor (TesTI, which was investigated for anti-Candida activity. Finally, in order to determine the potential of TesTI as a new natural chemotherapeutic product, its cytotoxicity to human peripheral blood mononuclear cells (PBMCs was evaluated. TesTI was isolated from saline extract by ammonium sulphate fractionation followed by ion exchange and gel filtration chromatographies. Antifungal activity was evaluated by determining the minimal inhibitory (MIC and fungicide (MFC concentrations using fungal cultures containing only yeast form or both yeast and hyphal forms. Candida cells treated with TesTI were evaluated for intracellular ATP levels and lipid peroxidation. Cytotoxicity of TesTI to PBMCs was evaluated by MTT assay. TesTI (39.8 kDa, pI 3.41, Ki 43 nM inhibited similarly the growth of both C. albicans and C. krusei culture types at MIC of 100 µg/mL. The MFCs were 200 µg/mL for C. albicans and C. krusei. Time-response curves revealed that TesTI (at MIC was more effective at inhibiting the replication of C. albicans cells. At MIC, TesTI promoted reduction of ATP levels and lipid peroxidation in the Candida cells, being not cytotoxic to PBMCs. In conclusion, TesTI is an antifungal agent against C. albicans and C. krusei, without toxicity to human cells.

  2. 75 FR 32370 - Final Results of Antidumping Duty Changed Circumstances Review: Fresh and Chilled Atlantic Salmon...

    Science.gov (United States)

    2010-06-08

    ... Duty Changed Circumstances Review: Fresh and Chilled Atlantic Salmon from Norway AGENCY: Import... Duty Changed Circumstances Review: Fresh and Chilled Atlantic Salmon from Norway SUMMARY: On August 5... antidumping order on fresh and chilled Atlantic Salmon from Norway and preliminarily determined that Nordic...

  3. 78 FR 30780 - Fisheries Off West Coast States; Modifications of the West Coast Commercial Salmon Fisheries...

    Science.gov (United States)

    2013-05-23

    ... Commercial Salmon Fisheries; Inseason Action 3 AGENCY: National Marine Fisheries Service (NMFS), National... in the ocean salmon fisheries. This inseason action modified the commercial fisheries in the area... ocean salmon fisheries (78 FR 25865, May 3, 2013), NMFS announced the commercial and recreational...

  4. 76 FR 8345 - Endangered and Threatened Species; Recovery Plan Module for Columbia River Estuary Salmon and...

    Science.gov (United States)

    2011-02-14

    ... and Threatened Species; Recovery Plan Module for Columbia River Estuary Salmon and Steelhead AGENCY.... ACTION: Notice of availability; recovery plan module for Columbia River estuary salmon and steelhead... Plan Module for Salmon and Steelhead (Estuary Module). The Estuary Module addresses the estuary...

  5. Activity of trypsin-like enzymes and gelatinases in rats with doxorubicin cardiomyopathy

    OpenAIRE

    Iu. А. Gordiienko; Ya. V. Babets; А. О. Kulinich; А. І. Shevtsova; G. О. Ushakova

    2014-01-01

    Activity of trypsin-like enzymes (ATLE) and gelatinases A and B were studied in the blood plasma and extracts from cardiac muscle, cerebral cortex and cerebellum of rats with cardiomyopathy caused by anthracycline antibiotic doxorubicin against the background of preventive application of corvitin and α-ketoglutarate. ATLE significantly increased in blood plasma and extracts from cerebral cortex but decreased in extracts from cardiac muscle and cerebellum in doxorubicin cardiomyopathy (DCMP). ...

  6. Salmon Aquaculture and Antimicrobial Resistance in the Marine Environment

    Science.gov (United States)

    Buschmann, Alejandro H.; Tomova, Alexandra; López, Alejandra; Maldonado, Miguel A.; Henríquez, Luis A.; Ivanova, Larisa; Moy, Fred; Godfrey, Henry P.; Cabello, Felipe C.

    2012-01-01

    Antimicrobials used in salmon aquaculture pass into the marine environment. This could have negative impacts on marine environmental biodiversity, and on terrestrial animal and human health as a result of selection for bacteria containing antimicrobial resistance genes. We therefore measured the numbers of culturable bacteria and antimicrobial-resistant bacteria in marine sediments in the Calbuco Archipelago, Chile, over 12-month period at a salmon aquaculture site approximately 20 m from a salmon farm and at a control site 8 km distant without observable aquaculture activities. Three antimicrobials extensively used in Chilean salmon aquaculture (oxytetracycline, oxolinic acid, and florfenicol) were studied. Although none of these antimicrobials was detected in sediments from either site, traces of flumequine, a fluoroquinolone antimicrobial also widely used in Chile, were present in sediments from both sites during this period. There were significant increases in bacterial numbers and antimicrobial-resistant fractions to oxytetracycline, oxolinic acid, and florfenicol in sediments from the aquaculture site compared to those from the control site. Interestingly, there were similar numbers of presumably plasmid-mediated resistance genes for oxytetracycline, oxolinic acid and florfenicol in unselected marine bacteria isolated from both aquaculture and control sites. These preliminary findings in one location may suggest that the current use of large amounts of antimicrobials in Chilean aquaculture has the potential to select for antimicrobial-resistant bacteria in marine sediments. PMID:22905164

  7. Salmon aquaculture and antimicrobial resistance in the marine environment.

    Directory of Open Access Journals (Sweden)

    Alejandro H Buschmann

    Full Text Available Antimicrobials used in salmon aquaculture pass into the marine environment. This could have negative impacts on marine environmental biodiversity, and on terrestrial animal and human health as a result of selection for bacteria containing antimicrobial resistance genes. We therefore measured the numbers of culturable bacteria and antimicrobial-resistant bacteria in marine sediments in the Calbuco Archipelago, Chile, over 12-month period at a salmon aquaculture site approximately 20 m from a salmon farm and at a control site 8 km distant without observable aquaculture activities. Three antimicrobials extensively used in Chilean salmon aquaculture (oxytetracycline, oxolinic acid, and florfenicol were studied. Although none of these antimicrobials was detected in sediments from either site, traces of flumequine, a fluoroquinolone antimicrobial also widely used in Chile, were present in sediments from both sites during this period. There were significant increases in bacterial numbers and antimicrobial-resistant fractions to oxytetracycline, oxolinic acid, and florfenicol in sediments from the aquaculture site compared to those from the control site. Interestingly, there were similar numbers of presumably plasmid-mediated resistance genes for oxytetracycline, oxolinic acid and florfenicol in unselected marine bacteria isolated from both aquaculture and control sites. These preliminary findings in one location may suggest that the current use of large amounts of antimicrobials in Chilean aquaculture has the potential to select for antimicrobial-resistant bacteria in marine sediments.

  8. Congener Patterns of Persistent Organic Pollutants Establish the Extent of Contaminant Biotransport by Pacific Salmon in the Great Lakes.

    Science.gov (United States)

    Gerig, Brandon S; Chaloner, Dominic T; Janetski, David J; Rediske, Richard R; O'Keefe, James P; Moerke, Ashley H; Lamberti, Gary A

    2016-01-19

    In the Great Lakes, introduced Pacific salmon (Oncorhynchus spp.) can transport persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs), to new environments during their spawning migrations. To explore the nature and extent of POP biotransport by salmon, we compared 58 PCB and 6 PBDE congeners found in spawning salmon directly to those in resident stream fish. We hypothesized that stream fish exposed to salmon spawners would have congener patterns similar to those of salmon, the presumed contaminant source. Using permutational multivariate analysis of variance (PERMANOVA) and nonmetric multidimensional scaling (NMDS), we found that POP congener patterns of Pacific salmon varied among regions in the Great Lakes basin (i.e., Lake Huron, Lake Michigan, or Lake Superior), tissue type (whole fish or eggs), and contaminant type (PCB or PBDE). For stream-resident fish, POP congener pattern was influenced by the presence of salmon, location (i.e., Great Lakes Basin), and species identity (i.e., brook trout [Salvelinus fontinalis] or mottled sculpin [Cottus bairdii]). Similarity in congener patterns indicated that salmon are a source of POPs to brook trout in stream reaches receiving salmon spawners from Lake Michigan and Lake Huron but not from Lake Superior. Congener patterns of mottled sculpin differed from those of brook trout and salmon, suggesting that brook trout and mottled sculpin either use salmon tissue to differing degrees, acquire POPs from different dietary sources, or bioaccumulate or metabolize POPs differently. Overall, our analyses identified the important role of salmon in contaminant biotransport but also demonstrated that the extent of salmon-mediated POP transfer and uptake in Great Lakes tributaries is location- and species-specific.

  9. How much Baltic salmon can be consumed without exceeding the tolerable safety limit ?

    Energy Technology Data Exchange (ETDEWEB)

    Kristiansen, H.R. [Mobile Nutrients Ltd. (Denmark)

    2004-09-15

    Because Baltic salmon is a top predator preying on sprat, herring and tobis, it is very vulnerable to contamination with dioxin and PCBs. The EU safety limit (SL) for fish is 4 picogram (pg) WHOTEQ g{sup -1} fresh fish. In April 2004, Danish commercial salmon fishing was banned to in the Baltic sea around Bornholm and Gotland (mainly ICES areas 25, 26), because the Food Administration reported dioxin levels exceeding the intervention level of 3 pg g{sup -1} fresh salmon. Their report was based on data from 10 individual salmon, and 3 pooled samples, each with 10 salmon. Since dioxins are widespread in the environment, the human population face a trade off to produce sufficient food that is safe to eat and avoid eating contaminated food. The world population is increasing, and the demand for healthy food is steadily increasing. Consequently, there is a need for risk assessments, where the consequences of eating foods with different grades of contamination is evaluated. The evaluation must be based on data of high quality, and because dioxin accumulation is a slow proces, the risk assessments should consider long time periods of months and years instead of days and weeks. The purpose of the present study is to evaluate the statistical variation of dioxin data from Baltic herring and salmon. The data are used to calculate the quantity of herring and salmon, that humans of different body weight can eat without exceeding the tolerable daily intake (TDI). (In dietary recommendations exposure from dairy products etc. must also be taken into account). A PCDD/F box model is proposed that subtract losses during cooking and postprandially.

  10. Diel and seasonal variation in food habits of Atlantic salmon parr in a small stream

    Science.gov (United States)

    Grader, M.; Letcher, B.H.

