RIKEN radioactive isotope beam factory project – Present status and ...
Indian Academy of Sciences (India)
Programs for studying nuclear reactions and structure of exotic nuclei available at the RIKEN radioactive isotope beam factory project are introduced and discussed by demonstrating recent highlights. Special emphasis ... RIKEN Nishina Center for Accelerator-Based Science, 2-1 Hirosawa, Wako, Saitama 351-0198, Japan ...
1992-11-01
7075 Dr. Samuel K.M.HO Dept. of Engineering Warwick University Coventry CV 47 AL UK 15 Tel.(44)203 524173 Fax.(44)203 524307 Mr. Mikio Inagaki...Nishi-8, Kita-ku Sapporo 060, JAPAN Tel. +81-11-716-211 ex.6447 Fax. +81-11-758-1619 Mr. Mikio Kitano 16 Motomachi Plant Toyota Moter Corporation 1...Hirosawa 2-1, Wako, Saitama 351-01 JAPAN Tel 81-484-65-6641 Fax 81-484-67-5942 Professor Hisayoshi Sato Director, Mechanical Engineering Laboratory
Exon: CBRC-DRER-26-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-26-0198 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGGCCGCTGCGACCTGCTCAAGTAAacacacacaca...cacacacacacacatactctatacacattcacacacatgcataaacacacacatactgtacacaaagacatactatatacagtacacacaaacacacacttacacaatatacctgtacacacacacacatactctacatacacacagactgtatAA ...
Exon: CBRC-RNOR-05-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0198 TTCAAAAATTTAACTTGGAagaagaaggaggaagaggaagaggagaagatgaggaggaagaggaagagaaggaggaagaagaggaggaag...aagaggaagaggaggagggggaagaagaggaggaagaggcagaggaggaggaggaagaggaggaggaggaagaggaggaggaggaagaggaggaggaggaag...aggaggaagatgaggaggaggaggaggaggaagaggaagcagatgaggaggaagaggaggaggaagaggaggaggaggaagaggaggaggaggaggaagaagaggaag...aggagaaggaggaagaggaaaagaaggaggaggaagaggaggaggatgaggaggaagaggaggaggatgaggaggaagaggaggaagaggaggaggaggacgaaaaagaggaggaggaggaggaggGATGA ...
Directory of Open Access Journals (Sweden)
Yu Omori
2015-03-01
Full Text Available This study was conducted to identify the characteristic pharmacological features of GT-0198 that is phenoxymethylbenzamide derivatives. GT-0198 inhibited the function of glycine transporter 2 (GlyT2 in human GlyT2-expressing HEK293 cells and did not bind various major transporters or receptors of neurotransmitters in a competitive manner. Thus, GT-0198 is considered to be a comparatively selective GlyT2 inhibitor. Intravenous, oral, and intrathecal injections of GT-0198 decreased the pain-related response in a model of neuropathic pain with partial sciatic nerve ligation. This result suggests that GT-0198 has an analgesic effect. The analgesic effect of GT-0198 was abolished by the intrathecal injection of strychnine, a glycine receptor antagonist. Therefore, GT-0198 is considered to exhibit its analgesic effect via the activation of a glycine receptor by glycine following presynaptic GlyT2 inhibition in the spinal cord. In summary, GT-0198 is a structurally novel GlyT2 inhibitor bearing a phenoxymethylbenzamide moiety with in vivo efficacy in behavioral models of neuropathic pain.
A survey of radioactive levels of agricultural products in Saitama prefecture
Energy Technology Data Exchange (ETDEWEB)
Motegi, Misako; Miyake, Sadaaki; Oosawa, Takashi; Nakazawa, Kiyoaki [Saitama Inst. of Public health, Saitama (Japan)
1997-09-01
Past atmospheric nuclear testing which have been conducted frequently, have caused environmental pollution due to the diffusion of radioactive substances into the atmosphere and from the radioactive fallout. The environmental pollution from nuclear testing into the atmosphere has resulted in the radioactive contamination in agricultural products and has continued for a long time. The radioactive contamination of agricultural products occurs through air, water and soil which were contaminated by radioactive fallout. In this paper, for the purpose of analyzing the extent of the radioactive contamination levels in the agricultural products of Saitama Prefecture, spinach, green soybeans, dried shiitake and welsh onion, were selected among products, as the amount of the harvest is abundant in all of Japan. Radioactivity concentration was investigated by gamma-ray spectrometry and radiochemical analysis. The radioactivity concentrations of artificial radioactive nuclides, cesium-137 ({sup 137}Cs) and strontium-90 ({sup 90}Sr), were detected in the range which is considered to be the result of radioactive fallout. Moreover, in order to examine the effect on radioactivity concentrations in agricultural products by culinary processing, the raw agricultural products were boiled, and their radioactivity concentrations were compared with the raw produce. The radioactivity concentrations in the boiled were lower than those in the raw produce. (author)
A survey of radioactive levels of agricultural products in Saitama prefecture
International Nuclear Information System (INIS)
Motegi, Misako; Miyake, Sadaaki; Oosawa, Takashi; Nakazawa, Kiyoaki
1997-01-01
Past atmospheric nuclear testing which have been conducted frequently, have caused environmental pollution due to the diffusion of radioactive substances into the atmosphere and from the radioactive fallout. The environmental pollution from nuclear testing into the atmosphere has resulted in the radioactive contamination in agricultural products and has continued for a long time. The radioactive contamination of agricultural products occurs through air, water and soil which were contaminated by radioactive fallout. In this paper, for the purpose of analyzing the extent of the radioactive contamination levels in the agricultural products of Saitama Prefecture, spinach, green soybeans, dried shiitake and welsh onion, were selected among products, as the amount of the harvest is abundant in all of Japan. Radioactivity concentration was investigated by gamma-ray spectrometry and radiochemical analysis. The radioactivity concentrations of artificial radioactive nuclides, cesium-137 ( 137 Cs) and strontium-90 ( 90 Sr), were detected in the range which is considered to be the result of radioactive fallout. Moreover, in order to examine the effect on radioactivity concentrations in agricultural products by culinary processing, the raw agricultural products were boiled, and their radioactivity concentrations were compared with the raw produce. The radioactivity concentrations in the boiled were lower than those in the raw produce. (author)
NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0198 ref|XP_596853.2| PREDICTED: similar to T-cell acute lymphocytic leukemia...-1 protein (TAL-1 protein) (Stem cell protein) (T-cell leukemia/lymphoma-5 protein) [Bos taurus] XP_596853.2 1e-168 89% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0198 ref|ZP_00370456.1| competence locus E (comE3) [Campylobacter upsaliens...is RM3195] gb|EAL53586.1| competence locus E (comE3) [Campylobacter upsaliensis RM3195] ZP_00370456.1 0.21 23% ...
NCBI nr-aa BLAST: CBRC-RNOR-05-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0198 ref|XP_001163354.1| PREDICTED: T-cell acute lymphocytic leukemia ...1 isoform 1 [Pan troglodytes] ref|XP_001163426.1| PREDICTED: T-cell acute lymphocytic leukemia 1 isoform 2 [...Pan troglodytes] ref|XP_513389.2| PREDICTED: T-cell acute lymphocytic leukemia 1 isoform 3 [Pan troglodytes] XP_001163354.1 1e-174 91% ...
Alzheimer?s disease and immunotherapy: what is wrong with clinical trials?
Kohyama, Kuniko; Matsumoto, Yoh
2015-01-01
Kuniko Kohyama,1 Yoh Matsumoto2–4 1Department of Brain Development and Neural Regeneration, Tokyo Metropolitan Institute of Medical Science, Tokyo, Japan; 2Department of Sensory and Motor Systems, Tokyo Metropolitan Institute of Medical Science, Tokyo, Japan; 3Immunotherapy Development Inc., Saitama, Japan; 4Geriatric Health Services Facility “Asahigaoka”, Saitama, Japan Abstract: Alzheimer’s disease (AD) is characterized by progressive neurodegenerati...
NCBI nr-aa BLAST: CBRC-PTRO-12-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-12-0198 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 98% ...
Multilayered elastic analysis formulation for surface moment loading
CSIR Research Space (South Africa)
Maina, JW
2006-01-01
Full Text Available Denki University Hatoyama-Cho, Hiki-Gun, Saitama 350-0394, JAPAN Tel.: +81-492-96-2911 Fax: +81-492-96-6501 fkiyo@g.dendai.ac.jp Kunihito Matsui Professor Dept. of Civil and Environmental Engineering, Tokyo Denki University Hatoyama-Cho, Hiki...-Gun, Saitama 350-0394, JAPAN Tel.: +81-492-96-2911 Fax: +81-492-96-6501 matsui@g.dendai.ac.jp Takemi Inoue Executive Managing Director NIPPO Corporation 19-11 Kyobashi 1-Chome. Chuo-Ku, Tokyo 104-8380, JAPAN Tel.: +81-3-3563-6760 Fax: +81...
International Nuclear Information System (INIS)
Miyake, Sadaaki; Motegi, Misako; Oosawa, Takashi; Nakazawa, Kiyoaki; Izumo, Yoshiro
1998-01-01
The concentrations of 137 Cs in water, sediment and fishes at the pond in Saitama prefecture were determined in order to elucidate the radioecology of 137 Cs in limnological ecosystems. 137 Cs concentration in water was 0.31±0.002 mBq/l (mean±standard error), and so indicated about 3 times higher than that (0.10 mBq/l) for the river in our previous report. 137 Cs concentrations in sediment, carp, Cyprinus carpio, crucian carp, Carassius auratus cuvieri, and Hakuren, Hypophthalmichthys molitrix, were about 20000, 1200, 2400 and 3100 times higher than that of the water, respectively. These concentrations were higher than those of each sample for the river in our previous report. It was so suggested that 137 Cs tended to be accumulated in these samples at the pond more than the nuclide in the river. Moreover, concentration ratios, concentration of 137 Cs in sediment, crucian carp and Hakuren to that of the water, were about 30, 2 and 3 times higher than these of 40 K, respectively, except for carp of which 137 Cs and 40 K concentration ratios were almost same. These results showed difference in accumulation mechanism between 137 Cs and 40 K in these samples, as well as 137 Cs transfer mechanism in the limnological ecosystems in part. (author)
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Benefit. 351.503 Section 351.503 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.503 Benefit. (a) Specific rules. In the case of a...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Facilities. 351.10 Section 351.10... CERTIFICATION CERTIFICATION OF TECHNICAL ANIMAL FATS FOR EXPORT Facilities and Operations § 351.10 Facilities. (a) Facilities for the preparation, identification, and storage of the technical animal fat to be...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.351 Section 120.351 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans Qualified Employee Trusts (esop) § 120.351 Definitions. All terms specific to ESOPs have the same definition...
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Act. 35.1 Section 35.1 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices... Definitions § 35.1 Act. Act or Export Grape and Plum Act means “An Act to promote the foreign trade of the...
Sample (S): SE22_S07 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S05 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S08 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S03 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S02 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S06 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S01 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
Sample (S): SE22_S04 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available Ind., Tokyo, Japan, and Kanto Hiryou Ind., Saitama, Japan) and kept in the contro...awn in the pot (500 ml) filled with mixture of vermiculite and Powersoil (mix ratio 1 to 1, Kureha Chemical
7 CFR 3565.351 - Project management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Project management. 3565.351 Section 3565.351... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Project Management § 3565.351 Project management. As a... Agency and complies with an approved management plan for the project. (b) Management plan. The lender...
14 CFR 135.351 - Recurrent training.
2010-01-01
... appropriate, including low-altitude windshear training and training on operating during ground icing... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Recurrent training. 135.351 Section 135.351... AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Training § 135.351...
5 CFR 351.403 - Competitive level.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Competitive level. 351.403 Section 351... FORCE Scope of Competition § 351.403 Competitive level. (a)(1) Each agency shall establish competitive levels consisting of all positions in a competitive area which are in the same grade (or occupational...
5 CFR 351.402 - Competitive area.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Competitive area. 351.402 Section 351.402... Competition § 351.402 Competitive area. (a) Each agency shall establish competitive areas in which employees compete for retention under this part. (b) A competitive area must be defined solely in terms of the...
Classification of posterior vitreous detachment
Kakehashi, Akihiro; Takezawa, Mikiko; Akiba, Jun
2013-01-01
Akihiro Kakehashi,1 Mikiko Takezawa,1 Jun Akiba21Department of Ophthalmology, Jichi Medical University, Saitama Medical Center, Saitama, 2Kanjodori Eye Clinic, Asahikawa, JapanAbstract: Diagnosing a posterior vitreous detachment (PVD) is important for predicting the prognosis and determining the indication for vitreoretinal surgery in many vitreoretinal diseases. This article presents both classifications of a PVD by slit-lamp biomicroscopy and of a shallow PVD by optical coherence tomography...
7 CFR 1210.351 - Books and records.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1210.351 Section 1210.351... PROMOTION PLAN Watermelon Research and Promotion Plan Reports, Books, and Records § 1210.351 Books and... make available for inspection by employees of the Board or Secretary, such books and records as are...
9 CFR 351.1 - Meaning of words.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Meaning of words. 351.1 Section 351.1 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY... CERTIFICATION CERTIFICATION OF TECHNICAL ANIMAL FATS FOR EXPORT Definitions § 351.1 Meaning of words. Words used...
7 CFR 1207.351 - Books and records.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1207.351 Section 1207.351... PLAN Potato Research and Promotion Plan Reports, Books, and Records § 1207.351 Books and records. Each... employees of the Board and the Secretary such books and records as are appropriate and necessary to carry...
Cecal perforation with an ascending colon cancer caused by upper gastrointestinal endoscopy
Directory of Open Access Journals (Sweden)
Hiroyuki Miyatani
2009-04-01
Full Text Available Hiroyuki Miyatani1, Yukio Yoshida1, Hirokazu Kiyozaki21Department of Gastroenterology, Jichi Medical University, Saitama Medical Center, Saitama, Japan; 2Department of Surgery, Jichi Medical University, Saitama Medical Center, Saitama, JapanAbstract: Colonic perforation caused by upper gastrointestinal (GI endoscopy is extremely rare. A 69-year-old woman was referred to our hospital because of abdominal fullness. Colonoscopy could be performed only up to the hepatic flexure due to an elongated colon and residual stools. Because her symptoms improved, upper GI endoscopy was performed 11 days later. The patient developed severe abdominal pain two hours after the examination. Abdominal X-ray and computed tomography showed massive free air. Immediate laparotomy was performed for the intestinal perforation. After removal of stool, a perforation site was detected in the cecum with an invasive ascending colon cancer. Therefore, a right hemicolectomy, ileostomy, and transverse colostomy were performed. Although she developed postoperative septicemia, the patient was discharged 38 days after admission. Seven months postoperatively, the patient died of lung, liver, and brain metastases. Even in cases with a lesion that is not completely obstructed, it is important to note that air insufflations during upper GI endoscopy can perforate the intestinal wall in patients with advanced colon cancer.Keywords: colonic perforation, colon cancer, upper gastrointestinal endoscopy, fecal peritonitis
44 CFR 351.28 - The Department of Commerce.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false The Department of Commerce. 351.28 Section 351.28 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... Assignments § 351.28 The Department of Commerce. (a) Assist State and local governments in determining their...
44 CFR 351.25 - The Department of Transportation.
2010-10-01
... Transportation. 351.25 Section 351.25 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... Assignments § 351.25 The Department of Transportation. (a) Assist FEMA, along with NRC, in the preparation and promulgation of guidance to State and local governments for their use in developing the transportation portions...
29 CFR 1926.351 - Arc welding and cutting.
2010-07-01
... 29 Labor 8 2010-07-01 2010-07-01 false Arc welding and cutting. 1926.351 Section 1926.351 Labor... (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Welding and Cutting § 1926.351 Arc welding and cutting. (a) Manual electrode holders. (1) Only manual electrode holders which are specifically designed...
27 CFR 40.351 - Cigarette papers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Cigarette papers. 40.351... OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND PROCESSED TOBACCO Manufacture of Cigarette Papers and Tubes Taxes § 40.351 Cigarette papers. Cigarette...
19 CFR 351.514 - Export subsidies.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Export subsidies. 351.514 Section 351.514 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES... government, a benefit does not exist if the Secretary determines that the activities consist of general...
42 CFR 35.1 - Hospital and station rules.
2010-10-01
... EXAMINATIONS HOSPITAL AND STATION MANAGEMENT General § 35.1 Hospital and station rules. The officer in charge of a station or hospital of the Service is authorized to adopt such rules and issue such instructions... 42 Public Health 1 2010-10-01 2010-10-01 false Hospital and station rules. 35.1 Section 35.1...
19 CFR 351.415 - Conversion of currency.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Conversion of currency. 351.415 Section 351.415... Conversion of currency. (a) In general. In an antidumping proceeding, the Secretary will convert foreign currencies into United States dollars using the rate of exchange on the date of sale of the subject...
Eating Behavior and Childhood Overweight Among Population-Based Elementary Schoolchildren in Japan
Directory of Open Access Journals (Sweden)
Akatsuki Kokaze
2012-04-01
Full Text Available This study investigated the relationship between eating behavior and childhood overweight among population-based elementary schoolchildren in Japan. Data was collected from fourth graders (9 or 10 years of age from Ina Town, Saitama Prefecture, Japan from 1999 to 2009. Information about subjects’ sex, age, and lifestyle, including eating behaviors (eating until full and chewing thoroughly, was obtained using a self-administered questionnaire, and height and weight were measured directly. Overweight was determined according to the definition established by the International Obesity Task Force. Data from 4027 subjects (2079 boys and 1948 girls were analyzed. Chewing thoroughly was associated with a significantly decreased odds ratio (OR for being overweight, whereas eating until full significantly increased the OR for being overweight (OR: 1.50, 95% confidence interval: 1.16–1.94 among boys. However, eating until full was not associated with a significantly increased OR for being overweight among the group that reported chewing thoroughly, whereas it was associated with a significantly increased OR for being overweight (2.02, 1.38–2.94 among boys who did not chew thoroughly. In conclusion, eating until full or not chewing thoroughly was associated with being overweight among elementary schoolchildren. Results of this study suggest that chewing thoroughly may be an avenue to explore childhood overweight prevention efforts.
44 CFR 351.26 - The United States Department of Agriculture.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false The United States Department of Agriculture. 351.26 Section 351.26 Emergency Management and Assistance FEDERAL EMERGENCY... PREPAREDNESS Interagency Assignments § 351.26 The United States Department of Agriculture. (a) Assist FEMA in...
37 CFR 1.351 - Amendments to rules will be published.
2010-07-01
... published. 1.351 Section 1.351 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE... Rules § 1.351 Amendments to rules will be published. All amendments to the regulations in this part will be published in the Official Gazette and in the Federal Register. ...
19 CFR 351.524 - Allocation of benefit to a particular time period.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Allocation of benefit to a particular time period. 351.524 Section 351.524 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE... Allocation of benefit to a particular time period. Unless otherwise specified in §§ 351.504-351.523, the...
Granslo, B. H.; Nakano, S.
2013-12-01
16.88 16 11 31.6 +19 45 05 0.07+ 0.14+ 15.5 Unsuccessful visual searches for the comet, with estimated limiting magnitudes: Dec. 4.26 UT, [8.0 (B. H. Granslo, Roverkollen, Oslo, Norway, 0.08-m refractor; altitude 5 degrees in twilight); Dec. 8.8, [10.6 (Akie Hashimoto, Chichibu, Saitama-ken, Japan, 25x150 binoculars; communicated by S. Nakano, Sumoto, Japan).
19 CFR Annex V to Part 351 - Comparison of Prior and New Regulations
2010-04-01
... weighted-average dumping margin Subpart B—Antidumping Duty Procedures 353.11 351.201 Self-initiation 353.12... Verification 353.37 351.308 Determination on the basis of the facts available 353.38 (a)-(e) 351.309 Written... 355.35 Removed Ex parte meeting 355.36 351.307 Verification 355.37 351.308 Determinations on the basis...
Directory of Open Access Journals (Sweden)
Nishihara K
2014-09-01
Full Text Available Ken Nishihara,1 Hisashi Kawai,2 Hiroyuki Hayashi,3 Hideo Naruse,4 Akihito Kimura,4 Toshiaki Gomi,5 Fumihiko Hoshi1 1Department of Physical Therapy, Saitama Prefectural University, Saitama, Japan; 2Health Promotion Management Office, Tokyo Metropolitan Geriatric Hospital and Institute of Gerontology, Tokyo, Japan; 3Center for University-wide Education, Saitama Prefectural University, Saitama, Japan; 4Faculty of Health Sciences, Tokyo Ariake University of Medical and Health Sciences, Tokyo, Japan, 5Faculty of Nursing, Tokyo Ariake University of Medical and Health Sciences, Tokyo, Japan Background: The skeletal muscle echo intensity (EI during ultrasound imaging has been investigated to evaluate the muscle quality. However, EI fluctuates according to the scanning conditions.Methods: The motor functions and ultrasound images of 19 elderly (73±3.2 years and 19 young (22±1.5 years individuals were investigated and an EI frequency component was assessed for more reliable evaluations. Healthy elderly and young subjects participated in this study. The motor functions were assessed during walking and according to the knee extension muscle strength. The muscle thicknesses of rectus femoris (RF, vastus intermedius (VI, and quadriceps femoris (QF were investigated. EIs were calculated and the mean frequencies of the regions of interest (MFROIs for RF and VI were analyzed. Results: EIs and MFROIs were greater in elderly subjects than in young subjects (P<0.01 for RF, and P<0.001 for VI, in EIs; and P<0.01 for RF, and P<0.05 for VI, in MFROIs. In young subjects, EI of RF was greater than that of VI; however, there was no difference between the RF and VI MFROIs in both elderly and young subjects. EIs of VI exhibited a significantly negative correlation with the QF thickness in both elderly and young subjects. RF MFROIs negatively correlated with the QF thickness and positively correlated with EI of VI in elderly subjects alone. Conclusion: These findings
Contamination of meat with Campylobacter jejuni in Saitama, Japan.
Ono, K; Yamamoto, K
1999-03-15
To determine the source of food contamination with Campylobacter jejuni, we investigated retail meat, a chicken processing plant and a broiler farm. C. jejuni was found in domestic retailed poultry (45.8%) and imported poultry (3.7%), but not in beef or pork. In the poultry processing plant, there is significant contamination with C. jejuni in chicken carcasses, equipment and workers' hands. This contamination increases during the defeathering and evisceration processes. RAPD analysis shows that contamination with C. jejuni is of intestinal origin. In a broiler farm, C. jejuni was first isolated from a faecal sample of broiler chicken after the 20th day of age. Two weeks later, all birds in this farm became C. jejuni positive. RAPD analysis indicated that C. jejuni spread rapidly from one broiler flock to the other flocks on the farm.
ONR Far East Scientific Information Bulletin. Volume 14, Number 1. HEISEI, Achieving Universal Peace
1989-03-01
shapes with the concomitant formation of an amorphous phase. Kobayashi et al. The poster papers covered a range (P3-12) studied the etching... Nobuaki Shohata and Kazutaka Fujii Fundamental Research Laboratories Shigeki Hoshino Resource and Environment Research Laboratories Hirotaka Yamaguchi, Yuji...University 255 Ookubo, Urawa-shi, Saitama 336, Japan A. Kobayashi Ibaraki Polytechnic College 864-4 Suifu-cho, Mito-shi, Ibaraki 310, Japan P3-05 AN
49 CFR 214.351 - Training and qualification of flagmen.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of flagmen. 214.351... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.351 Training and qualification of flagmen. (a) The training and qualification for roadway workers assigned the...
Steps of radioisotope separation in Japan
International Nuclear Information System (INIS)
Nakane, Ryohei; Kitamoto, Asashi; Shimizu, Masami
1998-03-01
The Extraordinary Specialist Committee on Radioisotope Separation of the Atomic Energy Society of Japan has supported various actions on foundation, application and industrialization of the radioisotope separation over past 30 years to continue wide range of actions at a standpoint of specialist, since established in Showa 44 (1969). On June 1993 (Heisei 5), a memorial lecture meeting, as the 100th committee was held at the Institute of Physical and Chemical Research (RIKEN) of Wako-city in Saitama prefecture. At that time, a planning to publish an impressive memorial issue, to prepare orbits and episodes of actions, painful stories and fault examples of developments, and so forth like novels and to use for a future foundation, was determined. For its writing principle, it was settled to the base not to use mathematical equation as possible, to collect the essence like a tale, to collect actual and historical reports, and so on. And, for its writing content, it was determined to report on actual, painful and fault experiences in research and development, on data, topics and human relation, and on what to be remained for references. This book can be used not only for data collected on traces from fundamental to applied studies, technical development for industrialization, and so forth on radioisotope concentration, but also for a knowledge bag to give some hints to a man aiming to overcome a new problem. (G.K.)
Energy Technology Data Exchange (ETDEWEB)
Matsuoka, T; Umezawa, N; Shiraishi, H [Saitama Institute of Environmental Pollution, Saitama (Japan)
1997-05-27
The Saitama prefectural government has been conducting basement structure exploration using the spatial autocorrelation method by dividing the entire plain area into meshes, for the purpose of improving the accuracy of estimating large-scale seismic damages. This paper reports the result of explorations on meshes in the east-west direction in the central part of Saitama Prefecture. The present exploration was intended on ten meshes in the east-west direction along the north latitude 36-degree line. The number of exploration points is 13 comprising three points on the hilly area bordering on the eastern edge of the Kanto mountainous area and ten points on the plain area. The arrangement constitutes a traverse line with a total distance of about 33 km from the west edge (Hatoyama-machi in Saitama Prefecture) to the east edge (Noda City in Chiba Prefecture). The phase velocities were estimated from the result of the array microtremor observations using the spatial autocorrelation method applied with the FET. The phase velocities were used to estimate underground structures by using an inverse analysis. As a result, detailed two-dimensional S-wave velocity structures were revealed on the traverse line. The velocity cross section expresses change in the basement structures with sufficient resolution, and at the same time the information is judged highly harmonious with existing deep boring data and the result of artificial earthquake exploration. 15 refs., 6 figs.
9 CFR 351.19 - Refusal of certification for specific lots.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Refusal of certification for specific lots. 351.19 Section 351.19 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION...
International Nuclear Information System (INIS)
Miyake, Sadaaki; Motegi, Misako; Oosawa, Takashi; Nakazawa, Kiyoaki; Ogata, Hiromitsu; Izumo, Yoshiro; Nakamura, Fumio.
1996-01-01
The concentrations of 137 Cs in water, sediment and biota at the lower region of the famous river in Saitama prefecture were determined in order to elucidate the radioecology of 137 Cs in limnological ecosystems. 137 Cs concentration in water was 0.10 mBq/l. 137 Cs concentrations in sediment, shellfish, Sinotaia quadratus historica (mean for 2 detectable samples), and fish, Carassius auratus cuvieri (mean for 2 detectable samples), were about 6200, 840 and 320 times higher than the concentration of the water, respectively. But 137 Cs radioactivity in the crustacea, Procambarus clarki, was significantly not detected. So, 137 Cs transfer mechanism in the limnological ecosystems was indicated in part. (author)
Yoshida, Yasuko; Honjo, Masanori; Kitamoto, Naoko; Ohsawa, Ryo
2009-08-01
Primula sieboldii E. Morren is a perennial clonal herb that is widely distributed in Japan, but in danger of extinction in the wild. In a previous study, we revealed the genetic diversity of the species using chloroplast and nuclear DNA and used this information to define conservation units. However, we lacked information on adaptive genetic diversity, which is important for long-term survival and, thus, for the definition of conservation units. In order to identify adaptive traits that showed adaptive differentiation among populations, we studied the genetic variation in six quantitative traits within and among populations for 3 years in a common garden using 110 genets from five natural populations from three regions of Japan. The number of days to bud initiation was adaptive quantitative trait for which the degree of genetic differentiation among populations (QST) was considerably larger than that in eight microsatellite markers (FST). The relationship between this trait and environmental factors revealed that the number of days to bud initiation was negatively correlated, with the mean temperature during the growing period at each habitat. This suggests that adaptive differentiation in the delay before bud initiation was caused by selective pressure resulting from temperature differences among habitats. Our results suggest that based on adaptive diversity and neutral genetic diversity, the Saitama population represents a new conservation unit.
2010-01-01
... not otherwise fully repay or sell loan security to repay a deceased borrower's FLP loans, the Agency... SPECIAL PROGRAMS DIRECT LOAN SERVICING-SPECIAL Loan Liquidation § 766.351 Liquidation. (a) General. (1) When a borrower cannot or will not meet a loan obligation, the Agency will consider liquidating the...
2010-04-01
... collar agreement, currency swap agreement, cross-currency rate swap agreement, currency option, any other... Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXEMPTION OF SWAP AGREEMENTS § 35.1 Definitions. (a) Scope. The provisions of this part shall apply to any swap agreement which may be subject to...
2010-04-01
... INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.504 Grants. (a) Benefit. In the case of a grant, a benefit exists in the amount of the grant. (b) Time of receipt of benefit. In the case of a grant, the...
Proceeding of the 1999 Particle Accelerator Conference. Volume 3
1999-04-02
Saitama, JAPAN Abstract The maximum emision current density is also reduced from 5.1 to 3.15 A/cm2 . We plan to use an Ir-coated An electron cooler (EC...3687, 3693 Sutton, Terry D. 3597 Tatanov, V.I. 753 Spyropoulos, Basile 2543 Suwada, T. 1132 Tavares, Pedro F. 2421, 2894, 3125 Sredniawski, Joseph 587
Vorinostat approved in Japan for treatment of cutaneous T-cell lymphomas: status and prospects
Directory of Open Access Journals (Sweden)
Sato A
2012-04-01
Full Text Available Akinori SatoDepartment of Urology, National Defense Medical College, 3-2 Namiki, Tokorozawa, Saitama 359-8513, JapanAbstract: Histone acetylation and deacetylation play important roles in the regulation of gene transcription and in the modulation of chromatin structure. The levels of histone acetylation are determined by the activities of histone acetyltransferases and histone deacetylases (HDACs. HDACs are associated with a number of oncogenes and tumor suppressor genes and can be aberrantly expressed and/or inappropriately activated in cancer cells. HDAC inhibitors have therefore recently emerged as a novel treatment modality against malignancies. They regulate gene expression by enhancing the acetylation of not only histones but also nonhistone proteins, including transcription factors, transcription regulators, signal transduction mediators, and DNA repair enzymes, and they inhibit cancer growth. Vorinostat (suberoylanilide hydroxamic acid is one of the most potent HDAC inhibitors, and was approved in Japan in 2011 for the treatment of cutaneous T-cell lymphoma. Numerous clinical trials have shown it to be effective against cutaneous T-cell lymphoma but less so against other types of cancer. Because vorinostat can overcome resistance to or enhance the efficacy of other anticancer agents, such as 5-fluorouracil, carboplatin, paclitaxel, bortezomib, and tamoxifen, combination therapies using vorinostat and these agents have been investigated. This review introduces the background and mechanism of action of vorinostat and describes the results of clinical trials using vorinostat, both as a single agent and in combination with other anticancer agents, against cutaneous T-cell lymphoma and other malignancies.Keywords: vorinostat, T-cell lymphoma, cancer, novel treatment
Energy Technology Data Exchange (ETDEWEB)
Miyake, Sadaaki; Motegi, Misako; Oosawa, Takashi; Nakazawa, Kiyoaki [Saitama Inst. of Public Health, Urawa (Japan); Ogata, Hiromitsu; Izumo, Yoshiro; Nakamura, Fumio
1996-02-01
The concentrations of {sup 137}Cs in water, sediment and biota at the lower region of the famous river in Saitama prefecture were determined in order to elucidate the radioecology of {sup 137}Cs in limnological ecosystems. {sup 137}Cs concentration in water was 0.10 mBq/l. {sup 137}Cs concentrations in sediment, shellfish, Sinotaia quadratus historica (mean for 2 detectable samples), and fish, Carassius auratus cuvieri (mean for 2 detectable samples), were about 6200, 840 and 320 times higher than the concentration of the water, respectively. But {sup 137}Cs radioactivity in the crustacea, Procambarus clarki, was significantly not detected. So, {sup 137}Cs transfer mechanism in the limnological ecosystems was indicated in part. (author).
Directory of Open Access Journals (Sweden)
Yamamoto M
2017-06-01
Full Text Available Michiko Yamamoto,1 Hirohisa Doi,1 Ken Yamamoto,2 Kazuhiro Watanabe,2 Tsugumichi Sato,3 Machi Suka,4 Takeo Nakayama,5 Hiroki Sugimori6 1Department of Drug Informatics, Center for Education & Research on Clinical Pharmacy, Showa Pharmaceutical University, Tokyo, Japan; 2Department of Pharmacy Practice, Center for Education & Research on Clinical Pharmacy, Showa Pharmaceutical University, Tokyo, Japan; 3Faculty of Pharmaceutical Sciences, Tokyo University of Science, Chiba, Japan; 4Department of Public Health and Environmental Medicine, The Jikei University School of Medicine, Tokyo, Japan; 5Department of Health Informatics, Kyoto University School of Public, Kyoto, Japan; 6Department of Preventive Medicine, Graduate School of Sports and Health Sciences, Daito Bunka University, Saitama, Japan Background: The safe use of drugs relies on providing accurate drug information to patients. In Japan, patient leaflets called Drug Guide for Patients are officially available; however, their utility has never been verified. This is the first attempt to improve Drug Guide for Patients via user testing in Japan.Purpose: To test and improve communication of drug information to minimize risk for patients via user testing of the current and revised versions of Drug Guide for Patients, and to demonstrate that this method is effective for improving Drug Guide for Patients in Japan.Method: We prepared current and revised versions of the Drug Guide for Patients and performed user testing via semi-structured interviews with consumers to compare these versions for two guides for Mercazole and Strattera. We evenly divided 54 participants into two groups with similar distributions of sex, age, and literacy level to test the differing versions of the Mercazole guide. Another group of 30 participants were divided evenly to test the versions of the Strattera guide. After completing user testing, the participants evaluated both guides in terms of amount of information
19 CFR 351.520 - Export insurance.
2010-04-01
... Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.520 Export insurance. (a) Benefit—(1) In general. In the case of export insurance, a benefit exists if the premium rates charged are inadequate to...
19 CFR 351.508 - Debt forgiveness.
2010-04-01
... Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.508 Debt forgiveness. (a) Benefit. In the case of an assumption or forgiveness of a firm's debt obligation, a benefit exists equal to the amount of...
19 CFR 351.413 - Disregarding insignificant adjustments.
2010-04-01
... COUNTERVAILING DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and Normal Value § 351..., constructed export price, or normal value, as the case may be. Groups of adjustments are adjustments for...
A Radio Emission Analysis of Classical Nova V351 Pup (1991)
Wendeln, Carolyn; Chomiuk, Laura; Finzell, Thomas; Linford, Justin D.; Strader, Jay
2017-05-01
Previously, Nova Puppis 1991 (V351 Pup) was measured to host one of the most massive ejections claimed in the literature. Multi-frequency radio detections from one epoch were published for this nova in the 1990's; and yet, the remaining data collected by the Karl G. Jansky Very Large Array (VLA) have remained unpublished. In this paper, we analyze the remaining unpublished data sets for V351 Pup at frequencies of 4.9, 8.4, 14.9, and 22.5 GHz. We fit the resulting light curve to a model of expanding thermal ejecta, under the assumption that the radio emission is dominated by free-free radiation and accounting for high levels of clumping in the ejecta. Images of V351 Pup in both the radio (from the VLA) and Hα+[N II] (from Hubble Space Telescope) exhibit no aspherical structure, strengthening our assumption of spherical symmetry. From expansion parallax methods, we estimate the distance to V351 Pup to be 5.0 ± 1.5 kpc. Our light-curve fit yields a value of {{log}}10({M}{ej})=-5.2+/- 0.7 {M}⊙ for the ejecta mass, implying that V351 Pup is on the low end of expectations for ejecta mass from classical novae. A comparison between our derived ejecta mass and theoretical models gives evidence for a very massive (1.25 {M}⊙ ) white dwarf, which is consistent with spectroscopic evidence for an oxygen-neon white dwarf.
19 CFR 351.506 - Loan guarantees.
2010-04-01
... Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.506 Loan guarantees. (a) Benefit—(1) In general. In the case of a loan guarantee, a benefit exists to the extent that the total amount a firm pays for...
19 CFR 351.509 - Direct taxes.
2010-04-01
... Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.509 Direct taxes. (a) Benefit—(1) Exemption or... direct tax (e.g., an income tax), or a reduction in the base used to calculate a direct tax, a benefit...
19 CFR 351.405 - Calculation of normal value based on constructed value.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Calculation of normal value based on constructed value. 351.405 Section 351.405 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and...
19 CFR 351.515 - Internal transport and freight charges for export shipments.
2010-04-01
... shipments. 351.515 Section 351.515 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE... Internal transport and freight charges for export shipments. (a) Benefit—(1) In general. In the case of internal transport and freight charges on export shipments, a benefit exists to the extent that the charges...
19 CFR 351.517 - Exemption or remission upon export of indirect taxes.
2010-04-01
... taxes. 351.517 Section 351.517 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE... Exemption or remission upon export of indirect taxes. (a) Benefit. In the case of the exemption or remission upon export of indirect taxes, a benefit exists to the extent that the Secretary determines that the...
19 CFR 351.519 - Remission or drawback of import charges upon export.
2010-04-01
... export. 351.519 Section 351.519 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE... Remission or drawback of import charges upon export. (a) Benefit—(1) In general. The term “remission or... import charges. In the case of the remission or drawback of import charges upon export, a benefit exists...
Phenotype abnormality: 351 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 351 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u856i increased number of trichome... branch in organ named trichome ... trichome ... present in greater numbers in organism ... trichome branch ...
Survey of damage to 602 MR scanners after the Great East Japan Earthquake
International Nuclear Information System (INIS)
Nakai, Toshiharu; Yamaguchi-Sekino, Sachiko; Tsuchihashi, Toshio
2013-01-01
An earthquake of 9.0 magnitude, the largest in modern Japanese history, struck east Japan on March 11, 2011. We investigated hazards and observations related to magnetic resonance (MR) scanners in this earthquake to evaluate potential risks and consider further prevention or minimization of damage from and injury of patients in such large earthquakes. The investigation team funded by MHLW sent questionnaires to the 984 facilities with installed MR scanners in the 7 prefectures of east Japan (Iwate, Miyagi, Fukushima, Ibaraki, Chiba, Tokyo, Saitama) and collected 458 responses (46.6%) with information on 602 MR scanners (144 units≤0.5 tesla; 31 one-T units; 371 1.5-T units; and 56 units≥3 T). Significant differences in damage were observed between seismic scale 5 and 6 (χ 2 test, P<0.001 for all items of damage checked). The frequencies of typical damage were displacement of magnets (12.4%), failure of the chiller or air conditioning (9.6%), rapid decrease in liquid helium (8.4%), damage to magnet enclosure and its equipment (7.6%), damage to shielding of the MR scanner room (6.1%), damage to the quench duct (4.5%), breakage of devices anchoring system cabinets (4.4%), damage to the magnet base (3.9%), and flying of metal components (1.5%). Twelve facilities reported flooding by the subsequent tsunami, and quench was confirmed in 19 facilities. No fire damage was reported. It was confirmed that no one was severely injured in MR scanners, and base isolation of the building was very useful in completely preventing damage even at seismic scale 7. In the future, training for evacuation and establishment of a standard protocol for emergency shutdown of MR scanners, onsite checking by MR operators, and emergency power plant equipment to maintain chiller for MR scanners will further ensure MR safety in an earthquake. (author)
A case of cholestatic hepatitis associated with histologic features of acute cholangitis
Directory of Open Access Journals (Sweden)
Takeuchi H
2011-11-01
Full Text Available Hajime Takeuchi1, Toru Kaneko1, Toshikazu Otsuka1, Kumiko Tahara1, Tadashi Motoori2, Makoto Ohbu3, Masaya Oda4, Hiroaki Yokomori11Department of Internal Medicine; 2Division of Pathology, Kitasato Medical Center Hospital, Kitasato University, Saitama; 3Department of Pathology, School of Allied Health Sciences, Kitasato University, Sagamihara, Kanagawa; 4Department of Internal Medicine, Saitama Social Insurance Hospital, Saitama; 5Organized Center of Clinical Medicine, International University of Health and Welfare, Sanno Hospital, Tokyo, JapanAbstract: This report describes a case showing histologic features of acute cholangitis with an over-the-counter drug. A 48-year-old woman was diagnosed with general malaise and progressive jaundice. A thorough review of her medical history revealed that the patient had taken an over-the-counter drug, Pabron Gold®, which she had used previously, that may have caused liver injury. Laboratory investigations revealed jaundice and liver dysfunction. Endoscopic retrograde cholangiography detected no extrahepatic biliary duct dilatation or stones. Liver biopsy indicated acute cholangitis involving neutrophils and eosinophils. Electron microscopy revealed fragmented nuclei, indicating that the degenerative bile duct-related epithelial cells were in an apoptotic process.Keywords: liver injury, over-the-counter drug, histologic features, acute cholangitis, electron microscopy, Pabron Gold
Naratriptan in the Prophylactic Treatment of Cluster Headache.
Ito, Yasuo; Mitsufuji, Takashi; Asano, Yoshio; Shimazu, Tomokazu; Kato, Yuji; Tanahashi, Norio; Maruki, Yuichi; Sakai, Fumihiko; Yamamoto, Toshimasa; Araki, Nobuo
2017-10-01
Objective Naratriptan has been reported to reduce the frequency of cluster headache. The purpose of this study was to determine whether naratriptan is effective as a prophylactic treatment for cluster headache in Japan. Methods We retrospectively reviewed all 43 patients with cluster headache who received preventive treatment with naratriptan from April 2009 to April 2015. The International Classification of Headache Disorders, 3rd Edition (beta version) (ICHD-3 beta) was used to diagnose cluster headache. This study was conducted at 3 centers (Department of Neurology, Saitama Medical University; Saitama Neuropsychiatric Institute; Saitama Medical University International Medical Center). Patients were recruited from these specialized headache outpatient centers. Naratriptan was taken before the patient went to bed. Results The study population included 30 men (69.8%) and 13 women (30.2%). Twenty-two cases received other preventive treatments (51.2%), while 21 cases only received naratriptan (48.8%). Among the 43 cases, 37 patients (86.0%) achieved an improvement of cluster headache on naratriptan. Conclusion Naratriptan has been suggested as a preventive medicine for cluster headache because of the longer the biological half-life in comparison to other triptans. The internal use of naratriptan 2 hours before attacks appears to achieve a good response in patients with cluster headache.
Directory of Open Access Journals (Sweden)
Mikiko Takezawa
2011-02-01
Full Text Available Mikiko Takezawa, Soichi Tetsuka, Akihiro KakehashiDepartment of Ophthalmology, Jichi Medical University, Saitama Medical Center, Saitama, Saitama, JapanAbstract: We report the possible mechanism of development of cystoid macular edema (CME in retinitis pigmentosa (RP in the case of a 68-year-old woman with RP and CME in the right eye and resolving CME in the left eye. Spectral domain optical coherence tomography showed CME and posterior vitreoschisis in the nasal quadrant of the fundus without a posterior vitreous detachment (PVD. This vitreous pathology suggested bilateral thickening and shrinkage of the posterior vitreous cortex. In the right eye, CME was evident with no vitreofoveal separation. However, in the left eye, minimal change was seen in the CME associated with a focal shallow PVD over the fovea. The best-corrected visual acuity (BCVA in the left eye increased to 0.3 from 0.15 7 years after the first visit. Tangential vitreous traction on the macula may have caused the CME in the right eye. The shallow PVD over the fovea might have released the tangential vitreous traction from the fovea, induced spontaneous resolution of the CME, and improved the BCVA in the left eye.Keywords: retinitis pigmentosa, cystoid macular edema, posterior vitreous detachment, posterior vitreoschisis, optical coherence tomography
19 CFR 351.408 - Calculation of normal value of merchandise from nonmarket economy countries.
2010-04-01
... nonmarket economy countries. 351.408 Section 351.408 Customs Duties INTERNATIONAL TRADE ADMINISTRATION... economy countries. (a) Introduction. In identifying dumping from a nonmarket economy country, the Secretary normally will calculate normal value by valuing the nonmarket economy producers' factors of...
2010-07-01
... replacement and upgrading of equipment at Veterans Memorial Medical Center. 17.351 Section 17.351 Pensions... Philippines § 17.351 Grants for the replacement and upgrading of equipment at Veterans Memorial Medical Center. Grants to assist the Republic of the Philippines in the replacement and upgrading of equipment and in...
19 CFR 351.404 - Selection of the market to be used as the basis for normal value.
2010-04-01
... Price, Fair Value, and Normal Value § 351.404 Selection of the market to be used as the basis for normal value. (a) Introduction. Although in most circumstances sales of the foreign like product in the home... for normal value. 351.404 Section 351.404 Customs Duties INTERNATIONAL TRADE ADMINISTRATION...
19 CFR 351.409 - Differences in quantities.
2010-04-01
... DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and Normal Value § 351.409... comparing export price or constructed export price with normal value, the Secretary will make a reasonable... section 773(a)(6)(C)(i) of the Act.) (b) Sales with quantity discounts in calculating normal value. The...
2010-07-01
... (TINs) required for registration of book-entry Series EE savings bonds? 351.68 Section 351.68 Money and... TREASURY BUREAU OF THE PUBLIC DEBT OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.68 Are taxpayer identification numbers (TINs) required for registration of book-entry...