    2006-01-01

    The diel and seasonal food habits of young-of-year (YOY) and post-young-of-year (PYOY) Atlantic salmon (Salmo salar) parr were assayed over the course of 11 months in the West Brook, Massachusetts USA. Gut fullness of YOY salmon did not vary significantly among months. PYOY salmon exhibited significant seasonal differences in gut fullness, with peak fullness occurring in the spring and late fall. Significant diel differences in PYOY gut fullness occurred in June and April, with peak fullness always occurring at dawn. Prey composition varied substantially among months. Dominant prey items of PYOY salmon were baetid mayflies in June, July, and August, limnephilid caddisflies in October and November, and ephemerellid mayflies in February and April. Few differences in prey composition between PYOY and YOY salmon were observed. Fish growth was unrelated to prey availability, but gut fullness explained up to 97% of growth variation across seasons. Results suggest that spring and fall are critical periods of feeding for PYOY salmon and that diel feeding intensity shifts seasonally.

  11. Spawning Habitat Studies of Hanford Reach Fall Chinook Salmon (Oncorhynchus tshawytscha), Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Geist, David R.; Arntzen, Evan V.; Chien, Yi-Ju (Pacific Northwest National Laboratory)

    2009-03-02

    The Pacific Northwest National Laboratory conducted this study for the Bonneville Power Administration (BPA) with funding provided through the Northwest Power and Conservation Council(a) and the BPA Fish and Wildlife Program. The study was conducted in the Hanford Reach of the Columbia River. The goal of study was to determine the physical habitat factors necessary to define the redd capacity of fall Chinook salmon that spawn in large mainstem rivers like the Hanford Reach and Snake River. The study was originally commissioned in FY 1994 and then recommissioned in FY 2000 through the Fish and Wildlife Program rolling review of the Columbia River Basin projects. The work described in this report covers the period from 1994 through 2004; however, the majority of the information comes from the last four years of the study (2000 through 2004). Results from the work conducted from 1994 to 2000 were covered in an earlier report. More than any other stock of Pacific salmon, fall Chinook salmon (Oncorhynchus tshawytscha) have suffered severe impacts from the hydroelectric development in the Columbia River Basin. Fall Chinook salmon rely heavily on mainstem habitats for all phases of their life cycle, and mainstem hydroelectric dams have inundated or blocked areas that were historically used for spawning and rearing. The natural flow pattern that existed in the historic period has been altered by the dams, which in turn have affected the physical and biological template upon which fall Chinook salmon depend upon for successful reproduction. Operation of the dams to produce power to meet short-term needs in electricity (termed power peaking) produces unnatural fluctuations in flow over a 24-hour cycle. These flow fluctuations alter the physical habitat and disrupt the cues that salmon use to select spawning sites, as well as strand fish in near-shore habitat that becomes dewatered. The quality of spawning gravels has been affected by dam construction, flood protection, and

  12. Inactivation of Staphylococcus aureus in raw salmon with supercritical CO2 using experimental design

    Directory of Open Access Journals (Sweden)

    Mônica CUPPINI

    2016-01-01

    Full Text Available Abstract Considering the microbial safety of consumption of raw foods (Asian food, this study aimed to explore the inactivation S. aureus in raw salmon by supercritical CO2 treatment (SC-CO2. For this purpose, experimental design methodology was employed as a tool to evaluate the effects of pressure (120-220 bar, the depressurization rate (10 to 100 bar.min–1 and the salmon:CO2 mass relation (1:0.2 to 1:1.0. It was observed that the pressure and the depressurization rate was statistically significant, i.e. the higher the system pressure and depressurization rate, the greater the microbial inactivation. The salmon: CO2 mass relation did not influence the S. aureus inactivation in raw salmon. There was a total reduction in S. aureus with 225 bar, a depressurizing rate of 100 bar.min–1, a salmon: CO2 mass relation of 1:0.6, for 2 hours at 33 °C.

  13. Post-mortem sporulation of Ceratomyxa shasta (Myxozoa) after death in adult Chinook salmon

    Science.gov (United States)

    Kent, Michael L.; Soderlund, K.; Thomann, E.; Schreck, Carl B.; Sharpton, T.J.

    2014-01-01

    Ceratomyxa shasta (Myxozoa) is a common gastrointestinal pathogen of salmonid fishes in the Pacific Northwest of the United States. We have been investigating this parasite in adult Chinook salmon (Oncorhynchus tshawytscha) in the Willamette River, Oregon. In prior work, we observed differences in the pattern of development of C. shasta in adult salmon compared to juvenile salmon. Adult salmon consistently had large numbers of prespore stages in many of the fish that survived to spawn in the fall. However, myxospores were rarely observed, even though they were exposed and presumably infected for months before spawning. We evaluated the ability of C. shasta to sporulate following fish death because it is reported that myxosores are common in carcasses of Chinook salmon. We collected the intestine from 30 adult salmon immediately after artificial spawning and death (T0). A total of 23 fish were infected with C. shasta based on histology, but only a few myxospores were observed in 1 fish by histology. Intestines of these fish were examined at T0 and T7 (latter held at 17 C for 7 days) using quantified wet mount preparations. An increase in myxospore concentrations was seen in 39% of these fish, ranging between a 1.5- to a 14.5-fold increase. The most heavily infected fish exhibited a 4.6-fold increase from 27,841 to 129,352 myxospores/cm. This indicates, supported by various statistical analyses, that under certain conditions presporogonic forms are viable and continue to sporulate after death in adult salmon. Considering the life cycle of C. shasta and anadromous salmon, the parasite may have evolved 2, non-mutually exclusive developmental strategies. In young fish (parr and smolts), the parasite sporulates shortly after infection and is released into freshwater from either live or dead fish before their migration to seawater, where the alternate host is absent. The second strategy occurs in adult salmon, particularly spring Chinook salmon, which become infected upon

  14. Parallel signatures of selection in temporally isolated lineages of pink salmon

    DEFF Research Database (Denmark)

    Seeb, L. W.; Waples, R. K.; Limborg, M. T.

    2014-01-01

    Studying the effect of similar environments on diverse genetic backgrounds has long been a goal of evolutionary biologists with studies typically relying on experimental approaches. Pink salmon, a highly abundant and widely ranging salmonid, provide a naturally occurring opportunity to study......-associated DNA (RAD) sequencing to discover and genotype approximately 8000 SNP loci in three population pairs of even- and odd-year pink salmon along a latitudinal gradient in North America. We found greater differentiation within the odd-year than within the even-year lineage and greater differentiation...... be particularly informative in understanding adaptive evolution in pink salmon and exploring how differing genetic backgrounds within a species respond to selection from the same natural environment...

  15. Stimulation of allogeneic lymphocytes by skin epidermal cells in the rat

    International Nuclear Information System (INIS)

    Tanaka, S.; Sakai, A.

    1979-01-01

    The ability of skin epidermal cells to induce allogeneic lymphocytes into proliferation was examined in mixed skin cell-lymphocyte culture reaction (MSLR). The stimulatng capacity of skin cells was reduced significantly by trypsin digestion, although the damage was repaired by incubation at 37 C for 3 hr. The optimal concentration of mitomycin C for treatment of stimulating cells in the MSLR differed from that in mixed lymphocyte culture reaction (MLR). Irradiation rendered them three to four times more stimulatory than did mitomycin C. Removal of adherent cells from responding cells by passage through a nylon-wool column gave a substantial elevation of the MSLR. The lymphocytes cocultured with skin cells in the primary MSLR incorporated 3 H-thymidine, with the peak at the 6th day of culture. If the lymphocytes primed in the MSLR were restimulated with skin cells from the same stimulating strain, the primed lymphocytes responded promptly and in great magnitude

  16. Hydro models and salmon recovery in the northwest

    International Nuclear Information System (INIS)

    Dragoon, K.

    1993-01-01

    Hydro regulation models provide extensive support for analyzing the efficacy of salmon recovery plans in the Northwest. Power planners developed these computer programs to help plan and efficiently operate a large multiple use river system. The models represent physical relationships and operational requirements on the system. They also simulate coordinated system operations for efficient power generation. These models are being pressed into service to provide data for fish recovery plans. They provide important information about hydro system capabilities and responses to recovery programs. However, the models cannot meet all of the analytical needs of fish biologists working toward salmon recovery

  17. 76 FR 43650 - Notice of Request for Extension of Approval of an Information Collection; Infectious Salmon...

    Science.gov (United States)

    2011-07-21

    ...] Notice of Request for Extension of Approval of an Information Collection; Infectious Salmon Anemia... of indemnity due to infectious salmon anemia. DATES: We will consider all comments that we receive on... the payment of indemnity due to infectious salmon anemia, contact Dr. William G. Smith, Area...

  18. 75 FR 383 - Canned Pacific Salmon Deviating From Identity Standard; Extension of Temporary Permit for Market...

    Science.gov (United States)

    2010-01-05

    ...] Canned Pacific Salmon Deviating From Identity Standard; Extension of Temporary Permit for Market Testing... test products designated as ``skinless and boneless sockeye salmon'' that deviate from the U.S. standard of identity for canned Pacific salmon. The extension will allow the permit holder to continue to...

  19. 78 FR 35153 - Fisheries Off West Coast States; Modifications of the West Coast Commercial Salmon Fisheries...

    Science.gov (United States)

    2013-06-12

    ... Commercial Salmon Fisheries; Inseason Actions 4 and 5 AGENCY: National Marine Fisheries Service (NMFS... inseason actions in the ocean salmon fisheries. These inseason actions modified the commercial fisheries in...: Background In the 2013 annual management measures for ocean salmon fisheries (78 FR 25865, May 3, 2013), NMFS...

  20. 76 FR 35755 - Listing Endangered and Threatened Species: Threatened Status for the Oregon Coast Coho Salmon...

    Science.gov (United States)

    2011-06-20

    ... Oregon Coast Coho Salmon Evolutionarily Significant Unit AGENCY: National Marine Fisheries Service (NMFS... the Oregon Coast (OC) Evolutionarily Significant Unit (ESU) of coho salmon (Oncorhynchus kisutch... coho salmon ESU as threatened under the ESA in 1995 (60 FR 38011; July 25, 1995). Since then, we have...

  1. Snake River Sockeye Salmon Captive Broodstock Program Hatchery Element : Project Progress Report 2007 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Dan J.; Heindel, Jeff A.; Green, Daniel G.; Kline, Paul A.