Directory of Open Access Journals (Sweden)
Ate Dijkstra
2015-06-01
Full Text Available Objective: This study investigates the influence of personal characteristics and health-related variables on the care dependency status among elderly in-patients with clinically diagnosed Alzheimer’s disease in two countries. Methods: A descriptive cross-cultural survey was administered to a convenience sample of 137 elderly in-patients. Patients were recruited from a hospital in Japan (N = 77 and from a nursing home in the Netherlands (N = 60. Results: In both countries, almost all participants are assessed on the severity level of care dependency in the range of “completely care dependent” (Japan: 35.1%; the Netherlands: 20.0%, or “to a great extent care dependent” (Japan: 24.7%; the Netherlands: 45.0%, to “partially care dependent” (Japan: 22.1%; the Netherlands: 21.7%. Conclusion: This study demonstrates that there is no interdependence between the severity level of care dependency and personal characteristics of patients with Alzheimer’s disease in both countries. Regarding the interplay of health-related variables on the severity level of care dependency, a difference was found between countries.
19 CFR 351.502 - Specificity of domestic subsidies.
2010-04-01
... 351.502 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND...) The subsidy programs have the same purpose; (2) The subsidy programs bestow the same type of benefit; (3) The subsidy programs confer similar levels of benefits on similarly situated firms; and (4) The...
37 CFR 351.2 - Voluntary negotiation period; settlement.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Voluntary negotiation period... CONGRESS COPYRIGHT ROYALTY JUDGES RULES AND PROCEDURES PROCEEDINGS § 351.2 Voluntary negotiation period..., the Copyright Royalty Judges will announce the beginning of a voluntary negotiation period and will...
31 CFR 351.86 - What is the role of Federal Reserve Banks and Branches?
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What is the role of Federal Reserve Banks and Branches? 351.86 Section 351.86 Money and Finance: Treasury Regulations Relating to Money and... Kansas City, 925 Grand Boulevard, Kansas City, MO 64106 Dallas, San Francisco, Kansas City, St. Louis...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Special monthly dependency and indemnity compensation, death compensation, pension and spouse's compensation ratings. 3.351 Section 3.351 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension...
19 CFR 351.411 - Differences in physical characteristics.
2010-04-01
... COUNTERVAILING DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and Normal Value § 351... difference has an effect on prices. In calculating normal value, the Secretary will make a reasonable..., the Secretary may also consider differences in the market value. The Secretary will not consider...
37 CFR 351.3 - Controversy and further proceedings.
2010-07-01
..., the contested amount of a claim is $10,000 or less, the Copyright Royalty Judges shall decide the... CONGRESS COPYRIGHT ROYALTY JUDGES RULES AND PROCEDURES PROCEEDINGS § 351.3 Controversy and further... negotiation period, the Copyright Royalty Judges will issue an order declaring that further proceedings are...
Topical steroid addiction in atopic dermatitis
Fukaya, Mototsugu; Sato, Kenji; Sato, Mitsuko; Kimata, Hajime; Fujisawa, Shigeki; Dozono, Haruhiko; Yoshizawa, Jun; Minaguchi, Satoko
2014-01-01
Mototsugu Fukaya,1 Kenji Sato,2 Mitsuko Sato,3 Hajime Kimata,4 Shigeki Fujisawa,5 Haruhiko Dozono,6 Jun Yoshizawa,7 Satoko Minaguchi8 1Tsurumai Kouen Clinic, Nagoya, 2Department of Dermatology, Hannan Chuo Hospital, Osaka, 3Sato Pediatric Clinic, Osaka, 4Kimata Hajime Clinic, Osaka, 5Fujisawa Dermatology Clinic, Tokyo, 6Dozono Medical House, Kagoshima, 7Yoshizawa Dermatology Clinic, Yokohama, 8Department of Dermatology, Kounosu Kyousei Hospital, Saitama, Japan Abstract: The American Academy ...
Smartphone viewing distance and sleep: an experimental study utilizing motion capture technology
Yoshimura,Michitaka; Kitazawa,Momoko; Maeda,Yasuhiro; Mimura,Masaru; Tsubota,Kazuo; Kishimoto,Taishiro
2017-01-01
Michitaka Yoshimura,1,* Momoko Kitazawa,1–3,* Yasuhiro Maeda,2 Masaru Mimura,4 Kazuo Tsubota,1 Taishiro Kishimoto,4,5 1Department of Ophthalmology, Keio University School of Medicine, Tokyo, 2RIKEN Center for Advanced Photonics, Wako, Saitama, 3Department of Nursing, Aino University Junior College, 4Department of Neuropsychiatry, Keio University School of Medicine, Tokyo, Japan; 5Department of Psychiatry, Hofstra Northwell School of Medicine, NY, USA *These authors contributed equal...
19 CFR 351.410 - Differences in circumstances of sale
2010-04-01
... COUNTERVAILING DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and Normal Value § 351.410 Differences in circumstances of sale (a) Introduction. In calculating normal value the Secretary... on the market value of the merchandise. ...
Modeling of filamentation damage induced in silica by 351-nm laser pulses
International Nuclear Information System (INIS)
Milam, D.; Manes, K.R.; Williams, W.H.
1996-01-01
A major risk factor that must be considered in design of the National Ignition Facility is the possibility for catastrophic self-focusing of the 351-nm beam in the silica optical components that are in the final section of the laser. Proposed designs for the laser are analyzed by the beam-propagation code PROP92. A 351-nm self-focusing experiment, induction of tracking damage, was done to provide data for validation of this code. The measured self-focusing lengths were correctly predicted by the code
Antigenic characterization of small, round-structured viruses by immune electron microscopy.
Okada, S; Sekine, S; Ando, T; Hayashi, Y; Murao, M; Yabuuchi, K; Miki, T; Ohashi, M
1990-01-01
Small, round-structured viruses (SRSVs) detected from nonbacterial gastroenteritis outbreaks in Tokyo and Saitama Prefecture, Japan, during the period from 1977 to 1988 were tentatively classified into nine antigenic patterns from SRSV-1 (S-1) to SRSV-9 (S-9) by cross-immune electron microscopy (IEM). S-1 and S-2 appeared pattern specific, while S-3 to S-9, distinguishable from each other in their reactivity, appeared somewhat antigenically related. Their antigenic relatedness to the Norwal, ...
Research and development of electric vehicles for clean transportation.
Wada, Masayoshi
2009-01-01
This article presents the research and development of an electric vehicle (EV) in Department of Human-Robotics Saitama Institute of Technology, Japan. Electric mobile systems developed in our laboratory include a converted electric automobile, electric wheelchair and personal mobile robot. These mobile systems contribute to realize clean transportation since energy sources and devices from all vehicles, i.e., batteries and electric motors, does not deteriorate the environment. To drive motors for vehicle traveling, robotic technologies were applied.
Ito, Akiko; Nishioka, Kazue; Kanto, Hiromi; Yagami, Akiko; Yamada, Shigeki; Sugiura, Mariko; Yasunaga, Chihiro; Yoshii, Keiko; Kobayashi, Hiromi; Adachi, Atsuko; Ikezawa, Yuko; Washizaki, Kumiko; Inui, Shigeki; Miyazawa, Hitoshi; Oiso, Naoki; Nakata, Tokio; Matsunaga, Kayoko
2017-07-01
In Japan, allergic contact dermatitis caused by hair colouring agents is a considerable problem for those occupationally exposed and also for consumers. Over the last 20 years, p-phenylenediamine (PPD) has been a common allergen, with ∼7% positive patch test reactions. To investigate which ingredients caused allergic contact dermatitis related to hair dye and perming solutions in Japan, to assess whether PPD is suitable for screening for hair dye allergy, and to propose allergens for a Japanese hairdresser series. We selected 19 hair cosmetic allergens, including PPD, Bandrowski's base, cysteamine HCl, and ammonium thioglycolate. Altogether 203 patients (26 males and 177 females) with suspected contact allergy to hair colouring or perming solutions at 14 hospitals in Japan were included. The highest prevalence of positive reactions (35.1%) was for PPD. p-Methylaminophenol and o-aminophenol were often positive, both in the PPD-positive and in the PPD-negative patients. Moreover, cysteamine HCl often yielded positive test reactions. PPD is insufficient to diagnose contact allergy caused by to hair dyes. We recommend 13 allergens to be included in a Japanese hairdresser series. © 2017 The Authors. Contact Dermatitis published by John Wiley & Sons Ltd.
2010-04-01
... prior-stage cumulative indirect taxes. 351.518 Section 351.518 Customs Duties INTERNATIONAL TRADE... indirect taxes. (a) Benefit—(1) Exemption of prior-stage cumulative indirect taxes. In the case of a... production of an exported product, a benefit exists to the extent that the exemption extends to inputs that...
Directory of Open Access Journals (Sweden)
Akira Sato
Full Text Available Cell-death can be necrosis and apoptosis. We are investigating the mechanisms regulating the cell death that occurs on treatment of mouse cancer cell-line FM3A with antitumor 5-fluoro-2'-deoxyuridine (FUdR: necrosis occurs for the original clone F28-7, and apoptosis for its variant F28-7-A. Here we report that a microRNA (miR-351 regulates the cell death pattern. The miR-351 is expressed strongly in F28-7-A but only weakly in F28-7. Induction of a higher expression of miR-351 in F28-7 by transfecting an miRNA mimic into F28-7 resulted in a change of the death mode; necrosis to apoptosis. Furthermore, transfection of an miR-351 inhibitor into F28-7-A resulted in the morphology change, apoptosis to necrosis, in this death-by-FUdR. Possible mechanism involving lamin B1 in this miR-351's regulatory action is discussed.
33 CFR 165.820 - Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania. 165.820 Section 165.820 Navigation and Navigable Waters... Guard District § 165.820 Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania. (a...
19 CFR 351.511 - Provision of goods or services.
2010-04-01
... 351.511 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND... services. (a) Benefit—(1) In general. In the case where goods or services are provided, a benefit exists to... import duties. (b) Time of receipt of benefit. In the case of the provision of a good or service, the...
20 CFR 410.351 - Determination of dependency; divorced wife.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of dependency; divorced wife... AND SAFETY ACT OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Relationship and Dependency § 410.351 Determination of dependency; divorced wife. An individual who is the miner's divorced wife (see § 410.311) will...
31 CFR 351.47 - May I purchase definitive Series EE savings bonds through a payroll savings plan?
2010-07-01
... savings bonds through a payroll savings plan? 351.47 Section 351.47 Money and Finance: Treasury....47 May I purchase definitive Series EE savings bonds through a payroll savings plan? You may purchase... maintains a payroll savings plan. An authorized issuing agent must issue the bonds. ...
Diminished but Not Abolished Effect of Two His351 Mutants of Anthrax Edema Factor in a Murine Model
Zhao, Taoran; Zhao, Xinghui; Liu, Ju; Meng, Yingying; Feng, Yingying; Fang, Ting; Zhang, Jinlong; Yang, Xiuxu; Li, Jianmin; Xu, Junjie; Chen, Wei
2016-01-01
Edema toxin (ET), which is composed of a potent adenylate cyclase (AC), edema factor (EF), and protective antigen (PA), is one of the major toxicity factors of Bacillus anthracis. In this study, we introduced mutations in full-length EF to generate alanine EF(H351A) and arginine EF(H351R) variants. In vitro activity analysis displayed that the adenylyl cyclase activity of both the mutants was significantly diminished compared with the wild-type EF. When the native and mutant toxins were administered subcutaneously in a mouse footpad edema model, severe acute swelling was evoked by wild-type ET, while the symptoms induced by mutant toxins were very minor. Systemic administration of these EF variants caused non-lethal hepatotoxicity. In addition, EF(H351R) exhibited slightly higher activity in causing more severe edema than EF(H351A). Our findings demonstrate that the toxicity of ET is not abolished by substitution of EF residue His351 by alanine or arginine. These results also indicate the potential of the mouse footpad edema model as a sensitive method for evaluating both ET toxicity and the efficacy of candidate therapeutic agents. PMID:26848687
Hayashi, Y; Shimizu, Y; Netsu, S; Hanley, S; Konno, R
2012-08-10
In Japan, the bivalent HPV vaccine was approved in October, 2009 and became available as a non-routine vaccine from December, 2009. While routine vaccinations are free, the cost and responsibility for non-routine vaccinations are left to the individual. In exceptional circumstances regional governments fund non-routine vaccinations. This was the case in Shiki City, Saitama Prefecture, where a high uptake rate for individual (non-school based) HPV vaccination was obtained. On January 20, 2010, the mayor of Shiki City announced to the media his decision to vaccinate adolescent girls in Shiki City against HPV. A project team for HPV vaccination was set up in the city's Health Promotion Center. To gain mutual consent for HPV vaccination, senior health professionals, city officials, the head of the board of education, school principals and health-care teachers met several times. The cohort to be vaccinated was 1254 girls aged 12-15 years. Individual notifications were mailed to each girl on April 23, 2010, along with information about the HPV vaccine. As of April 10th, 2011, the uptake rate for girls aged 15 years old was 90.7% for the 1st dose. The vaccine registry is managed by the health care system of the city. The success of the HPV vaccination program and high uptake rates in Shiki City is a good model for the nationwide HPV vaccination program that started in February, 2011. Copyright © 2012 Elsevier Ltd. All rights reserved.
Uemura, Shinichi; Machida, Kazuhiki
2003-09-01
In order to evaluate the relationship of quality of life (QOL) with physical fitness, competence and stress response in the elderly population in Japan, a cross sectional field survey of elderly subjects was conducted. This survey was taken in Naguri village, Saitama. The data collected included physical fitness, competence, stress response and QOL in addition to demographic variables. As for physical fitness indexes, grip strength (GS), single leg balance with eyes closed (SLB), bar grip ping reaction time (RT), trunk flexion (RF), ten-meter walking time (WT) and vital capacity (VC) were measured. The SF-36 was used for QOL assessment. A total of 120 elderly subjected participated to the survey. There were 42 males (73.5 +/- 5.74 years) and 78 females (74.2 +/- 6.17 years). The associations between physical health parameters in SF-36 and WT were highly significant: physical functioning (beta = -2.96, p fit indexes of the structural equation model describing the relationships among physical fitness, competence, stress response and QOL indicated excellent fit to the data with GFI = 0.95 and AGFI = 0.88. Stress response showed relatively stronger influence on QOL than physical fitness or competence. Although there were slight differences in degree of influence, physical fitness, stress response and competence were found to be clearly related to QOL in elderly subjects. To keep good QOL status, it is important to maintain good physical fitness and level of competence and to reduce stress response.
DEFF Research Database (Denmark)
Hansen, Annette Skovsted
2013-01-01
I 1500- og 1600-tallet dannedes tidligt moderne stater i Europa, men samtidig eksisterede der ligeså avancerede statsdannelser uden for Europa, bl.a. i Kina, Indien og Japan. I det følgende ser vi nærmere på dannelsen af den moderne stat i Japan. Hvorfor blev Japan aldrig en europæisk koloni......? Hvordan havde japanske magthavere igennem 300 år forberedt Japan og de mennesker, der boede på de japanske øer, til at kunne udvikle en nation, der skulle blive den stærkeste og rigeste i Asien i mere end 100 år? Hvem bestemte i Japan? Kejseren eller shogunen?...
Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm
Tang, Yongxin; Zhu, Lei
2005-06-01
We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.
31 CFR 351.85 - May Public Debt waive any provision in this part?
2010-07-01
... UNITED STATES SAVINGS BONDS, SERIES EE Miscellaneous Provisions § 351.85 May Public Debt waive any... unnecessary hardship: (a) If such action would not be inconsistent with law or equity; (b) If it does not...
Prevalence of frailty in Japan: A systematic review and meta-analysis.
Kojima, Gotaro; Iliffe, Steve; Taniguchi, Yu; Shimada, Hiroyuki; Rakugi, Hiromi; Walters, Kate
2017-08-01
Japan's population is aging more rapidly than that of any other country. Frailty has recently been recognized as an important priority. Understanding the basic epidemiology of frailty in Japan, which is an example of a rapidly aging society, will be beneficial for Japan as well as other countries expecting an aging population. A systematic literature search of 11 electronic databases was conducted in March 2016 using a comprehensive set of Medical Subject Heading and text terms for any studies published in 2000 or later that report the prevalence of frailty among Japanese community-dwelling older people aged 65 years or older. A total of 1529 studies were identified in the systematic search, of which five studies were included in this review. The pooled prevalence of frailty, prefrailty, and robustness was 7.4% (95% confidence interval [CI], 6.1%-9.0%), 48.1% (95% CI, 41.6%-54.8%), and 44.4% (95% CI, 37.2%-51.7%), respectively. A significant degree of heterogeneity was observed. There was no evidence of publication bias. Age-stratified meta-analyses of four studies showed the pooled prevalence of frailty was 1.9%, 3.8%, 10.0%, 20.4%, and 35.1% for those aged 65-69, 70-74, 75-79, 80-84, and ≥85 years, respectively. Pooled prevalence of frailty was 8.1% for women and 7.6% for men. This review showed an overall pooled prevalence of frailty among Japanese community-dwelling older people of 7.4%. The age-stratified analysis suggested that Japanese older people are less frail before their late 70's but frailer in later life than older people in other countries. These findings provide important basic information for all parties involved in Japanese frailty research. Copyright © 2016 The Authors. Production and hosting by Elsevier B.V. All rights reserved.
24 CFR 983.351 - PHA payment to owner for occupied unit.
2010-04-01
... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Payment to Owner § 983.351 PHA payment to owner for occupied unit. (a) When payments are made. (1) During the term of the HAP contract, the PHA shall... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false PHA payment to owner for occupied...
Directory of Open Access Journals (Sweden)
Kashiwagi H
2017-08-01
Full Text Available Hiroko Kashiwagi,1 Satoru Ikezawa,2 Tomiki Sumiyoshi,3 Atsuko Kadono,4 Kazuhiko Segawa,5 Kazuyoshi Takeda,1 Mayu Omori,1 Hisako Taguchi,1 Naotsugu Hirabayashi1 1Department of Forensic Psychiatry, 2Department of Psychiatry, 3Department of Clinical Epidemiology, Translational Medical Center, National Center Hospital of Neurology and Psychiatry, Kodaira, Tokyo, 4Saitama Psychiatric Medical Center, Kitaadatigun, Saitama, 5Department of General Medicine, National Center Hospital of Neurology and Psychiatry, Kodaira, Tokyo, Japan Abstract: We present a case of schizophrenia comorbid for tetralogy of Fallot, without chromosome 22q.11.2 deletion or duplication, treated successfully with a combination of clozapine and antiepileptic drugs. Although clozapine by itself initially triggered convulsive seizures, we continued it with co-administration of valproate and topiramate. This combined treatment did not affect cardiac function of the patient, who experienced a favorable clinical course in terms of symptomatology and functional outcomes. To our knowledge, we provide the first report on a patient with tetralogy of Fallot, in whom 22q.11.2 was not deleted and clozapine-induced seizures were observed. Keywords: schizophrenia, clozapine, tetralogy of Fallot, seizure, copy number variants
A case of radial keratoneuritis in non-Acanthamoeba keratitis
Directory of Open Access Journals (Sweden)
Mutoh T
2012-09-01
Full Text Available Tetsuya Mutoh, Yukihiro Matsumoto, Makoto ChikudaDepartment of Ophthalmology, Dokkyo Medical University Koshigaya Hospital, Saitama, JapanAbstract: A case of non-Acanthamoeba keratitis with radial keratoneuritis, which is thought to be pathognomonic for Acanthamoeba keratitis, is reported. A healthy 32-year-old woman with a history of frequent replacement of her contact lenses due to wear was examined at Dokkyo Medical University Koshigaya Hospital (Saitama, Japan and found to have a slight corneal opacity that was accompanied by radial keratoneuritis. Based on both the patient’s clinical findings and past history, the presence of Acanthamoeba keratitis was highly suspected. However, direct light microscopy of corneal scrapings stained by the Parker ink–potassium hydroxide method only found Acanthamoeba-type material in the specimen collected at her initial visit. In all other specimens collected from the patient, no Acanthamoeba was found either when using the same method or when performing cultures of the surgical debridement of the corneal lesion. In addition, topical antifungal eye drops, systemic antifungal drugs, and surgical debridement were also not effective in this case. Since a precise diagnosis could not be made, the patient was treated with topical 0.1% betamethasone sodium, which ultimately resulted in a dramatic improvement of her corneal inflammation. At 23 days after initiation of topical administration of 0.1% betamethasone sodium, visual acuity was 20/250, with a slight corneal opacity noted at the original site of infection. The outcome of the current case suggests that radial keratoneuritis is not always pathognomonic for Acanthamoeba keratitis.Keywords: radial keratoneuritis, non-Acanthamoeba keratitis, topical corticosteroid
19 CFR 351.407 - Calculation of constructed value and cost of production.
2010-04-01
... ANTIDUMPING AND COUNTERVAILING DUTIES Calculation of Export Price, Constructed Export Price, Fair Value, and Normal Value § 351.407 Calculation of constructed value and cost of production. (a) Introduction. This... 19 Customs Duties 3 2010-04-01 2010-04-01 false Calculation of constructed value and cost of...
Imaging evaluation of infants with neuroblastoma detected by VMA screening spot test
International Nuclear Information System (INIS)
Fujioka, M.; Saiki, N.; Aihara, T.; Yamamoto, K.
1988-01-01
In the Saitama Prefecture in Japan, VMA (vanillyl manderic acid) screening spot test for detection of neuroblastoma has been performed in 173,046 infants in the years 1981-1986 and 15 infants were found to have neuroblastoma. Two infants had mediastinal tumors and the remainder, 13, had intraabdominal tumors. Only 7 infants had palpable masses. Although CT was documented to be the best imaging procedure to provide sufficient information for treatment, conventional radiographic examinations of the chest and abdomen, and abdominal ultrasonography were able, as initial imaging procedures, to detect reasonably small neuroblastomas in infants with a positive VMA screening test. (orig.)
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What do I need to know about the long-term savings bond rate, to understand redemption value calculations in this subpart? 351.12 Section 351... What do I need to know about the long-term savings bond rate, to understand redemption value...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What do I need to know about the short-term savings bond rate, to understand redemption value calculations in this subpart? 351.11... Provisions § 351.11 What do I need to know about the short-term savings bond rate, to understand redemption...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What do I need to know about the savings bond rate to understand redemption value calculations in this subpart? 351.13 Section 351.13 Money... What do I need to know about the savings bond rate to understand redemption value calculations in this...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What do I need to know about market yields, or market bid yields, to understand redemption value calculations in this subpart? 351.10 Section... Provisions § 351.10 What do I need to know about market yields, or market bid yields, to understand...
351.pdf | mar2007 | jbiosci | www.ias.ac.in | | http: | Indian Academy ...
Indian Academy of Sciences (India)
Home; http: www.ias.ac.in; jbiosci; mar2007; 351.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Summer Research Fellowship Programme 2018. Posted on 16 December 2017.
Time Trends in Helicobacter pylori Infection and Atrophic Gastritis Over 40 Years in Japan.