    2008-12-17

    Numbers of Snake River sockeye salmon Oncorhynchus nerka have declined dramatically in recent years. In Idaho, only the lakes of the upper Salmon River (Sawtooth Valley) remain as potential sources of production (Figure 1). Historically, five Sawtooth Valley lakes (Redfish, Alturas, Pettit, Stanley, and Yellowbelly) supported sockeye salmon (Bjornn et al. 1968; Chapman et al. 1990). Currently, only Redfish Lake receives a remnant anadromous run. On April 2, 1990, the National Oceanic and Atmospheric Administration Fisheries Service (NOAA - formerly National Marine Fisheries Service) received a petition from the Shoshone-Bannock Tribes (SBT) to list Snake River sockeye salmon as endangered under the United States Endangered Species Act (ESA) of 1973. On November 20, 1991, NOAA declared Snake River sockeye salmon endangered. In 1991, the SBT, along with the Idaho Department of Fish & Game (IDFG), initiated the Snake River Sockeye Salmon Sawtooth Valley Project (Sawtooth Valley Project) with funding from the Bonneville Power Administration (BPA). The goal of this program is to conserve genetic resources and to rebuild Snake River sockeye salmon populations in Idaho. Coordination of this effort is carried out under the guidance of the Stanley Basin Sockeye Technical Oversight Committee (SBSTOC), a team of biologists representing the agencies involved in the recovery and management of Snake River sockeye salmon. National Oceanic and Atmospheric Administration Fisheries Service ESA Permit Nos. 1120, 1124, and 1481 authorize IDFG to conduct scientific research on listed Snake River sockeye salmon. Initial steps to recover the species involved the establishment of captive broodstocks at the Eagle Fish Hatchery in Idaho and at NOAA facilities in Washington State (for a review, see Flagg 1993; Johnson 1993; Flagg and McAuley 1994; Kline 1994; Johnson and Pravecek 1995; Kline and Younk 1995; Flagg et al. 1996; Johnson and Pravecek 1996; Kline and Lamansky 1997; Pravecek and

  2. Compendium of Low-Cost Pacific Salmon and Steelhead Trout Production Facilities and Practices in the Pacific Northwest.

    Energy Technology Data Exchange (ETDEWEB)

    Senn, Harry G.

    1984-09-01

    The purpose was to research low capital cost salmon and steelhead trout production facilities and identify those that conform with management goals for the Columbia Basin. The species considered were chinook salmon (Oncorhynchus tshawytscha), coho salmon (O. kisutch), sockeye salmon (O. nerka), and steelhead trout (Salmo gairdneri). This report provides a comprehensive listing of the facilities, techniques, and equipment used in artificial production in the Pacific Northwest. (ACR)

  3. Inhibition of p38 MAPK during cellular activation modulate gene expression of head kidney leukocytes isolated from Atlantic salmon (Salmo salar) fed soy bean oil or fish oil based diets.

    Science.gov (United States)

    Holen, E; Winterthun, S; Du, Z-Y; Krøvel, A V

    2011-01-01

    Head kidney leukocytes isolated from Atlantic salmon fed either a diet based on fish oil (FO) or soy bean oil (VO) were used in order to evaluate if different lipid sources could contribute to cellular activation of the salmon innate immune system. A specific inhibitor of p38 MAPK, SB202190, was used to investigate the effect of lipopolysaccharide (LPS) signalling in the head kidney leukocytes. The results show that LPS up regulate IL-1β, TNF-α, Cox2 expression in leukocytes isolated from fish fed either diet. The p38 MAPK inhibitor, SB202190, reduced the LPS induced expression of these genes in both dietary groups. In LPS stimulated leukocytes isolated from VO fed fish, SB202190 showed a clear dose dependent inhibitory effect on IL-1β, TNF-α and Cox2 expression. This effect was also observed for Cox2 in leukocytes isolated from FO fed fish. Furthermore, there was a stronger mean induction of Cox2 in LPS stimulated leucocytes isolated from the VO-group compared to LPS stimulated leukocytes isolated from the FO-group. In both dietary groups, LPS stimulation of salmon head kidney leukocytes increased the induction of CD83, a dendrite cell marker, while the inhibitor reduced CD83 expression in the VO fed fish only. The inhibitor also clearly reduced hsp27 expression in VO fed fish. Indicating a p38 MAPK feedback loop, LPS significantly inhibited the expression of p38MAPK itself in both diets, while SB202190 increased p38MAPK expression especially in the VO diet group. hsp70 expression was not affected by any treatment or feed composition. There were also differences in p38MAPK protein phosphorylation comparing treatment groups but no obvious difference comparing the two dietary groups. The results indicate that dietary fatty acids have the ability to modify signalling through p38 MAPK which may have consequences for the fish's ability to handle infections and stress. Signalling through p38MAPK is ligand dependent and affects gene and protein expression differently

  4. The Salmon Louse Lepeophtheirus salmonis (Copepoda: Caligidae life cycle has only two Chalimus stages.

    Directory of Open Access Journals (Sweden)

    Lars A Hamre

    Full Text Available Each year the salmon louse (Lepeophtheirussalmonis Krøyer, 1838 causes multi-million dollar commercial losses to the salmon farming industry world-wide, and strict lice control regimes have been put in place to reduce the release of salmon louse larvae from aquaculture facilities into the environment. For half a century, the Lepeophtheirus life cycle has been regarded as the only copepod life cycle including 8 post-nauplius instars as confirmed in four different species, including L. salmonis. Here we prove that the accepted life cycle of the salmon louse is wrong. By observations of chalimus larvae molting in incubators and by morphometric cluster analysis, we show that there are only two chalimus instars: chalimus 1 (comprising the former chalimus I and II stages which are not separated by a molt and chalimus 2 (the former chalimus III and IV stages which are not separated by a molt. Consequently the salmon louse life cycle has only six post-nauplius instars, as in other genera of caligid sea lice and copepods in general. These findings are of fundamental importance in experimental studies as well as for interpretation of salmon louse biology and for control and management of this economically important parasite.

  5. Salmon Site Remedial Investigation Report, Appendix C

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  6. Salmon Site Remedial Investigation Report, Exhibit 2

    Energy Technology Data Exchange (ETDEWEB)

    USDOE NV

    1999-09-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  7. Salmon Site Remedial Investigation Report, Appendix D

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  8. Salmon Site Remediation Investigation Report, Appendix A

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  9. Salmon Site Remedial Investigation Report, Main Body

    Energy Technology Data Exchange (ETDEWEB)

    US DOE/NV

    1999-09-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  10. Salmon Site Remedial Investigation Report, Exhibit 2

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  11. Salmon Site Remedial Investigation Report, Appendix C

    Energy Technology Data Exchange (ETDEWEB)

    US DOE/NV

    1999-09-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  12. Salmon Site Remedial Investigation Report, Exhibit 5

    Energy Technology Data Exchange (ETDEWEB)

    USDOE/NV

    1999-09-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  13. Salmon Site Remedial Investigation Report, Exhibit 5

    International Nuclear Information System (INIS)

    1999-01-01

    This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

  14. Radiotelemetry to estimate stream life of adult chum salmon in the McNeil River, Alaska

    Science.gov (United States)

    Peirce, Joshua M.; Otis, Edward O.; Wipfli, Mark S.; Follmann, Erich H.

    2011-01-01

    Estimating salmon escapement is one of the fundamental steps in managing salmon populations. The area-under-the-curve (AUC) method is commonly used to convert periodic aerial survey counts into annual salmon escapement indices. The AUC requires obtaining accurate estimates of stream life (SL) for target species. Traditional methods for estimating SL (e.g., mark–recapture) are not feasible for many populations. Our objective in this study was to determine the average SL of chum salmon Oncorhynchus keta in the McNeil River, Alaska, through radiotelemetry. During the 2005 and 2006 runs, 155 chum salmon were fitted with mortality-indicating radio tags as they entered the McNeil River and tracked until they died. A combination of remote data loggers, aerial surveys, and foot surveys were used to determine the location of fish and provide an estimate of time of death. Higher predation resulted in tagged fish below McNeil Falls having a significantly shorter SL (12.6 d) than those above (21.9 d). The streamwide average SL (13.8 d) for chum salmon at the McNeil River was lower than the regionwide value (17.5 d) previously used to generate AUC indices of chum salmon escapement for the McNeil River. We conclude that radiotelemetry is an effective tool for estimating SL in rivers not well suited to other methods.

  15. Laue diffraction as a tool in dynamic studies: Hydrolysis of a transiently stable intermediate in catalysis by trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Singer, P.T.; Berman, L.E.; Cai, Z.; Mangel, W.F.; Jones, K.W.; Sweet, R.M. (Brookhaven National Lab., Upton, NY (United States)); Carty, R.P. (State Univ. of New York, Brooklyn, NY (United States). Dept. of Biochemistry); Schlichting, I. (Brandeis Univ., Waltham, MA (United States). Rosenstiel Basic Medical Science Center); Stock, A. (Center for Advanced Biotechnology and Medicine, Piscataway, NJ (Un

    1992-01-01

    A transiently stable intermediate in trypsin catalysis, guanidinobenzyol-Ser-195 trypsin, can be trapped and then released by control of the pH in crystals of the enzyme. This effect has been investigated by static and dynamic white-beam Laue crystallography. Comparison of structures determined before and immediately after a pH jump reveals the nature of concerted changes that accompany activation of the enzyme. Careful analysis of the results of several structure determinations gives information about the reliability of Laue results in general. A study of multiple exposures taken under differing conditions of beam intensity, crystal quality, and temperature revealed information about ways to control damage of specimens by the x-ray beam.

  16. Laue diffraction as a tool in dynamic studies: Hydrolysis of a transiently stable intermediate in catalysis by trypsin

    Energy Technology Data Exchange (ETDEWEB)

    Singer, P.T.; Berman, L.E.; Cai, Z.; Mangel, W.F.; Jones, K.W.; Sweet, R.M. [Brookhaven National Lab., Upton, NY (United States); Carty, R.P. [State Univ. of New York, Brooklyn, NY (United States). Dept. of Biochemistry; Schlichting, I. [Brandeis Univ., Waltham, MA (United States). Rosenstiel Basic Medical Science Center; Stock, A. [Center for Advanced Biotechnology and Medicine, Piscataway, NJ (United States); Smalas, A. [Univ. of Tromso (Norway). Inst. of Mathematics and Physical Science

    1992-11-01

    A transiently stable intermediate in trypsin catalysis, guanidinobenzyol-Ser-195 trypsin, can be trapped and then released by control of the pH in crystals of the enzyme. This effect has been investigated by static and dynamic white-beam Laue crystallography. Comparison of structures determined before and immediately after a pH jump reveals the nature of concerted changes that accompany activation of the enzyme. Careful analysis of the results of several structure determinations gives information about the reliability of Laue results in general. A study of multiple exposures taken under differing conditions of beam intensity, crystal quality, and temperature revealed information about ways to control damage of specimens by the x-ray beam.