Kamada, Tomoari; Haruma, Ken; Ito, Masanori; Inoue, Kazuhiko; Manabe, Noriaki; Matsumoto, Hiroshi; Kusunoki, Hiroaki; Hata, Jiro; Yoshihara, Masaharu; Sumii, Koji; Akiyama, Takashi; Tanaka, Shinji; Shiotani, Akiko; Graham, David Y
2015-06-01
Helicobacter pylori infection produces progressive mucosal damage that may eventually result in gastric cancer. We studied the changes that occurred in the presence and severity of atrophic gastritis and the prevalence of H. pylori infection that occurred coincident with improvements in economic and hygienic conditions in Japan since World War II. The prevalence of H. pylori infection and histologic grades of gastric damage were retrospectively evaluated using gastric biopsy specimens obtained over a 40-year period. Gastric atrophy and intestinal metaplasia were scored using the updated Sydney classification system. The prevalence of H. pylori and severity of atrophy were examined in 1381 patients including 289 patients examined in the 1970s (158 men; mean age, 44.9 years), 787 in the 1990s (430 men; 44.2 years), and 305 in the 2010s (163 men; 53.2 years). Overall, the prevalence of H. pylori infection decreased significantly from 74.7% (1970s) to 53% (1990s) and 35.1% (2010s) (p pylori infection. There has been a progressive and rapid decline in the prevalence of H. pylori infection as well a fall in the rate of progression of gastric atrophy among H. pylori-infected Japanese coincident with the westernization and improvements in economic and hygienic conditions in Japan since World War II. © 2015 John Wiley & Sons Ltd.
19 CFR 351.510 - Indirect taxes and import charges (other than export programs).
2010-04-01
... OF COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Identification and Measurement of Countervailable Subsidies § 351.510 Indirect taxes and import charges (other than export programs). (a) Benefit—(1... the full or partial exemption or remission of an indirect tax or an import charge, a benefit exists to...
Michael E. Porter; Mariko Sakakibara
2004-01-01
This article examines competition in Japan and its link to postwar economic prosperity. While Japan's industrial structure and competition policy seem to indicate that competition in Japan has been less intense, the empirical evidence does not support this conclusion. The sectors in which competition was restricted prove to be those where Japan was not internationally successful. In the internationally successful sectors, internal competition in Japan was invariably fierce. While the level of...
2015-11-04
system as a function of coating parameters, physical conditions, as well as environment. Experimental Materials.— 99.9% magnesium rod (8.0 mm diam.), 500...μm di- ameter 99.9% magnesium wire, 1.6 mm thick AA2024-T351 sheet, Table I. Composition of AA2024-T351 used as a bare electrode in these...selected because they enable electrochemical impedance spectroscopy ( EIS ) measurements along with traditional electrochemical measure- ments. Saturated
Anisotropic Deformation Behavior of Al2024T351 Aluminum Alloy
Directory of Open Access Journals (Sweden)
R Khan
2013-06-01
Full Text Available The objective of this work was to investigate the effects of material anisotropy on the yielding and hardening behavior of 2024T351 aluminum alloy using isotropic and anisotropic yield criteria. Anisotropy may be induced in a material during the manufacturing through processes like rolling or forging. This induced anisotropy gives rise to the concept of orientation-dependent material properties such as yield strength, ductility, strain hardening, fracture strength, or fatigue resistance. Inclusion of the effects of anisotropy is essential in correctly predicting the deformation behavior of a material. In this study, uniaxial tensile tests were first performed in all three rolling directions, L , T and S , for smooth bar specimens made from hot rolled plate of Al2024 alloy. The experimental results showed that the L - and T -directions yielded higher yield strengths and a greater percentage of elongation before fracture than the S -direction. Subsequently, finite element analysis of tensile specimens was performed using isotropic (von Mises and anisotropic (Hill yield criteria to predict the onset of yielding and hardening behaviors during the course of deformation. Hill's criterion perfectly fitted with the test data in the S -direction, but slightly underestimated the yield strength in L -direction. The results indicated that the Hill yield criterion is the most suitable one to predict the onset of yielding and hardening behaviors for 2024T351 aluminum alloy in all directions.
A New Stubby Species of Demodectic Mite (Acari: Demodicidae) From the Domestic Dog (Canidae).
Morita, Tatsushi; Ohmi, Aki; Kiwaki, Akihito; Ike, Kazunori; Nagata, Katsuyuki
2018-02-28
A new species of Demodex was detected in the earwax of a dog with otitis externa in Saitama Prefecture, Japan, in July 2010. The opisthosoma length of the mite was slightly shorter than 1/2 of its body length, which was different from the other species in domestic dogs, D. canis and D. injai, but was similar to the form of mites termed "short-bodied species", including D. cornei. However, the stubby external form was morphologically different from those of "short-bodied species", excluding a case without a species description reported from Greece. Among known species, the mite was similar to D. equi and D. acutipes.
The 23rd nuclear explosion test of the People's Republic of China
International Nuclear Information System (INIS)
1978-01-01
Concerning the 23 rd nuclear explosion test of the People's Republic of China, the results of measurements of radioactivity, etc. in Japan are presented. (1) As for gross beta-radioactivity in upper air, high radioactivity was measured in western Japan. (2) As for gross beta-radioactivity in surface air at monitoring posts, relatively high radioactivity was detected in south-western Japan. (3) As for gross beta-radioactivity in rain and dry fallout, 130 mCi/km 2 in Hachijo Island and 101.9 mCi/km 2 in Saitama Prefecture were detected, and as for dry fallout, 82 mCi/km 2 was measured at National Institute of Radiological Sciences (Chiba Prefecture). (4) As for gross beta-radioactivity in air-borne dust, higher radioactivity than normal was measured in several prefectures. (5) As for the radioactive iodine concentration in raw milk, relatively high concentration of radioactive iodine was detected by National Institute of Radiological Sciences. (6) Hot particles. (7) Analysis of radionuclides. (8) Other related data. (J.P.N.)
The 35th JAIF annual conference
International Nuclear Information System (INIS)
2003-01-01
The JAIF (Japan Atomic Industrial Forum, INC) conference was opened at Oomiya Sonic City- Sonic City Hole, Saitama, Japan from April 22 to 24, 2002. Main theme was nuclear power in the changing socio-political environment-challenges for the future. The conference consisted of six parts such as opening session, session 1: energy policy of the 21st century and nuclear power, session 2: tasks for metropolitan areas and regions with nuclear facilities, session 3: why plutonium recycling? , session 4: contribution of nuclear power under the new socio-economic environment and session 5: to shape the future of nuclear power: development of advanced and innovative reactors. Session 2 to 4 was panel discussion. The other meeting for citizens and Youth Forum was hold and cinemas of nuclear power were shown. 14 speakers from many countries gave a lecture, 16 persons were panelers and 4 commentators. (S.Y.)
19 CFR 351.403 - Sales used in calculating normal value; transactions between affiliated parties.
2010-04-01
..., Constructed Export Price, Fair Value, and Normal Value § 351.403 Sales used in calculating normal value... 19 Customs Duties 3 2010-04-01 2010-04-01 false Sales used in calculating normal value... offers for sale in determining normal value. Additionally, this section clarifies the authority of the...
Okazaki, Atsuko; Fukushima, Risa; Nagashima, Sayuri; Mazda, Yusuke; Tamura, Kazumi; Terui, Katsuo; Tanaka, Motoshi
2016-12-01
The purpose of this study was to investigate the effects of labor epidural analgesia (LEA) on maternal and neonatal outcomes among parturients aged 40 years or older. We retrospectively reviewed medical records of all laboring, singleton and cephalic deliveries at ≥36 weeks' gestation at the Saitama Medical Center from April 2003 to September 2012. Women aged ≥40 years who received LEA (≥40 with LEA group) were compared with women aged ≥40 years who delivered without LEA (≥40 without LEA group) and women <40 years who received LEA (<40 with LEA group). Extracted outcomes included mode of delivery, oxytocin augmentation, duration of labor, amount of estimated blood loss, umbilical artery pH, Apgar scores, and neonatal intensive care unit admission. This study included 4441 women. There were 74 women in the ≥40 with LEA group, 369 in the ≥40 without LEA group, and 601 in the <40 with LEA group. The maternal outcomes of emergency cesarean delivery rate (9.5%, 12.5%, 9.0%), instrumental delivery rate (33.8%, 10.3%, 28.3%), duration of labor (521 min, 321 min, 565 min), and estimated blood loss (524 g, 351 g, 412 g) were reported for the ≥40 with LEA, ≥40 without LEA, and <40 with LEA groups, respectively. Neonatal outcomes were not different between these groups. LEA use was not associated with emergency cesarean delivery in the multivariable analysis. Our study showed that parturients aged ≥40 with LEA can expect similar LEA-associated labor outcomes to younger parturients with LEA. © 2016 Japan Society of Obstetrics and Gynecology.
Energy Technology Data Exchange (ETDEWEB)
Komatsubara, Kazuyo [Embassy of the Kingdom of the Netherlands, Tokyo (Japan)
2012-06-15
An overview is given of wind energy in Japan: Background; Wind Energy in Japan; Japanese Wind Energy Industry; Government Supports; Useful Links; Major Japanese Companies; Profiles of Major Japanese Companies; Major Wind Energy Projects in Japan.
DEFF Research Database (Denmark)
Ørstrup, Finn Rude; Hvass, Sven
2003-01-01
Kompendium udarbejdet til en studierejse til Japan 2003 Kunstakademiets Arkitektskole, Studieafdeling 10......Kompendium udarbejdet til en studierejse til Japan 2003 Kunstakademiets Arkitektskole, Studieafdeling 10...
An Exegetical Note on Plutarch, Isis and Osiris 351E
Directory of Open Access Journals (Sweden)
Geert Roskam
2015-06-01
Full Text Available In this article, I deal with a short but complex sentence at the end of the first chapter of Plutarch’s Isis and Osiris. Plutarch there says that «the happiness of even the eternal life, which God has obtained as his portion, consists in the fact that the things that come to be do not, through knowledge, fail in advance» (351E. This obscure phrase implies, so I argue, that Plutarch’s providential God has a knowledge of particular contingencies and that this knowledge indeed contributes to his eternal blessedness without affecting His essence.
Directory of Open Access Journals (Sweden)
Nakamoto K
2018-02-01
Full Text Available Kenji Nakamoto,1 Masahiko Takeshi,2 Toshihiko Hiraoka,2,3 Mayuko Eguchi,2,4 Yuichiro Nakano,1,2 Naomi Otsuka,5 Hiroko Hizaki,5 Hiromi Akai,5 Masayo Hashimoto5 1Department of Ophthalmology, Nippon Medical School, Tokyo, Japan; 2Shinanozaka Clinic, Tokyo, Japan; 3Hiraoka Eye Clinic, Saitama, Japan; 4Musashiurawa Eye Clinic, Saitama, Japan; 5Japan Medical Affairs, Global R&D, Santen Pharmaceutical Co., Ltd., Osaka, Japan Objective: The aim of this study was to evaluate the 24-hour intraocular pressure (IOP-control effect of the tafluprost/timolol fixed combination (TAF/TIM-FC in patients with primary open-angle glaucoma after they switched from the concomitant use of tafluprost and timolol gel-forming solution. Patients and methods: Twenty patients with primary open-angle glaucoma (12 male and 8 female; mean ± SD age, 57.0±7.1 years were included in this study. The patients were treated for 8 weeks with the concomitant administration of tafluprost and timolol gel-forming solution (evening dosing. At the end of this period, the patients underwent 24-hour IOP monitoring (measured at 21:00, 01:00, 05:00, 09:00, 13:00 and 17:00. IOP was measured with Goldmann applanation tonometer (GAT and Icare PRO at sitting position at all timepoints and additionally, at supine position with Icare PRO tonometer at 01:00 and 05:00. The patients were then all switched to TAF/TIM-FC treatment (evening dosing. After 8 weeks, the 24-hour IOP monitoring was repeated. Results: Nineteen patients completed the study. The mean 24-hour IOPs in the concomitant and TAF/TIM-FC phases were 13.8±2.7 vs 13.3±2.8 mmHg (P=0.0033 with the GAT in the sitting position and 13.96±2.56 vs 13.48±2.56 mmHg (P=0.0120 with the Icare PRO in habitual positions. In comparison with the concomitant phase, significantly lower IOP was observed for the TAF/TIM-FC phase at 21:00 and 01:00 with the GAT and at 01:00 with the Icare PRO. In addition, the maximum IOP and fluctuations in IOP in
DEFF Research Database (Denmark)
Hansen, Annette Skovsted
Human Resource Development was the first and remains an important pillar in Japanese foreign aid. I will argue that Japan has access to a global network of alumni who will co-define Japanese foreign aid in the future, because Japan has encouraged alumni societies and networking since 1965. A total...... of more than a million people in more than 100 countries have attended courses in Japan funded fully or partly by Japanese ODA since the inception of the technical assistance programs in 1954 through the Colombo Plan and since 1959 through the Association of Overseas Technical Scholarships (AOTS from 2009...... HIDA). Many of these alumni have and will in the future exchange ideas and keep contact not only to Japan, but also to fellow alumni around the globe and, thereby, practice south-south exchanges, which are made possible and traceable by their established alumni network and the World Network of Friends...
IRBA SERIES : Accounting In Japan
Arai, Kiyomitsu
1994-01-01
Preface / Legal and Conceptual Framework of Accounting in Japan / Setting Accounting Standards in Japan - The American Influence and The Present Status / Accounting Education and Profession in Japan / The International Harmonization of Accounting Standards / The Accounting Standard Setting in Japan and Its Responses to International Accounting Standards / Selected Bibliography for Accounting in Japan
2010-04-01
... Export Price, Constructed Export Price, Fair Value, and Normal Value § 351.402 Calculation of export... (date of final determination of sales at less than fair value). (3) Presumption. The Secretary may...) Introduction. In order to establish export price, constructed export price, and normal value, the Secretary...
Umemura, Maki
2010-01-01
Unlike its automobile or electronics industries, Japan's pharmaceutical industry did not become a global leader. Japan remains a net importer of pharmaceuticals and has introduced few global blockbuster drugs. Alfred Chandler argued that Japan's pharmaceutical firms remained relatively weak because Western firms enjoyed an insurmountable first first-mover advantage. However, this case study of the anticancer drug sector illustrates that Chandler's explanation is incomplete. Japanese medical culture, government policy, and research environment also played a substantial role in shaping the industry. In the 1970s and 1980s, these factors encouraged firms to develop little few effective drugs with low side effects, and profit from Japan's domestic market. But, these drugs were unsuitable to foreign markets with more demanding efficacy standards. As a result, Japan not only lost more than a decade in developing ineffective drugs, but also neglected to create the infrastructure necessary to develop innovative drugs and build a stronger pharmaceutical industry.
Stimulation of DNA synthesis by 340nm/ 351nm UV laser irradiation
International Nuclear Information System (INIS)
Meldrum, R.A.; Wharton, C.W.
1991-01-01
During preliminary experiments designed to test the feasibility of using a 'caged' DNA break trapping agent, the authors observed a stimulation of incorporation of 3 H-thymidine into DNA when cells were irradiated with low doses (100-1000J/m 2 ) of 351nm UV laser irradiation. This wavelength is used to photolyse 'caged' dideoxynucleotides in our fast time course measurements of DNA repair in mammalian cells. The dose at which this stimulation was observed is well below that at which measurable damage is detected. (author)
International development of Japan's Nuclear Industry. Indispensable Japan-U.S. cooperation
International Nuclear Information System (INIS)
Saigo, Masao
2006-01-01
It is significant to internationally develop the nuclear power plants technology that has been fostered by Japan's nuclear industry. It is also important to work with taking the degree of development of nuclear power plants of the recipient country into consideration. ''Forum on International Development of Nuclear Industry'' organized by the Japan Atomic Industrial Forum, Inc. (JAIF) proposed it would be indispensable for a Japan's nuclear industry to establish a Japan-U.S. Cooperation with the support of Government in order to develop the nuclear technology internationally. In November 2005, the investigating team including utilities and nuclear industry visited U.S. and exchanged opinions on its possibility. Investigating results and their evaluation were described. (T.Tanaka)
31 CFR 351.60 - How are book-entry Series EE savings bonds purchased and held?
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false How are book-entry Series EE savings... OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.60 How are book-entry Series EE savings bonds purchased and held? Book-entry bonds must be purchased and held online...
31 CFR 351.69 - When is a book-entry Series EE savings bond validly issued?
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false When is a book-entry Series EE... OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.69 When is a book-entry Series EE savings bond validly issued? A book-entry bond is validly issued when it is posted...
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Japan wax. 186.1555 Section 186.1555 Food and Drugs... Substances Affirmed as GRAS § 186.1555 Japan wax. (a) Japan wax (CAS Reg. No. 8001-39-6), also known as Japan... fruits of the oriental sumac, Rhus succedanea (Japan, Taiwan, and Indo-China), R. vernicifera (Japan...
The effect of welding parameters on the corrosion behaviour of friction stir welded AA2024-T351
DEFF Research Database (Denmark)
Jariyaboon, M; Davenport, A.J.; Ambat, Rajan
2007-01-01
The effect of welding parameters (rotation speed and travel speed) on the corrosion behaviour of friction stir welds in the high strength aluminium alloy AA2024-T351 was investigated. It was found that rotation speed plays a major role in controlling the location of corrosion attack. Localised...... intergranular attack was observed in the nugget region for low rotation speed welds, whereas for higher rotation speed welds, attack occurred predominantly in the heat-affected zone. The increase in anodic reactivity in the weld zone was due to the sensitisation of the grain boundaries leading to intergranular...... attack. Enhancement of cathodic reactivity was also found in the nugget as a result of the precipitation of S-phase. The results were compared with samples of AA2024-T351 that had been heat treated to simulate the thermal cycle associated with welding, and with samples that had been exposed to high...
Directory of Open Access Journals (Sweden)
Nagata Satoko
2012-08-01
Full Text Available Abstract Background In response to the rapid aging of the population in Japan, many care systems have been created in quick succession. Establishment of discharge planning departments (DPDs in hospitals is one of them. In this study, we compared the distribution and characteristics of DPDs and the characteristics of the hospitals that have DPDs between 2001 and 2010 in Japan. Methods We mailed a questionnaire about the characteristics of hospitals and existence and situation of DPDs to all general hospitals with 100 or more general beds in 2001 and in 2010. Results In 2001, of the 3,268 hospitals queried, 1,568 (48.0% responded and 1,357 (41.5% were selected for data analysis. In 2010, among 2,600 hospitals, 940 hospitals (36.1% responded and 913 (35.1% met the inclusion criteria. The percentage of hospitals with DPDs increased from 30% to more than 70% between the two surveys. More departments were under the direct control of the hospital director and more physicians participated in discharge planning activities in 2010 than in 2001. In 2001, private hospitals and hospitals with an affiliated institution or agency tended to have a DPD; however, the relationship between these factors and the presence of a DPD had disappeared in 2010. Larger hospitals and hospitals with more nurses per patient tended to have a DPD both in 2001 and 2010. Conclusions Since 2008, the establishment of a DPD has been directly connected to medical fees so hospital administrators might have recognized the DPD as a “necessary and paid for” department. Having a DPD was the majority’s policy in Japan, and we must recognize the importance of quality assurance through DPDs from now on, especially in small hospitals.
Directory of Open Access Journals (Sweden)
Veljić Darko
2016-01-01
Full Text Available Temperature, plastic strain and heat generation during the plunge stage of the friction stir welding (FSW of high-strength aluminium alloys 2024 T3 and 2024 T351 are considered in this work. The plunging of the tool into the material is done at different rotating speeds. A three-dimensional finite element (FE model for thermomechanical simulation is developed. It is based on arbitrary Lagrangian-Eulerian formulation, and Johnson-Cook material law is used for modelling of material behaviour. From comparison of the numerical results for alloys 2024 T3 and 2024 T351, it can be seen that the former has more intensive heat generation from the plastic deformation, due to its higher strength. Friction heat generation is only slightly different for the two alloys. Therefore, temperatures in the working plate are higher in the alloy 2024 T3 for the same parameters of the plunge stage. Equivalent plastic strain is higher for 2024 T351 alloy, and the highest values are determined under the tool shoulder and around the tool pin. For the alloy 2024 T3, equivalent plastic strain is the highest in the influence zone of the tool pin. [Projekat Ministarstva nauke Republike Srbije, br. TR 34016 i br. TR 35006
International Nuclear Information System (INIS)
Van Kooij, E.
1998-01-01
An overview is given of the technical know-how and expertise in Japan with respect to the supply, transport, storage and use of LNG. First the overall energy supply in Japan is outlined. Next, the reasons for the use of LNG as an energy source in Japan are discussed. As an example of a typical LNG-installation in Japan the construction of the Himeji Terminal of Osaka Gas Company is described. Finally, attention is paid to the world's largest and modern below-surface LNG-tanks (capacity of 200,000 m 3 ), installed at the Negishi Terminal of Tokyo Gas Company
31 CFR 351.66 - What book-entry Series EE savings bonds are included in the computation?
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What book-entry Series EE savings... DEBT OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.66 What book-entry Series EE savings bonds are included in the computation? (a) We include all bonds that...
Barbarian medicine in feudal Japan.
Fodstad, Harald; Hariz, Marwan I; Hirabayashi, Hidehiro; Ohye, Chihiro
2002-10-01
THE FIRST EUROPEANS to discover Japan were Portuguese traders who arrived in 1542. Fifteen years later, the Portuguese Jesuit priest and surgeon Luis De Almeida (1525-1583) founded the first Western hospital in Japan, for the care of lepers, syphilitics, and orphans. Because the hospital had a negative influence on the spread of Christianity, the Jesuits closed it in 1586. During the Tokugawa Shogunate (1600-1868), when Japan was secluded from the rest of the world, the only foreign physicians allowed to enter Japan were those employed by the Dutch factory at Dejima in Nagasaki. Only four of those physicians left behind seeds for the foundation of Western medicine in Japan, namely Caspar Schambergen, who founded a Japanese school of surgery in 1650; Engelbert Kämpfer, who visited Japan in 1691 to 1692; Carl Peter Thunberg, who botanically explored Japan in 1775 to 1776; and Philipp Franz Balthasar von Siebold, who practiced medicine in Nagasaki in 1823 to 1829 and 1859 to 1861. On the whole, Western medicine and surgery never established a real foothold in Japan until the fall of the shogunate and the restoration of the emperor in 1868.
Uvrag targeting by Mir125a and Mir351 modulates autophagy associated with Ewsr1 deficiency.