  17. Laue diffraction as a tool in dynamic studies: Hydrolysis of a transiently stable intermediate in catalysis by trypsin

    International Nuclear Information System (INIS)

    Singer, P.T.; Berman, L.E.; Cai, Z.; Mangel, W.F.; Jones, K.W.; Sweet, R.M.; Carty, R.P.; Smalas, A.

    1992-01-01

    A transiently stable intermediate in trypsin catalysis, guanidinobenzyol-Ser-195 trypsin, can be trapped and then released by control of the pH in crystals of the enzyme. This effect has been investigated by static and dynamic white-beam Laue crystallography. Comparison of structures determined before and immediately after a pH jump reveals the nature of concerted changes that accompany activation of the enzyme. Careful analysis of the results of several structure determinations gives information about the reliability of Laue results in general. A study of multiple exposures taken under differing conditions of beam intensity, crystal quality, and temperature revealed information about ways to control damage of specimens by the x-ray beam

  18. Quality Index Method (QIM) scheme developed for farmed Atlantic salmon ( Salmo salar )

    DEFF Research Database (Denmark)

    Sveinsdóttir, K.; Hyldig, Grethe; Martinsdóttir, E.

    2003-01-01

    The aim of the study was to develop 'Quality Index Method (QIM) scheme for raw, farmed Atlantic salmon (Salmo salar) and to evaluate the scheme. in a shelf life study. QIM is based on the evaluation of key parameters in the deterioration of seafood's. Demerit points are assigned to selected...... parameters according to their importance and a Quality Index (QI) is established by cumulating the resulting scores. The maximum storage time in ice was determined with Quantitative Descriptive Analysis (QDA) of the salmon after cooking and found to be 20-21 days. This was used as a reference to enable...... prediction of the remaining storage time of raw salmon in ice with QIM. The calculated QI evolved linearly with storage time in ice (QI=0.82x (days in ice)+0.18, R-2=0.97). Individual salmon varied in QI within each storage day. However, the multivariate analysis (PLS1) demonstrated that storage time could...

  19. 78 FR 50347 - Fisheries Off West Coast States; Modifications of the West Coast Commercial Salmon Fisheries...

    Science.gov (United States)

    2013-08-19

    ... Commercial Salmon Fisheries; Inseason Actions 6 Through 11 AGENCY: National Marine Fisheries Service (NMFS... salmon fisheries. These inseason actions modified the commercial fisheries in the area from the U.S...: Background In the 2013 annual management measures for ocean salmon fisheries (78 FR 25865, May 3, 2013), NMFS...

  20. Control of biological hazards in cold smoked salmon production

    DEFF Research Database (Denmark)

    Huss, Hans Henrik; Embarek, Peter Karim Ben; Jeppesen, V.F.

    1995-01-01

    An outline of the common processing technology for cold smoked salmon in Denmark is presented. The safety hazards related to pathogenic bacteria, parasites and biogenic amines are discussed with special emphasis on hazards related to Clostridium botulinum and Listeria monocytogenes. Critical...... control points are identified for all hazards except growth of L. monocytogenes. For this reason a limitation of shelf life to three weeks at +5 degrees C far cold smoked vacuum-packed salmon having greater than or equal to 3% water phase salt is recommended...

  1. Effects of salmon calcitonin on fracture healing in ovariectomized rats.

    Science.gov (United States)

    Li, Xiaolin; Luo, Xinle; Yu, Nansheng; Zeng, Bingfang

    2007-01-01

    To explore the effects of salmon calcitonin on the healing process of osteoporotic fractures in ovariectomized rats. We performed this study in The First Affiliated Hospital of Guangzhou Medical College, Guangzhou, China, during the period March 2002 to December 2004. We used 120 female adult Wistar rats in this experiment, among which 90 underwent ovariectomy (OVX) and the other 30 had sham-operation. All rats had their left tibias fractured 3 months later. The 90 OVX rats were randomly divided into 3 groups with 30 in each, while the 30 sham-operated rats served as control group. After the fracture the rats had subcutaneous injection of normal saline, salmon calcitonin and estrogen, respectively. X-ray film, histological examination, bone mineral density (BMD) measurement and biomechanics testing were carried out to evaluate the fracture healing. Compared with OVX rats treated with normal saline, the rats with salmon calcitonin had significantly higher BMD values in the left tibia, higher max torque, shear stress of the left tibia 8 weeks after fracture (pnormalization of microstructure of bone trabeculae. Salmon calcitonin can, not only increase BMD in osteoporotic bone, but also enhance the bone biomechanical properties and improve the process of fracture healing in fractured osteoporotic bone.

  2. Effects of salmon calcitonin on fracture healing in ovariectomized rats

    International Nuclear Information System (INIS)

    Li, Xiaolin; Zeng, Bingfang; Luo, Xinle; Yu, Nansheng

    2007-01-01

    Objective was to explore the effects of salmon calcitonin on the healing process of osteoporotic fractures in ovariectomized rats. We performed this study in the First Affiliated Hospital of Guangzhaou Medical College, Guangzhaou, China during the period March 2002 to December 2004. We used 120 female adult Wistar rats in this experiment, among which 90 underwent ovariectomy (OVX) and the other 30 had shamoperation. All rats had their left tibias fractured 3 months later. The 90 OVX rats were randomly divided into 3 groups with 30 in each, while the 30 shamoperated rats served as control group. After the fracture rats had subcutaneous injection of normal saline, salmon calcitonin and estrogen, respectively. X-ray film, histological examination, bone mineral density (BMD) measurement and biomechanics testing were carried out to evaluate the fracture healing. Compared with OVX rats treated normal saline, the rats with salmon calcitonin had significantly higher BMD values in the left tibia, higher max torque, shear stress of the left tibia 8 weeks after fracture (p<0.05), and presented with stronger callus formation, shorter fracture healing time and faster normalization of microstructure of bone trabeculae. Salmon calcitonin can, not only increase in osteoporotic bone biomechanical properties and improve the process of fractured osteoporotic bone. (author)

  3. Redfish Lake Sockeye Salmon Captive Broodstock Rearing and Research, 1995-2000 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Flagg, Thomas A.

    2001-01-01

    The National Marine Fisheries Service (NMFS) Northwest Fisheries Science Center, in cooperation with the Idaho Department of Fish and Game and the Bonneville Power Administration, has established captive broodstocks to aid recovery of Snake River sockeye salmon (Oncorhynchus nerka) listed as endangered under the US Endangered Species Act (ESA). Captive broodstock programs are a form of artificial propagation and are emerging as an important component of restoration efforts for ESA-listed salmon populations. However, they differ from standard hatchery techniques in one important respect: fish are cultured in captivity for the entire life cycle. The high fecundity of Pacific salmon, coupled with their potentially high survival in protective culture, affords an opportunity for captive broodstocks to produce large numbers of juveniles in a single generation for supplementation of natural populations. The captive broodstocks discussed in this report were intended to protect the last known remnants of this stock: sockeye salmon that return to Redfish Lake in the Sawtooth Basin of Idaho at the headwaters of the Salmon River. This report addresses NMFS research from January 1995 to August 2000 on the Redfish Lake sockeye salmon captive broodstock program and summarizes results since the beginning of the study in 1991. Since initiating captive brood culture in 1991, NMFS has returned 742,000 eyed eggs, 181 pre-spawning adults, and over 90,000 smolts to Idaho for recovery efforts. The first adult returns to the Stanley Basin from the captive brood program began with 7 in 1999, and increased to about 250 in 2000. NMFS currently has broodstock in culture from year classes 1996, 1997, 1998, and 1999 in both the captive broodstock program, and an adult release program. Spawn from NMFS Redfish Lake sockeye salmon captive broodstocks is being returned to Idaho to aid recovery efforts for the species.

  4. Cost-effective management alternatives for Snake River Chinook salmon: a biological-economic synthesis.

    Science.gov (United States)

    Halsing, David L; Moore, Michael R

    2008-04-01

    The mandate to increase endangered salmon populations in the Columbia River Basin of North America has created a complex, controversial resource-management issue. We constructed an integrated assessment model as a tool for analyzing biological-economic trade-offs in recovery of Snake River spring- and summer-run chinook salmon (Oncorhynchus tshawytscha). We merged 3 frameworks: a salmon-passage model to predict migration and survival of smolts; an age-structured matrix model to predict long-term population growth rates of salmon stocks; and a cost-effectiveness analysis to determine a set of least-cost management alternatives for achieving particular population growth rates. We assessed 6 individual salmon-management measures and 76 management alternatives composed of one or more measures. To reflect uncertainty, results were derived for different assumptions of effectiveness of smolt transport around dams. Removal of an estuarine predator, the Caspian Tern (Sterna caspia), was cost-effective and generally increased long-term population growth rates regardless of transport effectiveness. Elimination of adult salmon harvest had a similar effect over a range of its cost estimates. The specific management alternatives in the cost-effective set depended on assumptions about transport effectiveness. On the basis of recent estimates of smolt transport effectiveness, alternatives that discontinued transportation or breached dams were prevalent in the cost-effective set, whereas alternatives that maximized transportation dominated if transport effectiveness was relatively high. More generally, the analysis eliminated 80-90% of management alternatives from the cost-effective set. Application of our results to salmon management is limited by data availability and model assumptions, but these limitations can help guide research that addresses critical uncertainties and information. Our results thus demonstrate that linking biology and economics through integrated models can

  5. 50 CFR 226.204 - Critical habitat for Sacramento winter-run chinook salmon.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for Sacramento winter-run chinook salmon. 226.204 Section 226.204 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... § 226.204 Critical habitat for Sacramento winter-run chinook salmon. The following waterways, bottom and...

  6. Spring Chinook Salmon Interactions Indices and Residual/Precocial Monitoring in the Upper Yakima Basin, Annual Report 1998

    International Nuclear Information System (INIS)

    James, Brenda B.; Pearsons, Todd N.; McMichael, Geoffrey A.

    1999-01-01

    Select ecological interactions and spring chinook salmon residual/precocial abundance were monitored in 1998 as part of the Yakima/Klickitat Fisheries Project's supplementation monitoring program. Monitoring these variables is part of an effort to help evaluate the factors that contribute to, or limit supplementation success. The ecological interactions that were monitored were prey consumption, competition for food, and competition for space. The abundance of spring chinook salmon life-history forms that have the potential to be influenced by supplementation and that have important ecological and genetic roles were monitored (residuals and precocials). Residual spring chinook salmon do not migrate to the ocean during the normal emigration period and continue to rear in freshwater. Precocials are those salmon that precocially mature in freshwater. The purpose of sampling during 1998 was to collect baseline data one year prior to the release of hatchery spring chinook salmon which occurred during the spring of 1999. All sampling that the authors report on here was conducted in upper Yakima River during summer and fall 1998. The stomach fullness of juvenile spring chinook salmon during the summer and fall averaged 12%. The food competition index suggested that mountain whitefish (0.59), rainbow trout (0.55), and redside shiner (0.55) were competing for food with spring chinook salmon. The space competition index suggested that rainbow trout (0.31) and redside shiner (0.39) were competing for space with spring chinook salmon but mountain whitefish (0.05) were not. Age-0 spring chinook salmon selected a fairly narrow range of microhabitat parameters in the summer and fall relative to what was available. Mean focal depths and velocities for age 0 spring chinook salmon during the summer were 0.5 m ± 0.2 m and 0.26 m/s ± 0.19 m/s, and during the fall 0.5 m ± 0.2 m and 0.24 m/s ± 0.18 m/s. Among potential competitors, age 1+ rainbow trout exhibited the greatest degree

  7. Characteristics of dry- and brine-salted salmon later treated with liquid smoke flavouring

    Directory of Open Access Journals (Sweden)

    O. MARTINEZ

    2008-12-01

    Full Text Available The use of smoke flavourings for the processing of salmon has begun to substitute traditional smoking methods. This review examines the quality issues associated with salted salmon ‘smoked’ by this technique along the salting and smoking steps. Firstly, the evidence is examined to determine whether dry or brine salting is better for salmon flesh destined to be treated by liquid smoking. Secondly, influence of liquid smoking on the sensorial, physicochemical and textural characteristics of the flesh are described, as are its effects on potential spoilage organisms.;

  8. Grande Ronde Endemic Spring Chinook Salmon Supplementation Program: Monitoring and Evaluation, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Boe, Stephen J.; Weldert, Rey F.; Crump, Carrie A. (Confederated Tribes of the Umatilla Indian Reservation, Department of Natural Resources, Pendleton, OR)

    2003-03-01

    This is the fifth annual report of a multi-year project to operate adult collection and juvenile acclimation facilities on Catherine Creek and the upper Grande Ronde River for Snake River spring chinook salmon. These two streams have historically supported populations that provided significant tribal and non-tribal fisheries. Conventional and captive broodstock supplementation techniques are being used to restore spring chinook salmon fisheries in these streams. Statement of Work Objectives for 2002: (1) Plan for, administer, coordinate and assist comanagers in GRESCP M&E activities. (2) Evaluate performance of supplemented juvenile spring chinook salmon. (3) Evaluate life history differences between wild and hatchery-origin (F{sub 1}) adult spring chinook salmon. (4) Describe life history characteristics and genetics of adult summer steelhead collected at weirs.

  9. Effect of stocking sub-yearling Atlantic salmon on the habitat use of sub-yearling rainbow trout

    Science.gov (United States)

    Johnson, James H.

    2016-01-01

    Atlantic salmon (Salmo salar) restoration in the Lake Ontario watershed may depend on the species' ability to compete with naturalized non-native salmonids, including rainbow trout (Oncorhynchus mykiss) in Lake Ontario tributaries. This study examined interspecific habitat associations between sub-yearling Atlantic salmon and rainbow trout as well as the effect of salmon stocking on trout habitat in two streams in the Lake Ontario watershed. In sympatry, Atlantic salmon occupied significantly faster velocities and deeper areas than rainbow trout. However, when examining the habitat use of rainbow trout at all allopatric and sympatric sites in both streams, trout habitat use was more diverse at the sympatric sites with an orientation for increased cover and larger substrate. In Grout Brook, where available habitat remained constant, there was evidence suggesting that trout may have shifted to slower and shallower water in the presence of salmon. The ability of sub-yearling Atlantic salmon to affect a habitat shift in rainbow trout may be due to their larger body size and/or larger pectoral fin size. Future studies examining competitive interactions between these species during their first year of stream residence should consider the size advantage that earlier emerging Atlantic salmon will have over rainbow trout.

  10. Merits and Limits of Ecosystem Protection for Conserving Wild Salmon in a Northern Coastal British Columbia River

    Directory of Open Access Journals (Sweden)

    Aaron C. Hill

    2010-06-01

    Full Text Available Loss and degradation of freshwater habitat reduces the ability of wild salmon populations to endure other anthropogenic stressors such as climate change, harvest, and interactions with artificially propagated fishes. Preservation of pristine salmon rivers has thus been advocated as a cost-effective way of sustaining wild Pacific salmon populations. We examine the value of freshwater habitat protection in conserving salmon and fostering resilience in the Kitlope watershed in northern coastal British Columbia - a large (3186 km2 and undeveloped temperate rainforest ecosystem with legislated protected status. In comparison with other pristine Pacific Rim salmon rivers we studied, the Kitlope is characterized by abundant and complex habitats for salmon that should contribute to high resilience. However, biological productivity in this system is constrained by naturally cold, light limited, ultra-oligotrophic growing conditions; and the mean (± SD density of river-rearing salmonids is currently low (0.32 ± 0.27 fish per square meter; n = 36 compared to our other four study rivers (grand mean = 2.55 ± 2.98 fish per square meter; n = 224. Existing data and traditional ecological knowledge suggest that current returns of adult salmon to the Kitlope, particularly sockeye, are declining or depressed relative to historic levels. This poor stock status - presumably owing to unfavorable conditions in the marine environment and ongoing harvest in coastal mixed-stock fisheries - reduces the salmon-mediated transfer of marine-derived nutrients and energy to the system's nutrient-poor aquatic and terrestrial food webs. In fact, Kitlope Lake sediments and riparian tree leaves had marine nitrogen signatures (δ15N among the lowest recorded in a salmon ecosystem. The protection of the Kitlope watershed is undoubtedly a conservation success story. However, "salmon strongholds" of pristine watersheds may not adequately sustain salmon populations and foster

  11. Spawning distribution of fall chinook salmon in the Snake River: Annual report 1999

    International Nuclear Information System (INIS)

    Garcia, Aaron P.

    2000-01-01

    This report is separated into 2 chapters. The chapters are (1) Progress toward determining the spawning distribution of supplemented fall chinook salmon in the Snake River in 1999; and (2) Fall chinook salmon spawning ground surveys in the Snake River, 1999

  12. The Kuril Islands as a potential region for aquaculture: Trace elements in chum salmon

    International Nuclear Information System (INIS)

    Khristoforova, Nadezhda K.; Tsygankov, Vasiliy Yu.; Lukyanova, Olga N.; Boyarova, Margarita D.

    2016-01-01

    The Kuril Islands region is considered promising for development of salmon aquaculture. There are 41 salmon fish hatcheries in the Sakhalin Island and the Kuril Islands, 34 of them are hatcheries of the chum. Therefore, concentrations of six elements (Zn, Cu, Cd, Pb, As, and Hg) were determined in chum salmon were caught in this region. The contents of toxic elements (Cd, Pb, As, and Hg) don't exceed their maximum permissible concentrations (MPC) according to the Russian sanitary standards, but concentration of Pb are closely to MPC. Increased concentrations of Pb in wild chum have the natural origin. The unusual conditions of the Western Pacific are formed under the influence such factors as volcanism and upwelling. - Highlights: • High content of Pb, found in chum from the Kuril Islands, is caused by natural sources. • The content of elements do not exceed maximum permissible concentrations in Russia. • Kuril region is considered as promising zone for development of salmon aquaculture. - Kuril region is suitable for aquaculture development of Pacific salmon.

  13. Physiological mechanisms of imprinting and homing migration in Pacific salmon Oncorhynchus spp.

    Science.gov (United States)

    Ueda, H

    2012-07-01

    After several years of feeding at sea, salmonids have an amazing ability to migrate long distances from the open ocean to their natal stream to spawn. Three different research approaches from behavioural to molecular biological studies have been used to elucidate the physiological mechanisms underpinning salmonid imprinting and homing migration. The study was based on four anadromous Pacific salmon Oncorhynchus spp., pink salmon Oncorhynchus gorbuscha, chum salmon Oncorhynchus keta, sockeye salmon Oncorhynchus nerka and masu salmon Oncorhynchus masou, migrating from the North Pacific Ocean to the coast of Hokkaido, Japan, as well as lacustrine O. nerka and O. masou in Lake Toya, Hokkaido, where the lake serves as the model oceanic system. Behavioural studies using biotelemetry techniques showed swimming profiles from the Bering Sea to the coast of Hokkaido in O. keta as well as homing behaviours of lacustrine O. nerka and O. masou in Lake Toya. Endocrinological studies on hormone profiles in the brain-pituitary-gonad axis of O. keta, and lacustrine O. nerka identified the hormonal changes during homing migration. Neurophysiological studies revealed crucial roles of olfactory functions on imprinting and homing during downstream and upstream migration, respectively. These findings are discussed in relation to the physiological mechanisms of imprinting and homing migration in anadromous and lacustrine salmonids. © 2012 The Author. Journal of Fish Biology © 2012 The Fisheries Society of the British Isles.

  14. Immunoreactive trypsin and neonatalscreening for cystic fibrosis

    International Nuclear Information System (INIS)

    Travert, G.; Laroche, D.; Blandin, C.; Pasquet, C.

    1988-01-01

    Immunoreactive trypsin (IRT) was measured in dried blood spots from 160.822 five-day-old babies as a part of a regionwide neonatal screening program for cystic fibrosis. A second test was performed for 492 babies in whom blood IRT levels were found greater than 900 μg/l; retesting revealed persistent elevation in 55. Sweat testing confirmed cystic fibrosis in 43 babies, but results were normal in 12. During the course of this study, a total of 51 cystic fibrosis babies were identified: 43 by newborn screening, 6 because they had meconium ileus; so, early diagnosis was achieved in 49 cases out of 51. Two newborn babies did not have elevated IRT and they were missed by the screening test. Our results confirm that elevated blood IRT is characteristic of newborn babies with cystic fibrosis and show that this test has an excellent specificity (99.7%) and a good sensitivity (95%) when used as a neonatal screening test [fr

  15. Functional feeds reduce heart inflammation and pathology in Atlantic Salmon (Salmo salar L. following experimental challenge with Atlantic salmon reovirus (ASRV.