Kim, Yunha; Kang, Young-Sook; Lee, Na-Young; Kim, Ki Yoon; Hwang, Yu Jin; Kim, Hyun-Wook; Rhyu, Im Joo; Her, Song; Jung, Min-Kyung; Kim, Sun; Lee, Chai-Jin; Ko, Seyoon; Kowall, Neil W; Lee, Sean Bong; Lee, Junghee; Ryu, Hoon
2015-01-01
The EWSR1 (EWS RNA-binding protein 1/Ewing Sarcoma Break Point Region 1) gene encodes a RNA/DNA binding protein that is ubiquitously expressed and involved in various cellular processes. EWSR1 deficiency leads to impairment of development and accelerated senescence but the mechanism is not known. Herein, we found that EWSR1 modulates the Uvrag (UV radiation resistance associated) gene at the post-transcription level. Interestingly, EWSR1 deficiency led to the activation of the DROSHA-mediated microprocessor complex and increased the level of Mir125a and Mir351, which directly target Uvrag. Moreover, the Mir125a- and Mir351-mediated reduction of Uvrag was associated with the inhibition of autophagy that was confirmed in ewsr1 knockout (KO) MEFs and ewsr1 KO mice. Taken together, our data indicate that EWSR1 is involved in the post-transcriptional regulation of Uvrag via a miRNA-dependent pathway, resulting in the deregulation of autophagy inhibition. The mechanism of Uvrag and autophagy regulation by EWSR1 provides new insights into the role of EWSR1 deficiency-related cellular dysfunction.
Energy Technology Data Exchange (ETDEWEB)
EN YO,H.; SAITO,N.; SHIBATA,T.A.; YAZAKI,K.; BUNCE,G.
2002-03-29
The RIKEN School on ''Quark-Gluon Structure of the Nucleon and QCD'' was held from March 29th through 31st at the Nishina Memorial Hall of RIKEN, Wako, Saitama, Japan, sponsored by RIKEN (the Institute of Physical and Chemical Research). The school was the second of a new series with a broad perspective of hadron and nuclear physics. The purpose of the school was to offer young researchers an opportunity to learn theoretical aspects of hadron physics based on QCD and related experimental programs being or to be carried out by Japanese groups. We had 3 theoretical courses, each consisting of 3 one-hour lectures, and 6 experimental courses, each consisting of a one-hour lecture.
Acute pyogenic discitis in a degenerative intervertebral disc in an adult
Directory of Open Access Journals (Sweden)
Masamitsu Tanaka
2010-08-01
Full Text Available Masamitsu Tanaka1,2, Hiroshi Shimizu2, Yoshiyuki Yato1, Takashi Asazuma1, Koichi Nemoto11Department of Orthopedic Surgery, National Defense Medical College, Tokorozawa, Saitama; 2Department of Orthopedic Surgery, Self Defense Force Fukuoka Hospital, Kasuga, Fukuoka, JapanAbstract: A 35-year-old male who had been receiving conservative treatment for L4 isthmic spondylolisthesis suffered from pyogenic spondylodiscitis in the degenerative L4/L5 intervertebral disc space, which could be identified by comparison with previous images. Symptoms improved with conservative antibiotic treatment. Neovascularization may occur in the annulus fibrosus of a degenerative intervertebral disc, which may increase the risk of hematogenous infection, leading to “discitis” even in adults.Keywords: spondylodiscitis, spondylitis, discitis, isthmic spondylolisthesis, spondylolysis, intervertebral disc degeneration
Japan and the global environment
International Nuclear Information System (INIS)
Miller, A.S.; Moore, C.
1993-01-01
In many areas, the word most often used to describe Japanese policy is open-quotes enigma.close quotes In some ways, Japan's record on environmental policy also has elements of mystery and contradiction. On the one hand, Japan's history and culture often are associated with a reverence for nature. Indeed, Japan does lead the world in certain environmental areas, such as reduction of conventional air pollutants and compensation of air pollution victims. On the other hand, Japan has been widely criticized for its poor record in preserving its domestic environment, contribution to tropical deforestation, and unwillingness to protect endangered species. Today, the international community clamors for Japan to take its share of responsibility, as an economic superpower, for the global environment. To secure its place in world affairs, Japan slowly has begun to respond to this pressure on issues ranging from ivory importation to reduction of CFC emissions. There is some hope that the government's particular willingness to address global warming may be a sign of significant changes to come in Japanese environmental policy. However, international pressure remains on the many environmental issues Japan has yet to resolve, including tropical deforestation and financing of Third World development projects that harm the environment. Japan's environmental policy is most effective when government and industry cooperate to find technical solutions to environmental problems. Although in recent years Japan's energy consumption has risen sharply, the Japanese have developed numerous technologies to reduce pollution and increase economic growth by improving energy efficiency. It is in these technologies that Japan has made the greatest strides and has the most to offer the global environment
Japan`s civil use of foreign military plutonium
Energy Technology Data Exchange (ETDEWEB)
Suzuki, A. [Tokyo Univ. (Japan). Dept. of Quantum Engineering and Systems Sciences
1995-12-31
This paper is intended to propose one of the MOX options of international cooperation for safer and more secured management of excess military plutonium. The proposal was made with special reference to the Japanese public`s view. Owing to the domestic plutonium shortage anticipated soon after the 200 in Japan, some specific reactors will be available to get rid of foreign excess weapon plutonium. According to the Japan AEC`s new long-term programme, the shortage will be approximately 0.5 tonne of plutonium per annum, which is a sort of the least amount that Japan can buy from a certain external source. With international requests for a more positive Japanese contribution, however, the amount of Japanese purchase would be increased. It follows from the preliminary estimate shown in this paper that roughly 2 tonnes of plutonium can be burned annually in the reactors without any major modifications concerning safe reactor operation. (author) 10 refs.
Nuclear power development in Japan
International Nuclear Information System (INIS)
Sugawara, A.
1994-01-01
Energy situation in Japan and Japan's strategy for stable supply of energy are discussed. Benefits of nuclear power in comparison with other energy sources is considered. History of nuclear power development in Japan, modern status and future trends are described. 6 figs
IODP Expedition 351 Izu-Bonin-Mariana Arc Origins: Preliminary Results
Ishizuka, O.; Arculus, R. J.; Bogus, K.
2014-12-01
Understanding how subduction zones initiate and continental crust forms in intraoceanic arcs requires knowledge of the inception and evolution of a representative intraoceanic arc, such as the Izu-Bonin-Mariana (IBM) Arc system. This can be obtained by exploring regions adjacent to an arc, where unequivocal pre-arc crust overlain by undisturbed arc-derived materials exists. IODP Exp. 351 (June-July 2014) specifically targeted evidence for the earliest evolution of the IBM system following inception. Site U1438 (4711 m water depth) is located in the Amami Sankaku Basin (ASB), west of the Kyushu-Palau Ridge (KPR), a paleo-IBM arc. Primary objectives of Exp. 351 were: 1) determine the nature of the crust and mantle pre-existing the IBM arc; 2) identify and model the process of subduction initiation and initial arc crust formation; 3) determine the compositional evolution of the IBM arc during the Paleogene; 4) establish geophysical properties of the ASB. Seismic reflection profiles indicate a ~1.3 km thick sediment layer overlying ~5.5 km thick igneous crust, presumed to be oceanic. This igneous crust seemed likely to be the basement of the IBM arc. Four holes were cored at Site U1438 spanning the entire sediment section and into basement. The cored interval comprises 5 units: uppermost Unit I is hemipelagic sediment with intercalated ash layers, presumably recording explosive volcanism mainly from the Ryukyu and Kyushu arcs; Units II and III host a series of volcaniclastic gravity-flow deposits, likely recording the magmatic history of the IBM Arc from arc initiation until 25 Ma; Siliceous pelagic sediment (Unit IV) underlies these deposits with minimal coarse-grained sediment input and may pre-date arc initiation. Sediment-basement contact occurs at 1461 mbsf. A basaltic lava flow section dominantly composed of plagioclase and clinopyroxene with rare chilled margins continues to the bottom of the Site (1611 mbsf). The expedition successfully recovered pre-IBM Arc
Karube, Norio
1991-03-01
I am to report on some aspects of industrial lasers in Japan. Mostly centering on the market. In Japan, the history of laser developnent is rather profound. And long. Ever since the first invention of the laser in this country in 1960. This is partly because of the fact that in Japan the spectroscopic studies of the ruby was very popular in the late 1950's. Ever since niost of the work has been done in the research laboratories of the industry, not in the universities or not in the governmental laboratories. And since that time our first activity was mainly centering on the basic research, but after that time we have the evolution of the technology. One of the features in Japan is that the activity of developement and research of laser technology from the very basic phase up to the present commercialization has been done by the same group of people, including ine. We had a national project which ended about six years ago which was sponsored by MITI. MITI is Ministry of International Trade and Industry in Japan. And because of this national project, the effect of this project had a very enlightening effect in Japan. And after that our Japanese laser market became very flourishing.
Institutionalisation of Japan Identity Construction Policy
Directory of Open Access Journals (Sweden)
Zadvornaya Elena S.
2016-09-01
Full Text Available The article is devoted to the development of the modern politics of identity construction in Japan, which actively refers to the practice of designing self-image in international relations. This trend dates back to the 19th century, when there was the end of Sakoku (Japan’s policy of isolation. It is now possible to talk about the institutionalization of the identity construction policy to organized structures and regulations. Enhanced efforts in the field of Japanese traditional and popular culture, education and creative content has led to a number of institutions appearance (like Japan Foundation Fund, Japan Creative Agency, Japan Culture Fund, Agency for Cultural Affairs, Cool Japan Fund, Japan brand Fund and changing idea about the role of culture in foreign policy realization (it is fixed the documents of the Japanese Ministry of Foreign Affairs, the Ministry of Land, Infrastructure, Transport and Tourism, the Ministry of Education, Culture, Sports, Science and Technology, the Ministry of Economy, Trade and Industry, as well as a number of projects (Cool Japan, Visit Japan, Japan Culture Power, Japan Manga Awards, Kawaii Ambassadors, Cosplay International Fest and etc.. These efforts are aimed at forming Japan identity abroad to solve a number of foreign policy challenges of the future and the development of economic cooperation. The Japanese government nearest plans is to increase funding in order to create a positive image of Japan in the region of East Asia. All of these allows us to speak about the policy of the Japanese construction of identity as an institutionalized process in which there was clearance of organizations and regulatory activities.
International Nuclear Information System (INIS)
Anon.
1993-01-01
About 20 million metric tonnes of Liquefied Petroleum Gases (LPG) are consumed each year in Japan, of which 14,5 million metric tonnes are imported from Saudi Arabia and United Arab Emirates. This paper presents LPG industry in Japan and gives informations on the present status: supply and demand, imports, market, distribution
29 CFR 35.1 - What is the purpose of the Department of Labor (DOL) age discrimination regulations?
2010-07-01
... BASIS OF AGE IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE FROM THE DEPARTMENT OF LABOR General § 35.1 What is the purpose of the Department of Labor (DOL) age discrimination regulations... 29 Labor 1 2010-07-01 2010-07-01 true What is the purpose of the Department of Labor (DOL) age...
International Nuclear Information System (INIS)
Saito, H.; Hayashi, Y.; Abe, T.; Kanaya, T.; Suzuki, K.
2005-01-01
Full text: Garden verbenas (Verbena hybrida) belonging to the Verbenaceae family are originated from interspecific hybridization among several species, many cultivars frequently produce seeds. Recently, a sterile mutant has been isolated in the verbena cultivar 'Coral Pink' of Temari series (Suntory Flowers Ltd., Tokyo, Japan) by mutation induction using heavy-ion beams at RIKEN Accelarator Research Facility (RARF, Saitama, Japan). We investigated pollen and ovule fertility assessed by acetocarmin staining, seed-set following controlled-pollination tests and behavior of pollen tubes in pistils with the sterile mutant of 'Coral Pink' (SC) and its original fertile one (FC). As the results, although SC has functional male and female gametes, few self-pollinated flowers carry out seed-set, leading to sterile phenotype. Additionally, the sterile mechanism of SC was compared with the wild species V. peruviana (VP) which is one of origin of Temari series and exhibits sterility. Interestingly, similar phenotype was observed in PV. We further investigated, therefore, whether there are differences on self-incompatible reaction between SC and VP. (author)
Energy Technology Data Exchange (ETDEWEB)
Saito, H; Hayashi, Y; Abe, T [RIKEN, Wako (Japan); Kanaya, T; Suzuki, K [Suntory Flowers Ltd., Higashiomi (Japan)
2005-07-01
Full text: Garden verbenas (Verbena hybrida) belonging to the Verbenaceae family are originated from interspecific hybridization among several species, many cultivars frequently produce seeds. Recently, a sterile mutant has been isolated in the verbena cultivar 'Coral Pink' of Temari series (Suntory Flowers Ltd., Tokyo, Japan) by mutation induction using heavy-ion beams at RIKEN Accelarator Research Facility (RARF, Saitama, Japan). We investigated pollen and ovule fertility assessed by acetocarmin staining, seed-set following controlled-pollination tests and behavior of pollen tubes in pistils with the sterile mutant of 'Coral Pink' (SC) and its original fertile one (FC). As the results, although SC has functional male and female gametes, few self-pollinated flowers carry out seed-set, leading to sterile phenotype. Additionally, the sterile mechanism of SC was compared with the wild species V. peruviana (VP) which is one of origin of Temari series and exhibits sterility. Interestingly, similar phenotype was observed in PV. We further investigated, therefore, whether there are differences on self-incompatible reaction between SC and VP. (author)
International Nuclear Information System (INIS)
EN'YO, H.; HAMAGAKI, H.; HATSUDAT WATANABA, Y.; YAZAKI, K.
2004-01-01
The RIKEN-TODAI Mini-Workshop on ''Topics in Hadron Physics at RHIC'' was held on March 23rd and 24th, 2064 at the Nishina Memorial Hall of RIKEN, Wako, Saitama, Japan, sponsored by RIKEN (Institute of Physical and Chemical Research) and TODAI (University of Tokyo). The workshop was planned when we learned that two distinguished theorists in hadron physics, Professors L. McLerran and S.H. Lee, would be visiting TODAI and/or RIKEN during the week of March 22-26. We asked them to give key talks at the beginning of the workshop and attend the sessions consisting of talks by young theorists in RIKEN, TODAI and other institutes in Japan and they kindly agreed on both. Considering the JPS meeting scheduled from March 27 through 30, we decided to have a.one-and-half-a-day workshop on March 23 and 24. The purpose of the workshop was to offer young researchers an opportunity to learn the forefront of hadron physics as well as to discuss their own works with the distinguished theorists
Quasar 3C351: VLA maps and a deep search for optical emission in the outer lobes
International Nuclear Information System (INIS)
Kronberg, P.P.; Clarke, J.N.; van den Bergh, S.
1980-01-01
VLA radio maps of the quasar 3C351 (z=0.371) at approx.2'' and 0.''4 resolution (a) show interaction with a relatively dense intergalactic medium, (b) show that there is electron acceleration within at least one of the radio lobes, and (c) imply that the intergalactic gas density is different on one side of the source than on the other. Striking similarities are found between the northern radio lobe of 3C351 and one of the outer hotspots of Cygnus A, and possibly other similar systems, in that the outer, on-axis hotspot is resolved and cusp-shaped, and the ''secondary'' off-axis hotspot is more compact. A search for optical emission in the outer lobes shows no emission stronger than 22/sup m/ in the J band and approx.21/sup m/ in the F band. There is also no evidence at these limits for a cluster of galaxies near the radio source, as is suggested by our conclusion that it is interacting with a medium of typical intracluster density
International Nuclear Information System (INIS)
Guillemard, B.
1978-01-01
After having described the nuclear partners in Japan, the author analyzes the main aspects of Japan's nuclear energy: nuclear power plants construction program; developping of light water reactors; fuel cycle politics [fr
DEFF Research Database (Denmark)
Roesgaard, Marie Højlund
2014-01-01
Abstract for Nichibunken Copenhagen Symposium August 2012 Globalization in Japan – the case of moral education. 日本とグローバル化 - 道徳教育の件 Marie H. Roesgaard, Department of Cross-Cultural and Regional Studies, University of Copenhagen. This paper attempts to trace the history of global influence on Japan......Abstract for Nichibunken Copenhagen Symposium August 2012 Globalization in Japan – the case of moral education. 日本とグローバル化 - 道徳教育の件 Marie H. Roesgaard, Department of Cross-Cultural and Regional Studies, University of Copenhagen. This paper attempts to trace the history of global influence...... adjusting to those of the global currents that cannot be ignored. Further, I would suggest that global, or at least Western, influence is not a new thing in regard to moral education in Japan. The paper will provide an historical overview of the development of moral education since Meiji times and focus...
Boulton, William R.
1995-02-01
The purpose of this JTEC study is to evaluate Japan's electronic manufacturing and packaging capabilities within the context of global economic competition. To carry out this study, the JTEC panel evaluated the framework of the Japanese consumer electronics industry and various technological and organizational factors that are likely to determine who will win and lose in the marketplace. This study begins with a brief overview of the electronics industry, especially as it operates in Japan today. Succeeding chapters examine the electronics infrastructure in Japan and take an in-depth look at the central issues of product development in order to identify those parameters that will determine future directions for electronic packaging technologies.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Is a Self-Governance Tribe required to submit..., DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Roles of Self-Governance Tribe in Establishing and Implementing Construction Project Agreements § 137.351 Is a Self-Governance Tribe required to...
Energy Technology Data Exchange (ETDEWEB)
Murase, K. [Kobe Steel Ltd., Tokyo (Japan)
2004-07-01
The international and Japan's steel industry, the coking coal market, and Japan's expectations from Canada's coal industry are discussed. Japan's steel mills are operating at full capacity. Crude steel production for the first half of 2004 was 55.8 million tons. The steel mills are profitable, but costs are high, and there are difficulties with procuring raw materials. Japan is trying to enhance the quality of coke, in order to achieve higher productivity in the production of pig iron. Economic growth is rising disproportionately in the BRICs (Brazil, Russia, India, and China), with a large increase in coking coal demand from China. On the supply side, there are several projects underway in Australia and Canada to increase production. These include new developments by Elk Valley Coal Corporation, Grande Cache Coal, Western Canadian Coal, and Northern Energy and Mining in Canada. The Elga Mine in the far eastern part of Russia is under development. But the market is expected to remain tight for some time. Japan envisions Canadian coal producers will provide a stable coal supply, expansion of production and infrastructure capabilities, and stabilization of price. 16 slides/overheads are included.
2010-04-01
... Price, Constructed Export Price, Fair Value, and Normal Value § 351.412 Levels of trade; adjustment for.... The Secretary is authorized to adjust normal value to account for such a difference. (See section 773... value for a difference in level of trade if: (1) The Secretary calculates normal value at a different...
[Building epilepsy care network in Japan].
Otsuki, Taisuke
2012-01-01
Number of epilepsy patient in Japan officially surveyed by our government in 2008 is 219,000, which is only 0.17% of the total population and less than one third of the prevalence rate reported in Western countries. Number of epilepsy surgery per year in Japan is also low and less than half of other countries such as US, UK and Korea. These numbers may suggest that epilepsy care in Japan is not sufficient to cover all hidden medical needs of people with epilepsy at present. To solve this issue, our research group funded by the government have started to build an epilepsy care network among primary care physicians, secondary care neurology specialists and tertiary care epilepsy centers by utilizing a web site: Epilepsy Care Network-Japan (http://www.ecn-japan.com/) from July 2012. We are also proposing an epilepsy care algorithm suitable for our complex medical community consisted with various neurology specialists such as pediatric and adult neurologists, neurosurgeons and psychiatrists. Building Epilepsy Care Network in Japan may facilitate better medical and social support for people with epilepsy in Japan.
Positioning Indian Emigration to Japan
DEFF Research Database (Denmark)
D'Costa, Anthony
2013-01-01
as other IT-strong developing countries, are to supply technical talent, whose availability in Japan is constrained by the secular demographic crisis and changing educational and occupational preferences. The challenges for India are the institutional barriers, in particular, Japanese business practices...... that act as significant barriers to the entry of foreign skilled professionals. The paper brings out the source and pattern of foreign professionals and students in Japan as a proxy for talent. Though India’s presence in Japan is currently limited, its share of technical professionals to the total number....... For Japan, it means access to technical professionals and managed interfacing with the global economy....
2013-12-26
... DEPARTMENT OF COMMERCE International Trade Administration Japan-U.S. Decommissioning and Remediation Fukushima Recovery Forum Tokyo, Japan February 18-19, 2014 AGENCY: International Trade... Japan-United States Decommissioning and Remediation Fukushima Recovery Forum (``Fukushima Recovery Forum...
Directory of Open Access Journals (Sweden)
Ochiai Hirotaka
2010-08-01
Full Text Available Abstract Background Although the correlation coefficient between body mass index (BMI and percent body fat (%BF or waist circumference (WC has been reported, studies conducted among population-based schoolchildren to date have been limited in Japan, where %BF and WC are not usually measured in annual health examinations at elementary schools or junior high schools. The aim of the present study was to investigate the relationship of BMI to %BF and WC and to examine the influence of gender and obesity on these relationships among Japanese schoolchildren. Methods Subjects included 3,750 schoolchildren from the fourth and seventh grade in Ina-town, Saitama Prefecture, Japan between 2004 and 2008. Information about subject's age, sex, height, weight, %BF, and WC was collected from annual physical examinations. %BF was measured with a bipedal biometrical impedance analysis device. Obesity was defined by the following two criteria: the obese definition of the Centers for Disease Control and Prevention, and the definition of obesity for Japanese children. Pearson's correlation coefficients between BMI and %BF or WC were calculated separately for sex. Results Among fourth graders, the correlation coefficients between BMI and %BF were 0.74 for boys and 0.97 for girls, whereas those between BMI and WC were 0.94 for boys and 0.90 for girls. Similar results were observed in the analysis of seventh graders. The correlation coefficient between BMI and %BF varied by physique (obese or non-obese, with weaker correlations among the obese regardless of the definition of obesity; most correlation coefficients among obese boys were less than 0.5, whereas most correlations among obese girls were more than 0.7. On the other hand, the correlation coefficients between BMI and WC were more than 0.8 among boys and almost all coefficients were more than 0.7 among girls, regardless of physique. Conclusions BMI was positively correlated with %BF and WC among Japanese
International Nuclear Information System (INIS)
Richner, S.
1984-01-01
A summary of nuclear energy in Japan is presented. Nuclear energy provides 17% of Japan's electricity but could provide much more. 25 more reactors (to add to the existing 27) are planned by 1995. The cooperation between Japanese government and industry and the economic assistance in building new plants means that these are not likely to be cancelled. Public acceptance of new plants has often been obtained by large cash employment inducements. Now, however, there is growing disillusionment when short-term well paid employment building the reactors is followed by unemployment when the reactor is in operation. Also there is a growing opposition to the storage of the nuclear waste. To maintain the growth of its nuclear industry Japan needs to export to provide a steady flow of big orders. (U.K.)
19 CFR 351.406 - Calculation of normal value if sales are made at less than cost of production.
2010-04-01
... Price, Fair Value, and Normal Value § 351.406 Calculation of normal value if sales are made at less than cost of production. (a) Introduction. In determining normal value, the Secretary may disregard sales of... 19 Customs Duties 3 2010-04-01 2010-04-01 false Calculation of normal value if sales are made at...