    Directory of Open Access Journals (Sweden)

    Laura Martinez-Rubio

    Full Text Available Heart and Skeletal Muscle Inflammation (HSMI, recently associated with a novel Atlantic salmon reovirus (ASRV, is currently one of the most prevalent inflammatory diseases in commercial Atlantic salmon farms in Norway. Mortality varies from low to 20%, but morbidity can be very high, reducing growth performance and causing considerable financial impact. Clinical symptoms, including myocarditis, myocardial and red skeletal muscle necrosis, correlate with the intensity of the inflammatory response. In the present study, the effects of two functional feeds (FF1 and FF2 were compared to a standard commercial reference feed (ST in Atlantic salmon subjected to an ASRV challenge. The functional feeds had reduced levels of total lipid and digestible energy, and different levels and proportions of long-chain polyunsaturated fatty acids (LC-PUFA. The objective was to determine whether these feeds could provide effective protection by decreasing the inflammatory response associated with HSMI. Histopathology, viral load, fatty acid composition and gene expression of heart tissue were assessed over a period of 16 weeks post-infection with ASRV. The viral load and histopathology scores in heart tissue in response to ASRV infection were reduced in fish fed both functional feeds, with FF1 showing the greatest effect. Microarray hierarchical cluster analysis showed that the functional feeds greatly affected expression of inflammation/immune related genes over the course of the ASRV infection. Viral load correlated with up-regulation of pro-inflammatory genes at the early-mid stages of infection in fish fed the ST diet. Expression of inflammatory genes 16-weeks after ASRV challenge reflected the difference in efficacy between the functional feeds, with fish fed FF1 showing lower expression. Thus, severity of the lesions in heart tissue correlated with the intensity of the innate immune response and was associated with tissue fatty acid compositions. The present

  16. ASSESSING THE IMPORTANCE OF THERMAL REFUGE USE TO MIGRATING ADULT SALMON AND STEELHEAD

    Science.gov (United States)

    Salmon populations require river networks that provide water temperature regimes sufficient to support a diversity of salmonid life histories across space and time. The importance of cold water refuges for migrating adult salmon and steelhead may seem intuitive, and refuges are c...

  17. CROOS - Collaborative Research on Oregon Ocean Salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Goal 1: Improve understanding of salmon ocean ecology by integrating stock-specific distribution patterns over space and time with biological and environmental data....

  18. Electronic structure of trypsin inhibitor from squash seeds in aqueous solution

    Science.gov (United States)

    Zheng, Haoping

    2000-10-01

    The electronic structure of the trypsin inhibitor from seeds of the squash Cucurbita maxima (CMTI-I) in aqueous solution is obtained by ab initio, all-electron, full-potential calculations using the self-consistent cluster-embedding (SCCE) method. The reactive site of the inhibitor is explained theoretically, which is in agreement with the experimental results. It is shown that the coordinates of oxygen atoms in the inhibitor, determined by nuclear magnetic resonance and combination of distance geometry and dynamical simulated annealing, are systematically less accurate than that of other kinds of heavy atoms.

  19. AFSC/ABL: Genetic Analysis of Immature Bering Sea Chum Salmon: Part I. Baseline Evaluation

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Chum salmon populations from across their geographic distribution have been analyzed with a set of SNP and microsatellite markers. As is typical for chum salmon...

  20. Validation of a freshwater Otolith microstructure pattern for Nisqually Chinook Salmon (Oncorhynchus tshawytscha)

    Science.gov (United States)

    Lind-Null, Angie; Larsen, Kim

    2011-01-01

    The Nisqually Fall Chinook salmon (Oncorhynchus tshawytscha) population is one of 27 stocks in the Puget Sound (Washington) evolutionarily significant unit listed as threatened under the federal Endangered Species Act (ESA). Extensive restoration of the Nisqually River delta ecosystem has taken place to assist in recovery of the stock since estuary habitat is a critical transition zone for juvenile fall Chinook salmon. A pre-restoration baseline that includes the characterization of life history strategies, estuary residence times, growth rates and habitat use is needed to evaluate the potential response of hatchery and natural origin Chinook salmon to restoration efforts and to determine restoration success. Otolith microstructure analysis was selected as a tool to examine Chinook salmon life history, growth and residence in the Nisqually River estuary. The purpose of the current study is to incorporate microstructural analysis from the otoliths of juvenile Nisqually Chinook salmon collected at the downstream migrant trap within true freshwater (FW) habitat of the Nisqually River. The results from this analysis confirmed the previously documented Nisqually-specific FW microstructure pattern and revealed a Nisqually-specific microstructure pattern early in development (“developmental pattern”). No inter-annual variation in the microstructure pattern was visually observed when compared to samples from previous years. Furthermore, the Nisqually-specific “developmental pattern” and the FW microstructure pattern used in combination during analysis will allow us to recognize and separate with further confidence future unmarked Chinook salmon otolith collections into Nisqually-origin (natural or unmarked hatchery) and non-Nisqually origin categories. Freshwater mean increment width, growth rate and residence time were also calculated.

  1. High-flow, low-head pumps provide safe passage for Pacific salmon

    International Nuclear Information System (INIS)

    Anon

    2004-01-01

    The installation of 29 ultra-low head, high capacity submersible pump and auxiliary equipment at the Rocky Reach Dam in Washington State to allow juvenile salmon safe passage on their journey down the Columbia River to the Pacific Ocean is described. The reputed cost of the project is US$160 million; its purpose is to get juvenile salmon safely around the Rocky Reach Dam without interfering with the dam's original mission of generating electric power. The project is the most expensive fish bypass on any Columbia River dam. Getting the salmon safely around the dam is intended to reduce the impact of hydroelectric power projects on the basin's salmon stocks which are now estimated at less than 10 per cent of their historic size, despite major hatchery programs. The Columbia River has the second largest volume flow of any river in the United States, and millions of people depend on it for employment in water-related industries, and for transportation. The new horizontally installed propeller pump was developed by ITT Flygt; it utilizes planetary gear reduced to match the motor speed with the propeller rpm. Each 90 kW propeller pump has a flow rate of seven cubic meters per second at a head of 0.55 metres. The auxiliary equipment includes 10 racks of flap gates to prevent reverse flow, electric controls, remote supervision, testing, installation and maintenance facilities. It is anticipated that the new bypass will allow the Chelan County Public Utility Department, owners of the facility, to phase out all current spills, except for a 16 per cent spill for 40 days each spring for Sockeye salmon which tend to travel too deep to use the bypass. Prior to installation of this new facility, 60 to 70 per cent of average daily flow in the spring and summer had to be sacrificed to accommodate all species of salmon and steelhead, with corresponding losses of power generating capacity

  2. Comparative Resilience in Five North Pacific Regional Salmon Fisheries

    Directory of Open Access Journals (Sweden)

    Xanthippe Augerot

    2010-06-01

    Full Text Available Over the past century, regional fisheries for Pacific salmon (Oncorhynchus spp. have been managed primarily for their provisioning function, not for ecological support and cultural significance. We examine the resilience of the regional salmon fisheries of Japan, the Russian Far East, Alaska, British Columbia, and Washington-Oregon-California (WOC in terms of their provisioning function. Using the three dimensions of the adaptive cycle - capital, connectedness, and resilience - we infer the resilience of the five fisheries based on a qualitative assessment of capital accumulation and connectedness at the regional scale. In our assessment, we evaluate natural capital and connectedness and constructed capital and connectedness. The Russian Far East fishery is the most resilient, followed by Alaska, British Columbia, Japan, and WOC. Adaptive capacity in the fisheries is contingent upon high levels of natural capital and connectedness and moderate levels of constructed capital and connectedness. Cross-scale interactions and global market demand are significant factors in reduced resilience. Greater attention to ecological functioning and cultural signification has the potential to increase resilience in Pacific salmon ecosystems.

  3. Freshwater ecosystems and resilience of Pacific salmon: Habitat Management based on natural variability

    Science.gov (United States)

    Bisson, P.A.; Dunham, J.B.; Reeves, G.H.

    2009-01-01

    In spite of numerous habitat restoration programs in fresh waters with an aggregate annual funding of millions of dollars, many populations of Pacific salmon remain significantly imperiled. Habitat restoration strategies that address limited environmental attributes and partial salmon life-history requirements or approaches that attempt to force aquatic habitat to conform to idealized but ecologically unsustainable conditions may partly explain this lack of response. Natural watershed processes generate highly variable environmental conditions and population responses, i.e., multiple life histories, that are often not considered in restoration. Examples from several locations underscore the importance of natural variability to the resilience of Pacific salmon. The implication is that habitat restoration efforts will be more likely to foster salmon resilience if they consider processes that generate and maintain natural variability in fresh water. We identify three specific criteria for management based on natural variability: the capacity of aquatic habitat to recover from disturbance, a range of habitats distributed across stream networks through time sufficient to fulfill the requirements of diverse salmon life histories, and ecological connectivity. In light of these considerations, we discuss current threats to habitat resilience and describe how regulatory and restoration approaches can be modified to better incorporate natural variability. ?? 2009 by the author(s).

  4. Freshwater Ecosystems and Resilience of Pacific Salmon: Habitat Management Based on Natural Variability

    Directory of Open Access Journals (Sweden)

    Peter A. Bisson

    2009-06-01

    Full Text Available In spite of numerous habitat restoration programs in fresh waters with an aggregate annual funding of millions of dollars, many populations of Pacific salmon remain significantly imperiled. Habitat restoration strategies that address limited environmental attributes and partial salmon life-history requirements or approaches that attempt to force aquatic habitat to conform to idealized but ecologically unsustainable conditions may partly explain this lack of response. Natural watershed processes generate highly variable environmental conditions and population responses, i.e., multiple life histories, that are often not considered in restoration. Examples from several locations underscore the importance of natural variability to the resilience of Pacific salmon. The implication is that habitat restoration efforts will be more likely to foster salmon resilience if they consider processes that generate and maintain natural variability in fresh water. We identify three specific criteria for management based on natural variability: the capacity of aquatic habitat to recover from disturbance, a range of habitats distributed across stream networks through time sufficient to fulfill the requirements of diverse salmon life histories, and ecological connectivity. In light of these considerations, we discuss current threats to habitat resilience and describe how regulatory and restoration approaches can be modified to better incorporate natural variability.

  5. Changes in habitat availability for outmigrating juvenile salmon (Oncorhychus spp.) following estuary restoration

    Science.gov (United States)

    Ellings, Christopher S.; Davis, Melanie; Grossman, Eric E.; Hodgson, Sayre; Turner, Kelley L.; Woo PR, Isa; Nakai, Glynnis; Takekawa, Jean E.; Takekawa, John Y.

    2016-01-01

    The restoration of the Nisqually River Delta (Washington, U.S.A.) represents one of the largest efforts toward reestablishing the ecosystem function and resilience of modified habitat in the Puget Sound, particularly for anadromous salmonid species. The opportunity for outmigrating salmon to access and benefit from the expansion of available tidal habitat can be quantified by several physical attributes, which are related to the ecological and physiological responses of juvenile salmon. We monitored a variety of physical parameters to measure changes in opportunity potential from historic, pre-restoration, and post-restoration habitat conditions at several sites across the delta. These parameters included channel morphology, water quality, tidal elevation, and landscape connectivity. We conducted fish catch surveys across the delta to determine if salmon was utilizing restored estuary habitat. Overall major channel area increased 42% and major channel length increased 131% from pre- to post-restoration conditions. Furthermore, the results of our tidal inundation model indicated that major channels were accessible up to 75% of the time, as opposed to 30% pre-restoration. Outmigrating salmon utilized this newly accessible habitat as quickly as 1 year post-restoration. The presence of salmon in restored tidal channels confirmed rapid post-restoration increases in opportunity potential on the delta despite habitat quality differences between restored and reference sites.

  6. Effects of black-eyed pea trypsin/chymotrypsin inhibitor on proteolytic activity and on development of Anthonomus grandis.

    Science.gov (United States)

    Franco, Octávio L; dos Santos, Roseane C; Batista, João A N; Mendes, Ana Cristina M; de Araújo, Marcus Aurélio M; Monnerat, Rose G; Grossi-de-Sá, Maria Fátima; de Freitas, Sonia M

    2003-06-01

    The cotton boll weevil Anthonomus grandis (Boheman) is one of the major pests of cotton (Gossypium hirsutum L.) in tropical and sub-tropical areas of the New World. This feeds on cotton floral fruits and buds causing severe crop losses. Digestion in the boll weevil is facilitated by high levels of serine proteinases, which are responsible for the almost all proteolytic activity. Aiming to reduce the proteolytic activity, the inhibitory effects of black-eyed pea trypsin/chymotrypsin inhibitor (BTCI), towards trypsin and chymotrypsin from bovine pancreas and from midguts of A. grandis larvae and adult insects were analyzed. BTCI, purified from Vigna unguiculata (L.) seeds, was highly active against different trypsin-like proteinases studied and moderately active against the digestive chymotrypsin of adult insects. Nevertheless, no inhibitory activity was observed against chymotrypsin from A. grandis larval guts. To test the BTCI efficiency in vivo, neonate larvae were reared on artificial diet containing BTCI at 10, 50 and 100 microM. A reduction of larval weight of up to approximately 54% at the highest BTCI concentration was observed. At this concentration, the insect mortality was 65%. This work constitutes the first observation of a Bowman-Birk type inhibitor active in vitro and in vivo toward the cotton boll weevil A. grandis. The results of bioassays strongly suggest that BTCI may have potential as a transgene protein for use in engineered crop plants modified for heightened resistance to the cotton boll weevil.

  7. Snake River Sockeye Salmon Captive Broodstock Program; Hatchery Element, 1999 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Dan J,; Heindel, Jeff A.; Kline, Paul A. (Idaho Department of Fish and Game, Boise, ID)

    2005-08-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and the National Marine Fisheries Service initiated efforts to conserve and rebuild populations in Idaho. Initial steps to recover sockeye salmon included the establishment of a captive broodstock program at the Idaho Department of Fish and Game Eagle Fish Hatchery. Sockeye salmon broodstock and culture responsibilities are shared with the National Marine Fisheries Service at two locations adjacent to Puget Sound in Washington State. Activities conducted by the Shoshone-Bannock Tribes and the National Marine Fisheries Service are reported under separate cover. Idaho Department of Fish and Game monitoring and evaluation activities of captive broodstock program fish releases are also reported under separate cover. Captive broodstock program activities conducted between January 1, 1999 and December 31, 1999 are presented in this report. In 1999, seven anadromous sockeye salmon returned to the Sawtooth Valley and were captured at the adult weir located on the upper Salmon River. Four anadromous adults were incorporated in the captive broodstock program spawning design for year 1999. The remaining three adults were released to Redfish Lake for natural spawning. All seven adults were adipose and left ventral fin-clipped, indicating hatchery origin. One sockeye salmon female from the anadromous group and 81 females from the captive broodstock group were spawned at the Eagle Fish Hatchery in 1999. Spawn pairings produced approximately 63,147 eyed-eggs with egg survival to eyed-stage of development averaging 38.97%. Eyed-eggs (20,311), presmolts (40,271), smolts (9,718), and adults (21) were planted or released into Sawtooth Valley waters in 1999. Supplementation strategies involved releases to Redfish Lake, Redfish Lake Creek

  8. Relationships between salmon abundance and tree-ring δ 15N: three objective tests

    Science.gov (United States)

    D.C. Drake; Paul J. Sheppard; Robert J. Naiman

    2011-01-01

    Quantification of a relationship between salmon escapement in rivers and riparian tree-ring δ 15N could allow reconstruction of prehistorical salmon abundance. Unfortunately, attempts to quantify this link have met with little success. We examined the feasibility of the approach using natural abundance of δ 15...

  9. A novel dianionic amino acid ionic liquid-coated PEG 4000 modified Fe3O4 nanocomposite for the magnetic solid-phase extraction of trypsin.

    Science.gov (United States)

    Yang, Qin; Wang, Yuzhi; Zhang, Hongmei; Xu, Kaijia; Wei, Xiaoxiao; Xu, Panli; Zhou, Yigang

    2017-11-01

    A novel magnetic extractant, PEG 4000 modified Fe 3 O 4 nanomaterial that coated with dianionic amino acid ionic liquid (Fe 3 O 4 @PEG@DAAAIL), was successfully synthesized and characterized. X-ray diffraction (XRD), transmission electron microscope (TEM), vibrating sample magnetometer (VSM), fourier transform infrared spectrometry (FT-IR), thermal gravimetric analysis (TGA) and zeta potentials were used to confirm that the novel nanocomposite was successfully synthesized. Subsequently, the prepared Fe 3 O 4 @PEG@DAAAIL nanocomposite was used as the extractant for trypsin coupled with magnetic solid-phase extraction (MSPE). The concentrations of trypsin in the supernatant were detected by UV-vis spectrophotometer at 278nm. The extraction ability turned out to be better than the other four kinds of extractants prepared in this work. Furthermore, the influence of a series of factors, such as extraction time and temperature, initial trypsin concentration, the value of pH and ionic strength, was systematically investigated. Under the optimal extraction condition, the extraction capacity for trypsin could reach up to 718.73mg/g, absolutely higher than that of other adsorbents reported. This satisfactory extraction capacity could be maintained unchangeable after at least eight days, and kept over 90% of initial extraction capacity after eight recycles. What's more, the activity of trypsin after extraction retained 92.29% of initial activity, verifying the biocompatibility of the prepared extractant. Finally, the developed Fe 3 O 4 @PEG@DAAAIL-MSPE method was successfully applied to the real sample analysis with satisfactory results. All of above proves the potential value of Fe 3 O 4 @PEG@DAAAIL-MSPE in the analysis of biomass. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Species and life-history affects the utility of otolith chemical composition to determine natal stream-of-origin in Pacific salmon

    Science.gov (United States)

    Zimmerman, Christian E.; Swanson, Heidi K.; Volk, Eric C.; Kent, Adam J.R.

    2013-01-01

    To test the utility of otolith chemical composition as a tool for determining the natal stream of origin for salmon, we examined water chemistry and otoliths of juvenile and adult Chum Salmon Oncorhynchus keta and Coho Salmon O. kisutch from three watersheds (five rivers) in the Norton Sound region of Alaska. The two species are characterized by different life histories: Coho Salmon rear in freshwater for up to 3 years, whereas Chum Salmon emigrate from freshwater shortly after emergence. We used laser ablation (LA) inductively coupled plasma (ICP) mass spectrometry (MS) to quantify element: Ca ratios for Mg, Mn, Zn, Sr, and Ba, and we used multicollector LA-ICP-MS to determine 87Sr:86Sr ratios in otolith regions corresponding to the period of freshwater residence. Significant differences existed in both water and otolith elemental composition, suggesting that otolith composition could be used to discriminate the natal origin of Coho Salmon and Chum Salmon but only when 87Sr:86Sr ratios were included in the discriminant function analyses. The best discriminant model included 87Sr:86Sr ratios, and without 87Sr:86Sr ratios it was difficult to discriminate among watersheds and rivers. Classification accuracy was 80% for Coho Salmon and 68% for Chum Salmon, indicating that this method does not provide sufficient sensitivity to estimate straying rates of Pacific salmon at the scale we studied.

  11. Molecular pathology of vertebral deformities in hyperthermic Atlantic salmon (Salmo salar)

    OpenAIRE

    Ytteborg, Elisabeth; Baeverfjord, Grete; Torgersen, Jacob; Hjelde, Kirsti; Takle, Harald

    2010-01-01

    Abstract Background Hyperthermia has been shown in a number of organisms to induce developmental defects as a result of changes in cell proliferation, differentiation and gene expression. In spite of this, salmon aquaculture commonly uses high water temperature to speed up developmental rate in intensive production systems, resulting in an increased frequency of skeletal deformities. In order to study the molecular pathology of vertebral deformities, Atlantic salmon was subjected to hyperther...

  12. AFSC/FMA/Salmon Genetics From Observer Speimens

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Genetic data of salmon bycatch samples collected by fisheries observers are used for mixed-stock analyses to determine geographic region of origin. This work is done...

  13. Emigration of Natural and Hatchery Chinook Salmon and Steelhead Smolts from the Imnaha River, Oregon, Progress Report 2000-2002.

    Energy Technology Data Exchange (ETDEWEB)

    Cleary, Peter; Kucera, Paul; Blenden, Michael

    2003-12-01

    This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303

  14. Seasonal variation exceeds effects of salmon carcass additions on benthic food webs in the Elwha River

    Science.gov (United States)

    Morley, S.A.; Coe, H.J.; Duda, J.J.; Dunphy, L.S.; McHenry, M.L.; Beckman, B.R.; Elofson, M.; Sampson, E. M.; Ward, L.