Laser-Induced Damage Growth on Larger-Aperture Fused Silica Optical Components at 351 nm
International Nuclear Information System (INIS)
Wan-Qing, Huang; Wei, Han; Fang, Wang; Yong, Xiang; Fu-Quan, Li; Bin, Feng; Feng, Jing; Xiao-Feng, Wei; Wan-Guo, Zheng; Xiao-Min, Zhang
2009-01-01
Laser-induced damage is a key lifetime limiter for optics in high-power laser facility. Damage initiation and growth under 351 nm high-fluence laser irradiation are observed on larger-aperture fused silica optics. The input surface of one fused silica component is damaged most severely and an explanation is presented. Obscurations and the area of a scratch on it are found to grow exponentially with the shot number. The area of damage site grows linearly. Micrographs of damage sites support the micro-explosion damage model which could be used to qualitatively explain the phenomena
Type B investigation of electrical fault in 351 Substation, December 4, 1994
International Nuclear Information System (INIS)
Debban, H.L.; Shearer, C.A.; Boger, R.M.; McDonald, G.P.; Eyre, L.E.; Dell, L.D.; Kelly, D.S.
1995-02-01
On December 4, 1994, at 2132:10 hours, an electrical failure of a cable-tapping splice resulted in a fire in the 300 Area of the DOE Hanford Site. The fire occurred in the yard of Substation 351 in electrical Vault R122V, where the cable-tapping splice was located. The fire incinerated all cables passing to and through the vault causing them to fail. The failure of the cables resulted in a power outage to twenty customers in the 300 Area. The vault was electrically isolated, and power was restored to the electrical distribution system at 2311 hours. This report contains the accident scenario, accident analysis, direct cause and root and contributing causes
Type B investigation of electrical fault in 351 Substation, December 4, 1994
Energy Technology Data Exchange (ETDEWEB)
Debban, H.L.; Shearer, C.A.; Boger, R.M.; McDonald, G.P. [ICF Kaiser Hanford Co., Richland, WA (United States); Eyre, L.E.; Dell, L.D.; Kelly, D.S. [Westinghouse Hanford Co., Richland, WA (United States)
1995-02-01
On December 4, 1994, at 2132:10 hours, an electrical failure of a cable-tapping splice resulted in a fire in the 300 Area of the DOE Hanford Site. The fire occurred in the yard of Substation 351 in electrical Vault R122V, where the cable-tapping splice was located. The fire incinerated all cables passing to and through the vault causing them to fail. The failure of the cables resulted in a power outage to twenty customers in the 300 Area. The vault was electrically isolated, and power was restored to the electrical distribution system at 2311 hours. This report contains the accident scenario, accident analysis, direct cause and root and contributing causes.
Spent fuel management in Japan
International Nuclear Information System (INIS)
Shirahashi, K.; Maeda, M.; Nakai, T.
1996-01-01
Japan has scarce energy resources and depends on foreign resources for 84% of its energy needs. Therefore, Japan has made efforts to utilize nuclear power as a key energy source since mid-1950's. Today, the nuclear energy produced from 49 nuclear power plants is responsible for about 31% of Japan's total electricity supply. The cumulative amount of spent fuel generated as of March 1995 was about 11,600 Mg U. Japan's policy of spent fuel management is to reprocess spent nuclear fuel and recycle recovered plutonium and uranium as nuclear fuel. The Tokai reprocessing plant continues stable operation keeping the annual treatment capacity or around 90 Mg U. A commercial reprocessing plant is under construction at Rokkasho, northern part of Japan. Although FBR is the principal reactor to use plutonium, LWR will be a major power source for some time and recycling of the fuel in LWRs will be prompted. (author). 3 figs
Characteristics of Wet Deposition in Japan
Iwasaki, A.; Arakaki, T.
2017-12-01
Acid deposition survey in Japan has started since 1991 by Japan Environmental Laboratories Association (JELA). The JELA has about 60 monitoring sites for wet deposition including remote, rural and urban area. The measured constituents of wet deposition are; precipitation, pH, electric conductivity, major Anions, and major Cations. From those data, we analyze spatial and temporal variations of wet deposition components in Japan. Among the 60 monitoring sites, 39 sampling sites were selected in this study, which have kept sampling continuously between 2003JFY and 2014JFY. All samples were collected by wet-only samplers. To analyze area characteristics, all the areas were divided into 6 regions; Northern part of Japan (NJ), Facing the Japan Sea (JS), Eastern part of Japan (EJ), Central part of Japan (CJ), Western part of Japan (WJ) and Southern West Islands (SW). NO3- and non-sea-salt-SO42- (nss-SO42-) are major components of rain acidification. Especially, between December and February (winter) the air mass from west affected the temporal variations of those acid components and the concentrations were higher in JS and WJ regions than those in other regions. Japanese ministry of the Environment reported that mixing ratio of NO2 in Japan has been less than 0.04ppm since 1976, and that of SO2 has been less than 0.02ppm since 1978. Their concentrations in Japan have remained flat or slowly decreased recently. However the temporal variations of NO3-/nss-SO42- ratio in winter in JS region were significantly increased on average at 2.2% y-1 from 2003JFY to 2014JFY. The results suggest that long-range transboundary air pollutants increased NO3- concentrations and NO3-/nss-SO42- ratio.
Nuclear power development in Japan
International Nuclear Information System (INIS)
Sugawara, A.
1994-01-01
The energy situation in Japan is briefly outlined. Vulnerability in energy structure of the country is shown by a comparison of primary energy supply patterns of Japan and Western countries. Japan's energy policy consists in reducing dependence on oil, promoting efficient use of energy and increasing use of non-fossil fuels. Nuclear power is a core of alternative energy for petroleum because of stable supply of nuclear fuel, low detrimental emissions and less dependence on the fuel. A short historical review of nuclear power development in Japan is presented. Some future issues as development of entire nuclear fuel cycle, social acceptance, reactor safety and nuclear power economics are also discussed. 6 figs. (R.T.)
Watanabe, Tomoko; Kawai, Ryoko
2018-01-01
The latest version of the Standard Tables of Food Composition in Japan-2015- comprises the main food composition table (Standard Tables of Food Composition in Japan-2015-[Seventh revised Edition)) and three supplementary books. The supplementary books are Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Amino Acids -, Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Fatty Acids - and Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Available Carbohydrates, Polyols and Organic Acids-. We believe understanding these food composition tables can give greater insight into Japan's gastronomic culture and changes in eating habits. We expect them to play important roles as part of the East Asia food composition tables. Copyright © 2017. Published by Elsevier Ltd.
Japan's electronic packaging technologies
Tummala, Rao R.; Pecht, Michael
1995-02-01
The JTEC panel found Japan to have significant leadership over the United States in the strategic area of electronic packaging. Many technologies and products once considered the 'heart and soul' of U.S. industry have been lost over the past decades to Japan and other Asian countries. The loss of consumer electronics technologies and products is the most notable of these losses, because electronics is the United States' largest employment sector and is critical for growth businesses in consumer products, computers, automobiles, aerospace, and telecommunications. In the past there was a distinction between consumer and industrial product technologies. While Japan concentrated on the consumer market, the United States dominated the industrial sector. No such distinction is anticipated in the future; the consumer-oriented technologies Japan has dominated are expected to characterize both domains. The future of U.S. competitiveness will, therefore, depend on the ability of the United States to rebuild its technological capabilities in the area of portable electronic packaging.
Imanishi, Takashi; Kawabata, Takayoshi; Takayama, Akira
2017-01-01
In 2009, the Japan Anti-Doping Agency (JADA) established the "Sports Pharmacist Accreditation Program" to prevent doping in sports. Since then, anti-doping activities in Japan have been attracting attention. In this study, we investigated research about the current status of doping from 2007 to 2014 in Japan to make anti-doping activities more concrete, and we also discussed future anti-doping activities by pharmacists. In Japan, bodybuilding was the sporting event with the highest number and rate of doping from 2007 to 2014. Many of the positive doping cases were detected for class S1 (anabolic agents), S5 (diuretics and masking agents), and S6 (stimulants). Within class S1, supplements were the main cause of positive doping. Within class S5, medicines prescribed by medical doctors were the main cause of positive doping. Within class S6, non-prescription medicines (e.g., OTC) were the main cause of positive doping. When we looked at the global statistics on doping, many of the positive doping cases were detected for class S1. On comparing the Japanese statistics with the global statistics, the rate of positive doping caused by class S1 was significantly lower, but that caused by classes S5 and S6 was significantly higher in Japan than in the world. In conclusion, pharmacists in Japan should pay attention to class S1, S5, and S6 prohibited substances and to the sport events of bodybuilding. Based on this study, sports pharmacists as well as common pharmacists should suggest new anti-doping activities to prevent doping in the future.
2010-08-06
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-828, A-588-846] Hot-Rolled Flat..., Department of Commerce. SUMMARY: On April 1, 2010, the Department of Commerce (the Department) initiated... Department has conducted expedited (120-day) sunset reviews for both orders pursuant to 19 CFR 351.218(e)(1...
Sho, Ri; Narimatsu, Hiroto; Murakami, Masayasu
2013-10-01
Like health care systems in other developed countries, Japan's health care system faces significant challenges due to aging of the population and economic stagnation. Advanced medicine (Senshin Iryou) is a unique system of medical care in Japan offering highly technology-driven medical care that is not covered by public health insurance. Advanced medicine has recently developed and expanded as part of health care reform. Will it work? To answer this question, we briefly trace the historical development of advanced medicine and describe the characteristics and current state of advanced medical care in Japan. We then offer our opinions on the future of advanced medicine with careful consideration of its pros and cons. We believe that developing advanced medicine is an attempt to bring health care reform in line rather than the goal of health care reform.
Urban and spatial planning in Japan
Directory of Open Access Journals (Sweden)
Marin Tominaga
2011-12-01
Full Text Available This paper aims to introduce the urban and spatial planning inJapan. According to the national planning system of Japan, chapter 2, the planning system has 3 administrative levels and each territorial region has its own regulation. This paper introduces especially about planning and regulation system in city region in Japan.
On recycling of nuclear fuel in Japan
International Nuclear Information System (INIS)
1992-01-01
In Japan, atomic energy has become to accomplish the important role in energy supply. Recently the interest in the protection of global environment heightened, and the anxiety on oil supply has been felt due to the circumstances in Mideast. Therefore, the importance of atomic energy as an energy source for hereafter increased, and the future plan of nuclear fuel recycling in Japan must be promoted on such viewpoint. At present in Japan, the construction of nuclear fuel cycle facilities is in progress in Rokkasho, Aomori Prefecture. The prototype FBR 'Monju' started the general functional test in May, this year. The transport of the plutonium reprocessed in U.K. and France to Japan will be carried out in near future. This report presents the concrete measures of nuclear fuel recycling in Japan from the long term viewpoint up to 2010. The necessity and meaning of nuclear fuel recycling in Japan, the effort related to nuclear nonproliferation, the plan of nuclear fuel recycling for hereafter in Japan, the organization of MOX fuel fabrication in Japan and abroad, the method of utilizing recovered uranium and the reprocessing of spent MOX fuel are described. (K.I.)
Long-range pulselength scaling of 351nm laser damage thresholds
Foltyn, S. R.; Jolin, L. J.
1986-12-01
In a series of experiments incorporating 351nm pulselength of 9, 26, 54, and 625ns, it was found that laser damage thresholds increased as (pulselength)/sup x/, and that the exponent averaged 0.36 and ranged, for different samples, from 0.23 to 0.48. Similar results were obtained when only catastrophic damage was considered. Samples included Al2O3/SiO2 in both AR and HR multilayers, HR's of Sc2O3/SiO2 and HfO2/SiO2, and Al-on-pyrex mirror; 9ns thresholds were between 0.2 to 5.6 J/sq cm. When these data were compared with a wide range of other results - for wavelengths from 0.25 to 10.6 microns and pulselengths down to 4ps - a remarkably consistent picture emerged. Damage thresholds, on average, increase approximately as the cube-root of pulselength from picoseconds to nearly a microsecond, and do so regardless of wavelength or material under test.
Energy Technology Data Exchange (ETDEWEB)
Yasumi, S. [Iwatani Corp., Osaka (Japan). Dept. of Overseas Business Development
2009-07-01
Japan's Iwatani Corporation has focused its attention on hydrogen as the ultimate energy source in future. Unlike the United States, hydrogen use and delivery in liquid form is extremely limited in the European Union and in Japan. Iwatani Corporation broke through industry stereotypes by creating and building Hydro Edge Co. Ltd., Japan's largest liquid hydrogen plant. It was established in 2006 as a joint venture between Iwatani and Kansai Electric Power Group in Osaka. Hydro Edge is Japan's first combined liquid hydrogen and ASU plant, and is fully operational. Liquid oxygen, liquid nitrogen and liquid argon are separated from air using the cryogenic energy of liquefied natural gas fuel that is used for power generation. Liquid hydrogen is produced efficiently and simultaneously using liquid nitrogen. Approximately 12 times as much hydrogen in liquid form can be transported and supplied as pressurized hydrogen gas. This technology is a significant step forward in the dissemination and expansion of hydrogen in a hydrogen-based economy.
Implementation of the Additional Protocol in Japan
International Nuclear Information System (INIS)
Ogawa, T.
2001-01-01
The Additional Protocol between Japan and the IAEA entered into force in December 1999. To come into force a series of implementation trials of Additional Protocol was carried out at two Japanese representative nuclear research centers, i.e. Tokai Research Establishment of Japan Atomic Energy Research Institute (JAERI) and Oarai Engineering Center of Japan Nuclear Fuel Cycle Development Institute (JNC). These trials were proposed by Japan and were conducted in cooperation with the IAEA Secretariat. In addition, Japan amended 'the Law for the Regulation of Reactors etc.', to collect adequate information to submit to the IAEA, to arrange the surrounding for the complementary access, etc. In addition, Japan Submitted the Initial Declaration of the Additional Protocol within 180 days of the entry into force of the Protocol, in the middle of June, 2000
Kawabe, Rokuo; Konuma, Michiji; Elementary particle theory in Japan, 1935-1960 : Japan-USA collaboration, second phase
1988-01-01
This volume consists mainly of papers presented at five "workshop", each of two or three days duration, held at various locations in Japan and the United States during 1984-5 by a USA-Japan collaboration for the study of the history of particle physics in Japan, together with some of the discussions and additional interviews.
International Nuclear Information System (INIS)
2014-11-01
Japan's energy policy is undergoing fundamental changes. The accident at TEPCO's Fukushima Daiichi nuclear power plant questions the future contribution of nuclear power in the national energy mix. Growing imports of fossil fuels to replace the lost nuclear capacity inflated energy prices and raise economic and energy security challenges. At the same time, the US shale gas and oil revolution is reshaping the global energy scene. Japan expects to take advantage of the trend to eliminate the 'Asian premium' on natural gas prices and expand cheaper natural gas consumption. These developments have driven the Government of Japan to review its energy policy from scratch and adopt a new Strategic Energy Plan. This new policy has far reaching implications for gas and coal development in Japan but also for the international markets as Japan is the world's largest LNG importer and the second largest coal importer. This document summarizes the key findings of a new report by CEDIGAZ 'Japan's new energy policy: In search for stable and competitive energy supply'. The report analyzes the current changes taking place on the gas and coal markets in Japan, in light of the new energy policy adopted in April 2014, and in particular the decision to restart safe nuclear power plants and push forward electricity market reforms
Imada, Hiroshi; Tanaka-Matsumi, Junko
2016-06-01
The purpose of this article is to provide information about Japan and its psychology in advance of the 31st International Congress of Psychology (ICP), to be held in Yokohama, Japan, in 2016. The article begins with the introduction of the Japanese Psychological Association (JPA), the hosting organization of the ICP 2016, and the Japanese Union of Psychological Associations consisting of 51 associations/societies, of which the JPA is a member. This is followed by a brief description of a history of psychology of Japan, with emphasis on the variation in our approach to psychology in three different periods, that is, the pre- and post-Pacific War periods, and the post-1960 period. Next, the international contributions of Japanese psychology/psychologists are discussed from the point of view of their visibility. Education and training in psychology in Japanese universities is discussed with a final positive remark about the long-awaited enactment of the Accredited Psychologist Law in September, 2015. © 2016 International Union of Psychological Science.
[History of pandemic influenza in Japan].
Matsumoto, Keizo
2010-09-01
In Japan, influenza like epidemics were described many times since Heian era. However, Spanish flu as the modern medicine invaded Japan in 1918, thus almost infected 390,000 patients died with associated pneumonia. After the discovery of influenza virus in 1933, Japan experienced pandemic influenza--Asian flu(H2N2) in 1957. After about 10 years, Hong Kong flu (H3N2) came to Japan at 1968. However, we had many reliable antibiotics but had not any antiviral drug at the early time. After year 2000, we fortunately obtained reliable three antiviral drugs such as amantadine, oseltamivir and zanamivir. Moreover, very useful rapid test kits for influenza A and B viruses were developed and used in Japan. 2009 H1N1 influenza epidemic occured in Japan after the great epidemic in Mexico and North America but elderly patient was few. With together, host conditions regarding with high risk are changing. Lessons from past several pandemic influenza are those that many issues for changing high risk conditions, viral genetic changes, developing antiviral agents, developing new useful vaccins and determinating bacterial secondary pathogens are important.
Interstitial deletion of 5q33.3q35.1 in a boy with severe mental retardation
Lee, Jin Hwan; Kim, Hyo Jeong; Yoon, Jung Min; Cheon, Eun Jung; Lim, Jae Woo; Ko, Kyong Og; Lee, Gyung Min
2016-01-01
Constitutional interstitial deletions of the long arm of chromosome 5 (5q) are quite rare, and the corresponding phenotype is not yet clearly delineated. Severe mental retardation has been described in most patients who present 5q deletions. Specifically, the interstitial deletion of chromosome 5q33.3q35.1, an extremely rare chromosomal aberration, is characterized by mental retardation, developmental delay, and facial dysmorphism. Although the severity of mental retardation varies across cas...
IAEA Remediation Mission to Japan Concludes
International Nuclear Information System (INIS)
2011-01-01
Full text: A team of international experts today completed a preliminary assessment of the strategy and plans being considered by the Japanese authorities to remediate the areas off-site the Fukushima Dai-ichi Nuclear Power Plant reported to have elevated levels of radiation. The IAEA dispatched the mission to Japan on 7 October following a request from the country's Government. The mission, comprising 12 international and IAEA experts from several countries, visited numerous locations in the Fukushima Prefecture and conducted meetings in Tokyo and Fukushima with Japanese officials from several Ministries and institutions. ''The meetings held and visits made by the team over the last eight days gave us a first-hand appreciation of the extraordinary efforts and dedication on the part of Japanese people in their effort to remediate the areas affected by elevated levels of radiation in the Fukushima Prefecture,'' says Mr. Juan Carlos Lentijo, Team Leader and General Director for Radiation Protection at Spain's nuclear regulatory authority. ''As Japan continues its current remediation efforts, it is our belief that this work will bring relief to the populations who are affected by the consequences of the nuclear accident at the Fukushima Dai-ichi nuclear power plant.'' In a Preliminary Summary Report delivered to Japanese authorities today, the team prepared a set of conclusions including, though not limited to, the following: - Japan developed an efficient program for remediation - allocating the necessary legal, financial and technological resources to bring relief to the people affected by the accident, with priority being given to children. The Team was impressed with the strong commitment to the remediation effort from all institutions and parties involved, including the public; - Japan has also taken practical measures to inform the public and involve residents and local institutions in the process of defining its remediation strategy; - Japan is advised to avoid
75 FR 38119 - Polychloroprene Rubber From Japan
2010-07-01
... Rubber From Japan AGENCY: United States International Trade Commission. ACTION: Institution of a five-year review concerning the antidumping duty finding on polychloroprene rubber from Japan. SUMMARY: The... on polychloroprene rubber from Japan would be likely to lead to continuation or recurrence of...
Electronic manufacturing and packaging in Japan
Kelly, Michael J.; Boulton, William R. (Editor); Kukowski, John A.; Meieran, Eugene S.; Pecht, Michael; Peeples, John W.; Tummala, Rao R.
1995-01-01
This report summarizes the status of electronic manufacturing and packaging technology in Japan in comparison to that in the United States, and its impact on competition in electronic manufacturing in general. In addition to electronic manufacturing technologies, the report covers technology and manufacturing infrastructure, electronics manufacturing and assembly, quality assurance and reliability in the Japanese electronics industry, and successful product realization strategies. The panel found that Japan leads the United States in almost every electronics packaging technology. Japan clearly has achieved a strategic advantage in electronics production and process technologies. Panel members believe that Japanese competitors could be leading U.S. firms by as much as a decade in some electronics process technologies. Japan has established this marked competitive advantage in electronics as a consequence of developing low-cost, high-volume consumer products. Japan's infrastructure, and the remarkable cohesiveness of vision and purpose in government and industry, are key factors in the success of Japan's electronics industry. Although Japan will continue to dominate consumer electronics in the foreseeable future, opportunities exist for the United States and other industrial countries to capture an increasingly large part of the market. The JTEC panel has identified no insurmountable barriers that would prevent the United States from regaining a significant share of the consumer electronics market; in fact, there is ample evidence that the United States needs to aggressively pursue high-volume, low-cost electronic assembly, because it is a critical path leading to high-performance electronic systems.
International Nuclear Information System (INIS)
Itabashi, Keizo; Nakajima, Hidemitsu; Yokoo, Hiroshi
1988-01-01
The new journal, 'Nuclear Science Information of Japan-Oral Presentation', which was entirely revised from the previous abstract journal called 'Nuclear Science Information of Japan' was introduced. This is to be published quaterly in principle and compiled information by oral presentation presented at main conferences, symposia and other kind of formal meetings in the field of nuclear science and technology in Japan. Not all of the oral presentation is always contributed later to a proceeding or a journal as a full paper in Japan. In some cases, the pre-conference paper might be a only publication of the oral presentation. In this meaning, this journal could be used as a search tool for the subjects and the projects of nuclear research and development in progress. (author)
Electronics manufacturing and assembly in Japan
Kukowski, John A.; Boulton, William R.
1995-02-01
In the consumer electronics industry, precision processing technology is the basis for enhancing product functions and for minimizing components and end products. Throughout Japan, manufacturing technology is seen as critical to the production and assembly of advanced products. While its population has increased less than 30 percent over twenty-five years, Japan's gross national product has increase thirtyfold; this growth has resulted in large part from rapid replacement of manual operations with innovative, high-speed, large-scale, continuously running, complex machines that process a growing number of miniaturized components. The JTEC panel found that introduction of next-generation electronics products in Japan goes hand-in-hand with introduction of new and improved production equipment. In the panel's judgment, Japan's advanced process technologies and equipment development and its highly automated factories are crucial elements of its domination of the consumer electronics marketplace - and Japan's expertise in manufacturing consumer electronics products gives it potentially unapproachable process expertise in all electronics markets.