    2016-01-01

    Dam removal and other fish barrier removal projects in western North America are assumed to boost freshwater productivity via the transport of marine-derived nutrients from recolonizing Pacific salmon (Oncorhynchus spp.). In anticipation of the removal of two hydroelectric dams on the Elwha River in Washington State, we tested this hypothesis with a salmon carcass addition experiment. Our study was designed to examine how background nutrient dynamics and benthic food webs vary seasonally, and how these features respond to salmon subsidies. We conducted our experiment in six side channels of the Elwha River, each with a spatially paired reference and treatment reach. Each reach was sampled on multiple occasions from October 2007 to August 2008, before and after carcass placement. We evaluated nutrient limitation status; measured water chemistry, periphyton, benthic invertebrates, and juvenile rainbow trout (O. mykiss) response; and traced salmon-derived nutrient uptake using stable isotopes. Outside of winter, algal accrual was limited by both nitrogen and phosphorous and remained so even in the presence of salmon carcasses. One month after salmon addition, dissolved inorganic nitrogen levels doubled in treatment reaches. Two months after addition, benthic algal accrual was significantly elevated. We detected no changes in invertebrate or fish metrics, with the exception of 15N enrichment. Natural seasonal variability was greater than salmon effects for the majority of our response metrics. Yet seasonality and synchronicity of nutrient supply and demand are often overlooked in nutrient enhancement studies. Timing and magnitude of salmon-derived nitrogen utilization suggest that uptake of dissolved nutrients was favored over direct consumption of carcasses. The highest proportion of salmon-derived nitrogen was incorporated by herbivores (18–30%) and peaked 1–2 months after carcass addition. Peak nitrogen enrichment in predators (11–16%) occurred 2–3

  15. Associations between piscine reovirus infection and life history traits in wild-caught Atlantic salmon Salmo salar L. in Norway.

    Science.gov (United States)

    Garseth, Ase Helen; Biering, Eirik; Aunsmo, Arnfinn

    2013-10-01

    Piscine Reovirus (PRV), the putative causative agent of heart and skeletal muscle inflammation (HSMI), is widely distributed in both farmed and wild Atlantic salmon (Salmo salar L.) in Norway. While HSMI is a common and commercially important disease in farmed Atlantic salmon, the presence of PRV has so far not been associated with HSMI related lesions in wild salmon. Factors associated with PRV-infection were investigated in returning Atlantic salmon captured in Norwegian rivers. A multilevel mixed-effect logistic regression model confirmed clustering within rivers and demonstrated that PRV-infection is associated with life-history, sex, catch-year and body length as a proxy for sea-age. Escaped farmed salmon (odds ratio/OR: 7.32, p<0.001) and hatchery-reared salmon (OR: 1.69 p=0.073) have higher odds of being PRV-infected than wild Atlantic salmon. Male salmon have double odds of being PRV infected compared to female salmon (OR: 2.11, p<0.001). Odds of being PRV-infected increased with body-length measured as decimetres (OR: 1.20, p=0.004). Since body length and sea-age are correlated (r=0.85 p<0.001), body length serves as a proxy for sea-age, meaning that spending more years in sea increases the odds of being PRV-infected. Copyright © 2013 The Author. Published by Elsevier B.V. All rights reserved.

  16. Movements of adult Atlantic salmon in relation to a hydroelectric dam and fish ladder

    International Nuclear Information System (INIS)

    Gowans, A.R.D.; Priede, I.G.

    1999-01-01

    The movements of adult Atlantic salmon were recorded as they approached, entered and ascended the pool-and-orifice fish ladder at Pitlochry Dam, Scotland. Thirty-nine returning salmon were captured in the River Tummel by rod-and-line angling, radio-tagged and released near where they were caught. The subsequent movements of each fish were then monitored. An electronic fish counter collected additional data on movements of untagged fish past a fixed point in the ladder. Of the 39 fish that were radio-tagged, 29 individuals were recorded approaching and ascending the ladder. The remaining fish either did not approach the dam (three fish), approached the dam after detailed tracking had ended (two fish), were recaptured by anglers (three fish), or the radio tags failed (two fish). Salmon released earlier in the year delayed longer before first approaching the dam. Delays between first approaching the dam and ascent of the ladder were greater for fish that approached the dam earlier. The majority of salmon visited the ladder entrance more than once (maximum 10 visits) before ascending. Having entered, all but four salmon ascended the fish ladder successfully on their first attempt. The four individuals that failed to do so succeeded on their second attempt. The rate at which salmon ascended the ladder was related directly to temperature. The shortest ascent time of a radio-tagged salmon was 5.25 h. Movements of eight of 11 tagged fish through the ladder ceased with the onset of darkness but continued on the following morning. No radio-tagged fish entered the ladder at temperatures below 9 o C. Similarly, few untagged fish were recorded ascending the ladder by the electronic fish counter at water temperatures below 8.5 o C. Records from the fish counter indicated that 92% of upstream movements were made during daylight. (author)

  17. Habitat selection and overlap of Atlantic salmon and smallmouth bass juveniles in nursery streams

    Science.gov (United States)

    Wathen, G.; Coghlan, S.M.; Zydlewski, Joseph D.; Trial, J.G.

    2011-01-01

    Introduced smallmouth bass Micropterus dolomieu have invaded much of the historic freshwater habitat of Atlantic salmon Salmo salar in North America, yet little is known about the ecological interactions between the two species. We investigated the possibility of competition for habitat between age-0 Atlantic salmon and age-0 and age-1 smallmouth bass by means of in situ observations and a mesocosm experiment. We used snorkel observation to identify the degree and timing of overlap in habitat use in our in situ observations and to describe habitat shifts by Atlantic salmon in the presence of smallmouth bass in our mesocosm experiments. In late July 2008, we observed substantial overlap in the depths and mean water column velocities used by both species in sympatric in situ conditions and an apparent shift by age-0 Atlantic salmon to shallower water that coincided with the period of high overlap. In the mesocosm experiments, we detected no overlap or habitat shifts by age-0 Atlantic salmon in the presence age-1 smallmouth bass and low overlap and no habitat shifts of Atlantic salmon and age-0 smallmouth bass in fall 2009. In 2009, summer floods with sustained high flows and low temperatures resulted in the nearly complete reproductive failure of the smallmouth bass in our study streams, and we did not observe a midsummer habitat shift by Atlantic salmon similar to that seen in 2008. Although this prevented us from replicating our 2008 experiments under similar conditions, the virtual year-class failure of smallmouth bass itself is enlightening. We suggest that future studies incorporate the effects of varying temperature and discharge to determine how abiotic factors affect the interactions between these species and thus mediate the outcomes of potential competition.

  18. Trypsin- and low pH-mediated fusogenicity of avian metapneumovirus fusion proteins is determined by residues at positions 100, 101 and 294.

    Science.gov (United States)

    Yun, Bingling; Guan, Xiaolu; Liu, Yongzhen; Gao, Yanni; Wang, Yongqiang; Qi, Xiaole; Cui, Hongyu; Liu, Changjun; Zhang, Yanping; Gao, Li; Li, Kai; Gao, Honglei; Gao, Yulong; Wang, Xiaomei

    2015-10-26

    Avian metapneumovirus (aMPV) and human metapneumovirus (hMPV) are members of the genus Metapneumovirus in the subfamily Pneumovirinae. Metapneumovirus fusion (F) protein mediates the fusion of host cells with the virus membrane for infection. Trypsin- and/or low pH-induced membrane fusion is a strain-dependent phenomenon for hMPV. Here, we demonstrated that three subtypes of aMPV (aMPV/A, aMPV/B, and aMPV/C) F proteins promoted cell-cell fusion in the absence of trypsin. Indeed, in the presence of trypsin, only aMPV/C F protein fusogenicity was enhanced. Mutagenesis of the amino acids at position 100 and/or 101, located at a putative cleavage region in aMPV F proteins, revealed that the trypsin-mediated fusogenicity of aMPV F proteins is regulated by the residues at positions 100 and 101. Moreover, we demonstrated that aMPV/A and aMPV/B F proteins mediated cell-cell fusion independent of low pH, whereas the aMPV/C F protein did not. Mutagenesis of the residue at position 294 in the aMPV/A, aMPV/B, and aMPV/C F proteins showed that 294G played a critical role in F protein-mediated fusion under low pH conditions. These findings on aMPV F protein-induced cell-cell fusion provide new insights into the molecular mechanisms underlying membrane fusion and pathogenesis of aMPV.

  19. Responses of pink salmon to CO2-induced aquatic acidification

    Science.gov (United States)

    Ou, Michelle; Hamilton, Trevor J.; Eom, Junho; Lyall, Emily M.; Gallup, Joshua; Jiang, Amy; Lee, Jason; Close, David A.; Yun, Sang-Seon; Brauner, Colin J.

    2015-10-01

    Ocean acidification negatively affects many marine species and is predicted to cause widespread changes to marine ecosystems. Similarly, freshwater ecosystems may potentially be affected by climate-change-related acidification; however, this has received far less attention. Freshwater fish represent 40% of all fishes, and salmon, which rear and spawn in freshwater, are of immense ecosystem, economical and cultural importance. In this study, we investigate the impacts of CO2-induced acidification during the development of pink salmon, in freshwater and following early seawater entry. At this critical and sensitive life stage, we show dose-dependent reductions in growth, yolk-to-tissue conversion and maximal O2 uptake capacity; as well as significant alterations in olfactory responses, anti-predator behaviour and anxiety under projected future increases in CO2 levels. These data indicate that future populations of pink salmon may be at risk without mitigation and highlight the need for further studies on the impact of CO2-induced acidification on freshwater systems.

  20. Historical occurrence and extinction of Atlantic salmon in the River Elbe from the fourteenth to the twentieth centuries

    Directory of Open Access Journals (Sweden)

    Andreska J.

    2015-03-01

    Full Text Available Data on the occurrence, biology, and historical background of the Atlantic salmon, Salmo salar L., (Pisces, Salmoniformes in the Elbe river basin (Europe, North Sea drainage area with a focus on Bohemian territory (Central Europe from the fourteenth to twentieth centuries are summarized in this paper. Historical methods of salmon fishing in Central Europe and historical legal protection of salmon in Bohemia are presented. The salmon is a model example of species which was extirpated as a result of anthropogenic changes in the landscape and rivers in some water systems. The human activities, such as stream bed regulation, dam system construction, other migration barriers, water pollution, fisheries exploitation, that led to the extirpation of Atlantic salmon in the Elbe river basin (are discussed. The last sporadic migrating native salmon were registered in the Bohemian section of the Elbe river basin in the mid twentieth century.