Transport of MOX fuel from Europe to Japan
International Nuclear Information System (INIS)
2002-01-01
The MOX fuel transports from Europe to Japan represent a main part in the implementing of the Japan nuclear program. They complement the 160 transports of spent fuels realized from Japan to Europe and the vitrified residues return from France to Japan. In this framework the document presents the MOX fuel, the use of the MOX fuel in reactor, the proliferation risks, the MOX fuel transport to Japan, the public health, the transport regulations, the safety and the civil liability. (A.L.B.)
The Early Overseas Activities of IBM in Japan
吉沢, 正広; 田中, 雅章; Masahiro, YOSHIZAWA; Masaaki, TANAKA; 愛知学院大学; 鈴鹿短期大学; / SUZUKA JUNIOR COLLEGE
1998-01-01
The purpose of this paper is to examine how IBM entered into prewar Japan and ran its wholly-owned subsidiary thereafter. Before examining something noted above, this paper surveys the process of formation of IBM and then traces its early overseas activities. Turning to the initial contacts between Japan and IBM, at first IBM carried out its mere export trade to Japan through Morimura and then Kurosawa. IBM then established its wholly-owned subsidiary, Japan Watson,in Japan to expand the busi...
Epidemiology of diabetes mellitus in Japan
Energy Technology Data Exchange (ETDEWEB)
Blackard, W G; Omori, Yoshiaki; Freedman, L R
1964-03-12
The clinical and epidemiological features of diabetes mellitus in Japan have been compiled and compared with data from other countries. Diabetes is basically the same in Japan as elsewhere: however, consideration of important differences has led to the following conclusions: The rarity of ketoacidosis in Japan is due to the mild carbohydrate defect present in most diabetics. The mild carbohydrate intolerance in diabetics is probably in part due to a high carbohydrate intake. Diabetic retinopathy is more common in women than in men in Japan; there are limited and conflicting data from the West on this point, but retinopathy, nephropathy and neuropathy occur about as frequently in Japan as in the West. Because of marked dietary differences between Japan and Western countries, these findings suggest that dietary fat has no significance in the pathogenesis of these lesions. Peripheral gangrene is distinctly unusual in Japanese diabetics. This suggests that either: the responsible vascular lesions are different from those responsible for nephropathy and retinopathy; or that small vessel lesions are the same but the lack of large vessel atherosclerosis in the population accounts for the decreased incidence of gangrene. Men have diabetes 2 or 3 times as commonly as women in Japan. If sex-limited inheritance is discarded as a possible reason, it is likely that adult-onset diabetes is more common in men than women except in those countries (the West) where women gain relatively large amounts of weight. The rarity of juvenile diabetes in Japan is best explained by the infrequency of responsible genetic factors. As a consequence, it is likely that juvenile diabetes is caused by different or additional genetic factors which are not significant in adult-onset diabetes. Diabetes prevalance varies sufficiently between different localities in the same country to render the concept of national prevalance of doubtful usefulness. 55 references, 3 figures, 3 tables.
Recent developments: Japan and Australia
International Nuclear Information System (INIS)
Anon.
1990-01-01
Recent developments in the nuclear industry in Japan and Australia are briefly reviewed. Topics discussed include: the world energy situation; and nuclear power generation trends and completion the nuclear fuel cycle in Japan. Recent events that suggest possible policy changes in Australia are briefly discussed
International Nuclear Information System (INIS)
1998-12-01
The partnership between the Cogema group and Japan in the domain of fuel cycle started about 20 years ago and the 10 Japanese nuclear operators are all clients of the Cogema group. The 1997 turnover realized with Japan reached 3.6 billions of francs (11% of the total turnover of the group). This short paper presents briefly the nuclear program of Japan (nuclear park, spent fuels reprocessing-recycling strategy) and the contracts between Cogema and the Japanese nuclear operators (natural uranium, uranium conversion and enrichment, spent fuel reprocessing, plutonium recycle and MOX fuel production markets). (J.S.)
International Nuclear Information System (INIS)
Takamatsu, Takejiro; Koshikawa, Masami; Sase, Hiroyuki; Masuzawa, Toshiyuki; Kawashima, Munetsugu; Takada, Jitsuya; Matsushita, Rokuji
1999-01-01
Aerosol deposits on leaves of various trees, especially cedar in different regions of Japan were collected to characterize the elemental composition using neutron activation analysis, ICP-AES, etc. and also investigate the effects of deposit aerosols on plants and the efficacy as an indicator for air pollution. Compared with the elemental composition of the soil, Se, Cr, Au, Br, As, Sb, Ag, etc. were more abundant in aerosols on cedar leaves. Especially, Sb is thought to be mostly derived from combustion of fossil fuels (exhaust gas from cars, etc.). Since Sb was accumulated on leaves at high levels and the analytical precision for Sb by neutron radioactivation was very high, the element was thought useful as an indicator for air pollution. If the amounts of Sb on the leaves of cedar and pine trees, which are widely distributed in Japan are determined, the degrees of pollution in all regions of Japan would be determined. In cedar trees of Saitama Prefecture where the deposit amounts of aerosols were comparatively larger, 42% of stoma was covered with the deposits, resulting that the rate of cuticular transpiration was increased and the amounts of basic elements leached from the leave surface was also increased. Thus, it was suggested that these changes might be the cause of recent declining of cedars in Japanese urban regions. (M.N.)
Research of fault activity in Japan
International Nuclear Information System (INIS)
Nohara, T.; Nakatsuka, N.; Takeda, S.
2004-01-01
Six hundreds and eighty earthquakes causing significant damage have been recorded since the 7. century in Japan. It is important to recognize faults that will or are expected to be active in future in order to help reduce earthquake damage, estimate earthquake damage insurance and siting of nuclear facilities. Such faults are called 'active faults' in Japan, the definition of which is a fault that has moved intermittently for at least several hundred thousand years and is expected to continue to do so in future. Scientific research of active faults has been ongoing since the 1930's. Many results indicated that major earthquakes and fault movements in shallow crustal regions in Japan occurred repeatedly at existing active fault zones during the past. After the 1995 Southern Hyogo Prefecture Earthquake, 98 active fault zones were selected for fundamental survey, with the purpose of efficiently conducting an active fault survey in 'Plans for Fundamental Seismic Survey and Observation' by the headquarters for earthquake research promotion, which was attached to the Prime Minister's office of Japan. Forty two administrative divisions for earthquake disaster prevention have investigated the distribution and history of fault activity of 80 active fault zones. Although earthquake prediction is difficult, the behaviour of major active faults in Japan is being recognised. Japan Nuclear Cycle Development Institute (JNC) submitted a report titled 'H12: Project to Establish the. Scientific and Technical Basis for HLW Disposal in Japan' to the Atomic Energy Commission (AEC) of Japan for official review W. The Guidelines, which were defined by AEC, require the H12 Project to confirm the basic technical feasibility of safe HLW disposal in Japan. In this report the important issues relating to fault activity were described that are to understand the characteristics of current fault movements and the spatial extent and magnitude of the effects caused by these movements, and to
International Nuclear Information System (INIS)
Schmitt, Joseph R.; Wang, Ji; Fischer, Debra A.; Moriarty, John C.; Boyajian, Tabetha S.; Jek, Kian J.; LaCourse, Daryll; Omohundro, Mark R.; Winarski, Troy; Goodman, Samuel Jon; Jebson, Tony; Schwengeler, Hans Martin; Paterson, David A.; Schwamb, Megan E.; Lintott, Chris; Simpson, Robert; Lynn, Stuart; Smith, Arfon M.; Parrish, Michael; Schawinski, Kevin
2014-01-01
We report the discovery of 14 new transiting planet candidates in the Kepler field from the Planet Hunters citizen science program. None of these candidates overlapped with Kepler Objects of Interest (KOIs) at the time of submission. We report the discovery of one more addition to the six planet candidate system around KOI-351, making it the only seven planet candidate system from Kepler. Additionally, KOI-351 bears some resemblance to our own solar system, with the inner five planets ranging from Earth to mini-Neptune radii and the outer planets being gas giants; however, this system is very compact, with all seven planet candidates orbiting ≲ 1 AU from their host star. A Hill stability test and an orbital integration of the system shows that the system is stable. Furthermore, we significantly add to the population of long period transiting planets; periods range from 124 to 904 days, eight of them more than one Earth year long. Seven of these 14 candidates reside in their host star's habitable zone.
Analysis of energy intensity in Japan
International Nuclear Information System (INIS)
Okajima, Shigeharu; Okajima, Hiroko
2013-01-01
This study discusses the causes of the increase in Japan's energy intensity, defined as energy consumption divided by GDP, since the early 1990s. The significant reduction in Japan's energy intensity ceased in the early 1980s and has even slightly increased since the early 1990s, indicating that Japan seemingly stopped taking aggressive action to improve energy use. However, further analysis at prefecture level and sector level provides additional insight on energy intensity trends. To analyze the causes of the increase in Japan's energy intensity, energy intensity is decomposed into energy efficiency (improvements in energy efficiency) and energy activity (structural changes from the secondary sector to the tertiary sector of the economy). Our result indicates that the non-uniform energy intensity trends between prefectures are attributed to a high variability in energy efficiency. At sector level, we estimate the income elasticity of energy consumption in each sector and find that a structural change in energy consumption behaviors occurred in all sectors at different time points. The industrial sector and commercial sector became less energy efficient after 1981 and 1988, respectively, which is presumably responsible for the deterioration of Japan's energy intensity since the early 1990s. - Highlights: • We examine why the reduction in Japan's energy intensity increased in the early 1990s. • There is a high variability in energy intensity trends between regions. • The structural changes in energy consumption behaviors occurred in sector level. • These changes may be responsible for the deterioration of Japan's energy intensity
International Nuclear Information System (INIS)
Moody, J D; Divol, L; Glenzer, S H; MacKinnon, A J; Froula, D H; Gregori, G; Kruer, W L; Suter, L J; Williams, E A; Bahr, R; Seka, W
2003-01-01
We describe experiments investigating the simultaneous backscattering from 351 nm (3w) and 527 nm (2w) interaction beams in a long scalelength laser-produced plasma for intensities (le) 1 x 10 15 W/cm 2 . Measurements show comparable scattering fractions for both color probe beams. Time resolved spectra of stimulated Raman and Brillouin scattering (SRS and SBS) indicate the effects of laser intensity and smoothing as well as plasma composition and parameters on the scattering levels
Urgent Safety Measures in Japan after Great East Japan Earthquake
International Nuclear Information System (INIS)
Taniura, W.; Otani, H.
2012-01-01
Due to tsunami triggered by the Great East Japan Earthquake on March 11, 2011, the operating and refueling reactor facilities at Fukushima Dai-ichi and Dai-ni Nuclear Power Plants of Tokyo Electric Power Co. caused a nuclear hazard. Japanese electric power companies voluntarily began to compile various urgent measures against tsunami within the week the hazard was caused. As for the urgent safety measures of each licensee, it is clarified that effective measures have been appropriately implemented as a result of the inspection of the national government, the verification based on the guideline of the Japan Society of Maintenology and the stress test. (author)
Maeda, Hideki; Kurokawa, Tatsuo
2015-12-01
This study exhaustively and historically investigated the status of drug lag for oncology drugs approved in Japan. We comprehensively investigated oncology drugs approved in Japan between April 2001 and July 2014, using publicly available information. We also examined changes in the status of drug lag between Japan and the United States, as well as factors influencing drug lag. This study included 120 applications for approval of oncology drugs in Japan. The median difference over a 13-year period in the approval date between the United States and Japan was 875 days (29.2 months). This figure peaked in 2002, and showed a tendency to decline gradually each year thereafter. In 2014, the median approval lag was 281 days (9.4 months). Multiple regression analysis identified the following potential factors that reduce drug lag: "Japan's participation in global clinical trials"; "bridging strategies"; "designation of priority review in Japan"; and "molecularly targeted drugs". From 2001 to 2014, molecularly targeted drugs emerged as the predominant oncology drug, and the method of development has changed from full development in Japan or bridging strategy to global simultaneous development by Japan's taking part in global clinical trials. In line with these changes, the drug lag between the United States and Japan has significantly reduced to less than 1 year.
Food Irradiation In Vietnam And Japan
International Nuclear Information System (INIS)
Tamikazy Kume
2011-01-01
In 2008, Japan Atomic Energy Commission of Cabinet Office performed the study of current status of food irradiation in the world. The results showed that the total quantity of irradiated foods in 2005 was 405,000 tons. Seven main countries for food irradiation were China, USA, Ukraine, Brazil, South Africa, Vietnam and Japan. In Japan, only the potato irradiation for sprout inhibition is continued more than 35 years since 1974 but the quantity is decreasing. On the other hand, the food irradiation of Vietnam has been developed rapidly in a short time to export the frozen seafood and fruit. This paper shows the status of food irradiation in Vietnam and Japan, and the progress in both countries after 2005. (author)
Japan's National Security: Structures, norms, and policies
International Nuclear Information System (INIS)
Katzenstein, P.J.; Okawara, N.
1993-01-01
Japan's national security policy has two distinctive aspects that deserve analysis. First, Japan's definition of national security goes far beyond traditional military notions. National security is viewed in comprehensive terms that also include economic and political dimensions. The second feature of Japan's security policy worth explanation is a distinctive mixture of flexibility and rigidity in the process of policy adaptation to change: flexibility on issues of economic security, rigidity on issues of military security, and flexibility combined with rigidity on issues of political security. With the end of the Cold War and changes in the structure of the international system, it is only natural that we ask whether and how Japan's national security policy will change as well. Optimists insist that the Asian balance of power and the US-Japan relationship will make Japan aspire to be a competitive, noninterventionist trading state that heeds the universal interest of peace and profit rather than narrow aspirations for national power. Pessimists warn us instead that the new international system will finally confirm Herman Kahn's prediction of 1970: Japan will quickly change to the status of a nuclear superpower, spurred perhaps by what some see as a dangerous rise of Japanese militarism in the 1970s and 1980s
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What are interest rates and... Series Ee Savings Bonds with Issue Dates of May 1, 1997, Through April 1, 2005 § 351.33 What are interest rates and redemption values for Series EE bonds issued May 1, 1997, through April 1, 2005, during an...
2018-01-03
potential addition of F-35B STOVL aircraft to their Izumo class helicopter destroyers is a good example. Japan’s conduct during World War II remain locked ...antiwar and antinuclear identity . But after sixty years, Japan’s neighbors still see bayoneted babies. Relations between Japan and its former victims...and the world order Robert Cooper defines Japan as the lone post-modern country surrounded by states firmly locked into an earlier age and that if
Legislative Basis of Pedagogical Education in Japan
Kuchai, Tetiana
2014-01-01
Legal framework policy of Japan in the field of education has been analyzed. The problem of influence of legislative materials on the development of education in Japan, its legislative support has been considered. It has been defined that directive materials affect the development of education system in Japan. Legislation policy of the country is…
The Role of Sub-National Actors in Climate Change Policy. The Case of Tokyo
International Nuclear Information System (INIS)
Roppongi, Hitomi
2016-06-01
Tokyo is known as a pioneer throughout the history of Japan's environmental policy, often being compared to California in the United States or Paris in France. Following the global trend of growing local initiatives tackling climate change, Tokyo introduced a cap-and-trade scheme in 2010 ahead of a national implementation. The Tokyo Cap-and-Trade Program is the first of its kind that regulates CO_2 emissions from all business sectors, where energy consumers are defined in terms of the business establishments they own. Tokyo's initiative is largely seen as a reaction to the modest national commitment, following the tradition of center-local rivalry. This study first explains the centre-local relationship in the history of Japan's environmental governance. It then analyzes the development of the Tokyo's flagship climate policy and its implications for national and other sub-national governments in Japan. The tactics used by the Tokyo Metropolitan Government to overcome business opposition typically seen in the introduction of GHG control, and future policy challenges are also discussed. The study finds that Tokyo's policy encourages behavioral changes and technological improvement in the business sector, going a step beyond the existing culture of energy conservation in Japan. An emission trading scheme is often associated with the collapse of carbon markets and the 'money game', rather than a practical tool to reduce CO_2 emissions, but the Tokyo Cap-and-Trade Program has demonstrated a policy impact that recasts such an image. A known case of policy diffusion to Saitama prefecture, an immediate neighbor of Tokyo with the fifth largest population in Japan, is also discussed to elaborate on the potential domestic diffusion of the policy. (author)
Japan's contribution to nuclear medical research
International Nuclear Information System (INIS)
Rahman, M.; Sakamoto, Junichi; Fukui, Tsuguya
2002-01-01
We investigated the degree of Japan's contribution to the nuclear medical research in the last decade. Articles published in 1991-2000 in highly reputed nuclear medical journals were accessed through the MEDLINE database. The number of articles having affiliation with a Japanese institution was counted along with publication year. In addition, shares of top-ranking countries were determined along with their trends over time. Of the total number of articles (7,788), Japan's share of articles in selected nuclear medical journals was 11.4% (889 articles) and ranked 2nd in the world after the USA (2,645 articles). The recent increase in the share was statistically significant for Japan (p=0.02, test for trend). Japan's share in nuclear medical research output is much higher than that in other biomedical fields. (author)
Japan-U.S. cooperation in transport of plutonium
International Nuclear Information System (INIS)
Takeda, Yu
2012-01-01
Japan's effort to utilize plutonium for peaceful purpose since 1950s was caught in a cross fire after the end of the Cold War. Maritime transport of plutonium from France to Japan in 1993, for instance, was criticized by U.S. Congress, nonproliferation specialists and environmental activists. U.S. government, however, compiled with Japan-US Nuclear Cooperation Agreement and cooperated to ship plutonium. This paper focuses on why Washington was supportive for the sealift of plutonium despite of opposition against it. By solving the puzzle, this research will contribute to studies of Japan's plutonium policy and Japan-U.S. nuclear relations. Based on newspaper articles, memoirs and official documents, this paper examines backgrounds and features of controversy surrounding the transport. The analyses show the causes of U.S. cooperation to the transport, such as Japan's efforts toward nuclear nonproliferation. (author)
International Nuclear Information System (INIS)
1965-01-01
Japan, which is host country for the Ninth Regular Session of the Agency General Conference, has an important programme of nuclear power development to meet future needs. In addition, Japan is active in other applications of atomic energy and is building up a domestic nuclear engineering industry. Japan has profited by the Agency as a channel of international cooperation, and was a party to the first bilateral agreement in which the responsibility for administering safeguards against the diversion of materials to military purposes, was transferred to the Agency. Japan has also lent support to Agency programmes by gifts, training courses, research, and the loan of experts. In 1961, the Japan Atomic Energy Commission (AEC) formulated the 'Long-Range Programme for Development and Utilization of Atomic Energy', on the basis of the economic prospects of nuclear power generation, and the conditions necessary to meet the ever-increasing domestic energy demands. According to this programme, in the light of power reactor development trends overseas, it is expected that nuclear power costs will compete with those of oil burning stations by 1970. On this basis, total nuclear power generating capacity of 1000 MW(e) will be attained by 1970, and 7000 - 9 500M(e) by 1980. As a prelude to the above programme the Japan Atomic Power Company (JAPCO) began construction in 1959 of a graphite-moderated gas-cooled nuclear power station (Improved Calder Hall type) of 165 MW(e) gross capacity. This is now progressing smoothly, and reached criticality in May 1965; it is expected to supply commercial power by the end of this year. The second nuclear power station will be built by the same company on the coast of the Japan Sea, with a light water-moderated reactor of 250 - 300 MW(e) capacity. The construction plan i s currently being pushed forward for completion in 1970. Thereafter three private utility companies - Tokyo, Kansai and Chubu Electric Companies - are doing preparatory work for
Directory of Open Access Journals (Sweden)
Reihaneh Asadi
2015-03-01
Conclusion: The results do not support the previous findings of an association between -351A>G genetic polymorphism in ESR1 gene and endometriosis. Therefore, comprehensive genetic approaches including linkage analyses and family-based tests, together with a number of replication studies with large sample size, are needed to make conclusive claims about the role of this genetic polymorphism in susceptibility to endometriosis.
DEFF Research Database (Denmark)
Hansen, Annette Skovsted; Ipsen, Lene
Skildrer Japans historie gennem de sidste 200 år inklusiv et kapitel om historiebrug ift. Nanjingmassakren i 1937-1938.......Skildrer Japans historie gennem de sidste 200 år inklusiv et kapitel om historiebrug ift. Nanjingmassakren i 1937-1938....
Japan/India. Towards a nuclear cooperation?
International Nuclear Information System (INIS)
Pajon, Celine
2011-10-01
As diplomatic, economic and strategic relationships between Japan and India have been intensively developed for a decade, the author aims at discussing the very sensitive approach to a nuclear cooperation between these two countries as Japan, while taking benefit of the American nuclear umbrella, is a strong defender of nuclear disarmament and non proliferation, and India has been developing its own civilian and military nuclear programme outside of the international regime which it considers as discriminative. The author first discusses factors which incited Japan to build up a strategic partnership with India in front of the evolution of the political context, of the powerful upswing of China, and of the new American orientation with respect to Delhi. She comments the economic and political stakes of the currently negotiated Japan-India nuclear cooperation agreement which not only concerns the relationships between these both countries, but also French and American industrial groups which are present on the Indian market. She also notices that the Fukushima accident which has put Japan energy choices into question again, is a new deal which is to be taken into account
Directory of Open Access Journals (Sweden)
Akahoshi K
2012-07-01
Full Text Available Keiko Akahoshi,1 Hiroshi Matsuda,2 Masuko Funahashi,1 Tomoyuki Hanaoka,3 Yasuyuki Suzuki11Department of Pediatrics, Tokyo Children’s Rehabilitation Hospital, Tokyo; 2Department of Nuclear Medicine, Saitama Medical University, International Medical Center, Saitama; 3Department of Pediatrics, Bihoro Rehabilitation Hospital, Hokkaido, JapanBackground: The aim of this study was to evaluate acute neuropsychiatric disorders in adolescents and young adults with Down syndrome. We report 13 Japanese adolescents or young adults with Down syndrome who developed acute neuropsychiatric disorders including withdrawal, depression, obsessive-compulsive behaviors, and occasional delusions or hallucinations.Methods: The following information was collected from each patient: age at onset of acute neuropsychiatric disorder, complications, signs and symptoms, personality traits before the onset of the acute neuropsychiatric disorder, prescribed medications with their respective doses and the response to treatment, and senile changes observed on magnetic resonance imaging or computed tomography.Results: The mean age at onset of these disorders was 21.2 years. Brain imaging showed almost senile changes; patients responded well to low-dose psychotropic therapy. Patients had an onset at a young age and presented with treatable conditions, although the average age of the onset of Alzheimer’s disease is generally over 40 years of age in patients with Down syndrome.Conclusion: These findings suggest that the pathology of acute neuropsychiatric disorder in patients with Down syndrome may be related to presenile changes; however, these disorders present features and a clinical course that is different from those presented in typical Alzheimer’s disease with Down syndrome.Keywords: Down syndrome, acute neuropsychiatric disorders, Alzheimer’s disease
Neurosurgeons in Japan Are Exclusively Brain Surgeons.
Asamoto, Shunji
2017-03-01
In Japan, neurosurgeons have traditionally mainly treated brain diseases, with most cases involving the spine and spinal diseases historically being treated by orthopedists. Nowadays, spinal surgery is 1 of the many subspecialties in the neurosurgical field in Japan. Most patients with neurological deficits or suspected neurological diseases see board-certified neurosurgeons directly in Japan, not through referrals from family physicians or specialists in other fields. Problems originating in the spine and spinal cord have been overlooked or misdiagnosed in these situations. Neurosurgeons in Japan must rethink the educational program to include advanced trauma life support and spinal surgery. Copyright © 2016. Published by Elsevier Inc.
Noah H. N. Lynn; Paul D. Berger
2014-01-01
In this paper we describe the state of mobile marketing in Japan. We consider the various aspects of mobile marketing in Japan and what has led to the overwhelming adoption by Japanese youth, and to a degree Japanese society as a whole, of social media and associated activities. This growth of mobile marketing has dramatic, positive implications for marketing, in general, as well as for the sale of selected product classes. We also consider markers for suggesting what the future of mobile mar...
Progress on development of nuclear power in Japan
International Nuclear Information System (INIS)
Anon.
2000-01-01
Since three Laws on the nuclear power were published 45 years has passed. Now, development on nuclear power in Japan is at an emergent state. In Japan, 51 units of commercial nuclear reactors with 44.917 GW are in operation, occupy about 37% of total electric power generation, and is positioned at an essential basic energy source supporting economical society in Japan. However, an accident occurred at Tokai Works of the JCO Co., Ltd., one of the uranium reconversion company, on September 30, 1999, was the first critical accident in Japan, and became the worst case in history on development of nuclear power in Japan, because of forming three heavy radiation disabled persons (One of them was dead) in its operators. This was a big crisis with relation to existence on development of nuclear power in Japan, by which anxiety and distrust of the Japanese against the nuclear power were amplified rapidly. On the other side, for Japan short in energy sources and of a big energy consumption, in order to intend for a long term to carry out energy security, global environmental conservation, and sustainable maintenance of essential growth, it remains to be one of important optional methods to further promote nuclear power generation and to establish nuclear fuel cycle. Here were described on progress on peaceful applications of nuclear power in Japan, progress on the field of nuclear power in Japan (from 1955 to 1999), progress on Tokai nuclear power station, introduction of nuclear power generation and effort on its domestic production. (G.K.)
75 FR 67100 - Superalloy Degassed Chromium From Japan
2010-11-01
... Chromium From Japan AGENCY: United States International Trade Commission. ACTION: Institution of a five-year review concerning the antidumping duty order on superalloy degassed chromium from Japan. SUMMARY... order on superalloy degassed chromium from Japan would be likely to lead to continuation or recurrence...
[Etiological analysis of subambient temperature burn in 351 cases of Hefei area].
Shi, Jie; Qi, Weiwei; Xu, Qinglian; Zhou, Shunying; Wang, Guobao
2010-06-01
To study the preventive measure of the subambient temperature burn by analysing the pathogenesis feature. The clinical data were analysed from 351 cases of subambient temperature burn between February 2004 and February 2009, including age, sex, burn season, burn factors, burn position, burn area, burn degree, treatment way, and wound healing. Subambient temperature burn occurred in every age stage. The susceptible age stages included infant, children, and the elderly. Female patients were more than male patients. The common burn reasons were hot-water bottle burn, honey warm keeper burn, and heating device burn. The peak season was winter. Lower limb was the most common site of the subambient temperature burn. The deep II degree to III degree were the most common level, and the burn area was always small, often time safety awareness should be strengthened so as to decrease the incidence rate of subambient temperature burn and the injury degree.
Universal varicella vaccine immunization in Japan.
Yoshikawa, Tetsushi; Kawamura, Yoshiki; Ohashi, Masahiro
2016-04-07
In 1974, Japanese scientists developed a live attenuated varicella vaccine based on the Oka strain. The efficacy of the vaccine for the prevention of varicella has been primarily demonstrated in studies conducted in the United States following the adoption of universal immunization using the Oka strain varicella vaccine in 1996. Although the vaccine was developed by Japanese scientists, until recently, the vaccine has been administered on a voluntary basis in Japan resulting in a vaccine coverage rate of approximately 40%. Therefore, Japan initiated universal immunization using the Oka strain varicella vaccine in November 2014. Given the transition from voluntary to universal immunization in Japan, it will also be important to monitor the epidemiology of varicella and herpes zoster. The efficacy and safety of co-administration of the varicella vaccine and measles, mumps, and rubella vaccine have been demonstrated in many countries; however, there was no data from Japan. In order to adopt the practice of universal immunization using the Oka strain varicella vaccine in Japan, data demonstrating the efficacy and safety of co-administration of varicella vaccine and measles and rubella (MR) vaccine were required. Additionally, we needed to elucidate the appropriate time interval between the first and second administrations of the vaccine. It is also important to differentiate between wild type and Oka vaccine type strains in herpes zoster patient with past history of varicella vaccine. Thus, there are many factors to consider regarding the adoption of universal immunization in Japan to control varicella zoster virus (VZV) infections. Copyright © 2016 Elsevier Ltd. All rights reserved.
Business Ownership and Unemployment in Japan
J. van Acht; J. Stam; A.R. Thurik (Roy); I. Verheul (Ingrid)
2004-01-01
textabstractThe influence of industrial structure, more specifically of business ownership, is investigated on the level of unemployment in Japan. The question is to what extent business ownership, i.e., entrepreneurship, can reduce the level of unemployment. It will be concluded that Japan is
Energy Technology Data Exchange (ETDEWEB)
Itabashi, Keizo; Nakajima, Hidemitsu; Yokoo, Hiroshi
1988-03-01
The new journal, 'Nuclear Science Information of Japan-Oral Presentation', which was entirely revised from the previous abstract journal called 'Nuclear Science Information of Japan' was introduced. This is to be published quaterly in principle and compiled information by oral presentation presented at main conferences, symposia and other kind of formal meetings in the field of nuclear science and technology in Japan. Not all of the oral presentation is always contributed later to a proceeding or a journal as a full paper in Japan. In some cases, the pre-conference paper might be a only publication of the oral presentation. In this meaning, this journal could be used as a search tool for the subjects and the projects of nuclear research and development in progress.
From sword to chrysanthemum: Japan's culture of anti-miltarism
International Nuclear Information System (INIS)
Berger, T.U.
1993-01-01
The end of the Cold War and the phenomenal increase in Japan's economic and technological power put Japan today in the position to become, if it chooses, a military as well as economic superpower. The diminution of the Soviet threat and the increasing US preoccupation with domestic problems give Japan a latitude for independent action it has not had since the end of World War II. At the same time the US-Japanese security alliance, which has enabled Japan to adopt a minimalist approach to defense and national security, is being weakened by ideologically charged trade and other economic frictions and a growing American perception of Japan as a threat to its interests. Moreover, in the long run Japan faces the prospect of having to deal with other rising regional powers, most notably the People's Republic of China. This changing international security environment thus raises question whether Japan, having become an economic rival of the United States, may not in the future become a military competitor as well; whether, after having adopted a pacifist stance for half a century, Japan may choose to unsheathe its sword once again
U.S.-Japan Quake Prediction Research
Kisslinger, Carl; Mikumo, Takeshi; Kanamori, Hiroo
For the seventh time since 1964, a seminar on earthquake prediction has been convened under the U.S.-Japan Cooperation in Science Program. The purpose of the seminar was to provide an opportunity for researchers from the two countries to share recent progress and future plans in the continuing effort to develop the scientific basis for predicting earthquakes and practical means for implementing prediction technology as it emerges. Thirty-six contributors, 15 from Japan and 21 from the U.S., met in Morro Bay, Calif.September 12-14. The following day they traveled to nearby sections of the San Andreas fault, including the site of the Parkfield prediction experiment. The conveners of the seminar were Hiroo Kanamori, Seismological Laboratory, California Institute of Technology (Caltech), for the U.S., and Takeshi Mikumo, Disaster Prevention Research Institute, Kyoto University, for Japan . Funding for the participants came from the U.S. National Science Foundation and the Japan Society forthe Promotion of Science, supplemented by other agencies in both countries.
Japan-U.S. Relations: Issues for Congress
2008-05-23
fields in an area of the East China Sea that both countries claim as their territory. Hu also announced that China would lease two giant pandas to Japan...to replace a recently deceased panda at a Tokyo zoo. Days later, after China was struck by a devastating earthquake, Japan immediately offered...other shipments of U.S. beef from Japan. In May 2007, the World Organization for Animal Health (OIE) announced that the United States was a “controlled
Understanding Great Earthquakes in Japan's Kanto Region
Kobayashi, Reiji; Curewitz, Daniel
2008-10-01
Third International Workshop on the Kanto Asperity Project; Chiba, Japan, 16-19 February 2008; The 1703 (Genroku) and 1923 (Taisho) earthquakes in Japan's Kanto region (M 8.2 and M 7.9, respectively) caused severe damage in the Tokyo metropolitan area. These great earthquakes occurred along the Sagami Trough, where the Philippine Sea slab is subducting beneath Japan. Historical records, paleoseismological research, and geophysical/geodetic monitoring in the region indicate that such great earthquakes will repeat in the future.
Partnership between Japan and North Atlantic treaty organization
Directory of Open Access Journals (Sweden)
Budimir Željko
2016-01-01
Full Text Available In the paper, the relationship between Japan and the North Atlantic Alliance, the development of their partnership and Japan's contribution to the NATO missions throughout the world, as well as the current status that Japan has in the Alliance, are described and explained. The authors of the paper have presented and explained the models of cooperation between the two sides and the perspectives of their future relationships as well. Apart from the said, the internal political and legal transformation of Japan, directed towards the country's greater and more robust engagement in international missions, including the use of force, which has carefully been avoided in the past seven decades due to constitutional and legal limitations, is also shown in parallel with that. The underlying thesis statement of the paper reads as follows: Japan's coming closer to NATO, i.e. the strengthening of their partnership and the elimination of legal obstacles in Japan itself to the use of force in international politics, are complementary processes. In the paper, the analytical, synthetic and comparative methods are used.
The photovoltaic energy in Japan
International Nuclear Information System (INIS)
Georgel, O.
2005-07-01
Today the Japan is the leader of the photovoltaic energy. The first reason of this success is an action of the government integrating subventions for the installation of photovoltaic systems and a support of the scientific research. To explain this success, the author presents the energy situation in Japan, details the national programs, the industrial sector (market, silicon needs, recycling, manufacturers, building industry) and presents the main actors. (A.L.B.)
Proto-Industrialization in Tokugawa Japan
Murphy, Martin J.
2012-01-01
This research examines the process of early capitalism in Japanese history. Generally it is thought that capitalism developed in the years leading to the Meiji Restoration. Like European models of early capitalist development in handicraft and cottage industries, Japan went through a similar process. Development of rural trade and small-scale capitalism sowed the seeds that broke feudal bonds and resulted in the mass factory system that made modern capitalist Japan.
International Nuclear Information System (INIS)
Ogawa, Kazuhiko; Nakamura, Katsumasa; Sasaki, Tomonari; Onishi, Hiroshi; Araya, Masayuki; Koizumi, Masahiko; Okamoto, Atsushi; Tejima, Teruki; Mitsumori, Michihide
2007-01-01
This study focused on the differences in the patterns of care for prostate cancer patients treated with radical external beam radiotherapy between Japan and the United States. Results from the 1999-2001 Japanese Patterns of Care Study (PCS) survey were compared with those of the 1999 PCS in the United States. In addition, the changing trends in the patterns of care between Japan and the United States were also analyzed. Patients in Japan were found to have more advanced primary disease than those in the United States, but the proportions of advanced disease have gradually decreased in Japan. The distributions of CT-based treatment planning, conformal therapy and higher doses were higher in the United States, and a drastic change in these parameters occurred in the United States, while only moderate changes occurred in Japan. These results indicate that patterns of care for prostate cancer in Japan are considerably different from those in the United States, and the changing trends in the patterns of care are also different between the two countries. (author)
Organic photovoltaic energy in Japan
International Nuclear Information System (INIS)
2007-01-01
Japan finances research programs on photovoltaic conversion since 1974. Research in this domain is one of the 11 priorities of NEDO, the agency of means of the ministry of economy, trade and industry of Japan. The search for an abatement of production costs and of an increase of cells efficiency is mentioned in NEDO's programs as soon as the beginning of the 1990's. A road map has been defined which foresees photovoltaic energy production costs equivalent to the ones of thermal conversion by 2030, i.e. 7 yen/kWh (4.4 cents of euro/kWh). The use of new materials in dye-sensitized solar cells (DSSC) or organic solar cells, and of new structures (multi-junctions) is explored to reach this objective. The organic photovoltaic technology is more particularly considered for small generation units in mobile or domestic technologies. Japan is particularly in advance in the improvement of DSSC cells efficiency, in particular in the domain of the research on solid electrolytes. Europe seems more in advance in the domain of the new generation of organic solar cells. Therefore, a complementarity may be found between Japan and French teams in the domain of organic solar cells improvement through collaboration programs. (J.S.)
DEFF Research Database (Denmark)
Selmer, Finn
2014-01-01
In March 2014 a group of teachers and students from the Royal Danish Academy of Fine Arts Schools of Architecture, Design and Conservation, School of Architecture, Study Dept. 3 went on a study trip to Japan. This publication collects observations and reflections that the participants of the trip...
Male acceptance of condoms in Japan.
Uchida, Y
1981-01-01
Current surveys indicate that more than 70% of married couples in Japan use condoms as their primary contraceptive method. The popularity of condoms is due to the oral contraceptive (OC) pills not being recognized as safe forms of contraception and IUDs not being legalized by the government until 1974. The history of condom use in Japan goes back to 1872 when condoms of thin leather were imported into Japan from England and France. Manufacturing of condoms in Japan began in 1909, mainly as a method for venereal disease prevention. The condom and induced abortion are now the major methods of contraception. 60% of the distribution of condoms is through pharmacies and cosmetic stores; 50% of the buyers are women. Since 1955, teams of family planning workers have distributed condoms by selling on a door-to-door basis, especially to lower middle class couples. Between 1969-75, 75% of contraceptive users were using condoms. Currently there are 81% users. The rhythm method ranks second in popularity at 30% between 1969-75. OCs have gradually increased recently to 3% users, but side effects have deterred people from selecting them. The proportion of IUD users has remained at a consistently low level for the past several years. Japan accounts for 1/3 of the total world production of condoms.
Soldo, Yan; de Matthaeis, Paolo; Le Vine, David M.
2016-01-01
In recent years, three instruments have been launched into orbit with the aim of producing global maps of sea surface salinity and soil moisture using the 1400-1427 MHz band: SMOS, Aquarius and SMAP. Although this frequency band is allocated to passive measurements only, RFI (Radio-Frequency Interference) is present in the data of all three missions. On a global scale, the three sensors have observed approximately the same distribution of RFI. Japan is an important exception that has implications for the design of RFI detection algorithms. RFI in Japan is caused by a large number of emitters belonging to the same system (TV receivers) and for this reason some traditional RFI detection strategies detect little to no RFI over Japan. The study of this case has led to an improvement of the approach to detect RFI in Aquarius data.
An overview of work, retirement, and pensions in Japan.
Bass, S A
1996-01-01
Work to retirement in Japan is a sequential transition for the most part, and Japan permits mandatory retirement by firms at age 60. But many older people work beyond the age of 60, many more than in other industrialized countries. A number of hypotheses are examined, having to do with pensions, health, opportunity, interest in working, cultural attitudes (including the concept of ikigai), and public policy initiatives (such as employment policy and the Silver Human Resource Centers). Japan's cultural attitudes and existing policies appear to have set Japan on a unique course in considering the aging of its population. To what extent should other nations emulate Japan?
International Nuclear Information System (INIS)
Matsumoto, Koji; Ando, Masashi; Yamauchi, Chikako
2009-01-01
A nationwide survey was performed to investigate the current patterns of care for brain metastasis (BM) from breast cancer in Japan. A total of 351 survey questionnaires were sent to community or academic breast oncologists who were members of the Japanese Breast Cancer Society as of December 2005. The questionnaire consists of 40 multiple choice questions in eight categories. Of 240 institutions sent survey questionnaires, 161 (67.1%) answered; 60% of institutions answered with '<5' patients with BM every year; almost half (83 of 161) screened for BM in asymptomatic patients; surgical resection was rarely performed, as ∼75% of institutions (118 of 160 institutions) answered 'none or one case of surgery per year'; 27% (41 of 154) preferred stereotactic radiosurgery (SRS) over whole-brain radiotherapy (WBRT) as the initial treatment in all cases, although ∼70% (100 of 154) of them answered 'depend on cases'. The preference for SRS over WBRT mainly depends on the impressions of breast oncologists about both safety (late normal tissue damage and dementia in WBRT) and efficacy (better local control by SRS). Eighty-one percent (117 of 144) of institutions did not limit the number of SRS sessions as far as technically applicable. SRS is widely used as the first choice for BM from breast cancer in Japan. Considerable numbers of Japanese breast oncologists prefer SRS over WBRT as the initial treatment for BM. A randomized trial comparing SRS and WBRT is warranted. (author)
Japan's oil situation and relationship with the Middle East
International Nuclear Information System (INIS)
Oka, H.
1991-01-01
This paper reports on Japan's energy supply structure and the demand for energy in the country. It focuses on oil relations between Japan and the Middle Eastern oil countries, and Japan's attempt to enhance energy supply-security policy measures
History and structure of Japan-US nuclear alliance
International Nuclear Information System (INIS)
Yoshioka, Hitoshi
2011-01-01
'Japan-US nuclear alliance' for civil use of nuclear energy was used here as technical term for the state Japanese commercial power plants were all water-cooled reactors under the US nuclear engineering umbrella and US admitted Japanese development of all 'SNT: sensitive nuclear technology' in the area of nuclear fuel cycle. 'Japan-US alliance' was used for various areas closely related with national security while 'Japan-US nuclear weapon alliance' was for military use of nuclear energy such as nuclear weapon (transport methods included) and counter weapon system. Military and civil use of nuclear energy relied fundamentally on common technical bases and especially nuclear fuel cycle related technologies were directly connected to both uses and called 'SNT'. Japanese nuclear policy sticking to SNT might come from the axiom: nuclear engineering for national security, that meant Japan refrained from nuclear arms but maintained technical and industrial potential of nuclear arms. This could be called 'nuclear arms standby strategy' and derived from compromise of both countries to play role of stabilizer of 'Japan-US alliance'. History of Japanese nuclear power development could be well understood as formation process of 'Japan-US nuclear alliance'. If Fukushima Daiichi accident forced nuclear power to phase out, nuclear fuel cycle would be obliged to terminate. This meant failure of the axiom and dissolution of 'Japan-US nuclear alliance'. (T. Tanaka)
Japan Sports Arbitration Agency (JSAA
Directory of Open Access Journals (Sweden)
Ekaterina P. Rusakova
2015-12-01
Full Text Available In this article author analyzes the activities of Japan Sports Arbitration Agency. Author considers the goals, objectives and procedure for dealing with disputes relating to the use of performance-enhancing drugs by athletes. Author study the regulation of Japan Sports Arbitration Agency, to resolve disputes relating to the use of doping, as well as the procedure for application and acceptance of its agency, the choice of arbitrators, counterclaim, protection of evidence.
Discrimination between biological interfaces and crystal-packing contacts
Directory of Open Access Journals (Sweden)
Yuko Tsuchiya
2008-11-01
Full Text Available Yuko Tsuchiya1, Haruki Nakamura2, Kengo Kinoshita1,31Institute of Medical Science, The University of Tokyo, 4-6-1 Shirokanedai, Minatoku, Tokyo, 108-8639, Japan; 2Institute for Protein Research, Osaka University, 3-2 Yamadaoka, Suita, Osaka, 565-0871, Japan; 3Bioinformatics Research and Development, JST, 4-1-8 Honcho, Kawaguchi, Saitama, 332-0012, JapanAbstract: A discrimination method between biologically relevant interfaces and artificial crystal-packing contacts in crystal structures was constructed. The method evaluates protein-protein interfaces in terms of complementarities for hydrophobicity, electrostatic potential and shape on the protein surfaces, and chooses the most probable biological interfaces among all possible contacts in the crystal. The method uses a discriminator named as “COMP”, which is a linear combination of the complementarities for the above three surface features and does not correlate with the contact area. The discrimination of homo-dimer interfaces from symmetry-related crystal-packing contacts based on the COMP value achieved the modest success rate. Subsequent detailed review of the discrimination results raised the success rate to about 88.8%. In addition, our discrimination method yielded some clues for understanding the interaction patterns in several examples in the PDB. Thus, the COMP discriminator can also be used as an indicator of the “biological-ness” of protein-protein interfaces.Keywords: protein-protein interaction, complementarity analysis, homo-dimer interface, crystal-packing contact, biological interfaces
International Nuclear Information System (INIS)
Amano, Y.
2014-01-01
The last time I had the pleasure of speaking to the Foreign Correspondents' Club of Japan was in December 2010. I had been IAEA Director General for about a year. Three months later came the Fukushima Daiichi accident. It was triggered by a powerful tsunami which followed the Great East Japan Earthquake. Human and organizational failings also played a part. Helping Japan deal with the aftermath of the accident has been a top priority for the IAEA, and for me personally, in the past three years. Nuclear safety is a hugely important issue, both in Japan and throughout the world. We have been working with our 162 Member States to implement the IAEA Action Plan on Nuclear Safety, which was adopted soon after the accident. Just recently, the final reports of our international review missions on decommissioning, and on remediation of large contaminated off-site areas, were made public. Both missions observed good progress in their respective areas. The IAEA is preparing a report on the Fukushima Daiichi accident, which will be finalized by the end of this year and shared with our Member States next year. I welcome the way in which Japan is sharing its post-Fukushima experience with the rest of the world and I encourage all States to make full use of IAEA services in order to help raise levels of safety everywhere
2010-07-01
... government has a smoke-free ordinance that is more strict than the smoking policy for Federal facilities... REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Smoking § 102-74.351 If a state or local government has a smoke-free ordinance that is more strict than the smoking policy for Federal facilities...
Japan - IAEA joint Nuclear Energy Management School 2016
International Nuclear Information System (INIS)
Yamaguchi, Mika; Hidaka, Akihide; Ikuta, Yuko; Yamashita, Kiyonobu; Sawai, Tomotsugu; Murakami, Kenta; Uesaka, Mitsuru; Tomita, Akira; Toba, Akio; Hirose, Hiroya; Watanabe, Masanori; Kitabata, Takuya; Ueda, Kinichi; Kita, Tomohiko; Namaizawa, Ken; Onose, Takatoshi
2017-03-01
Since 2010, International Atomic Energy Agency (IAEA) has held the 'Nuclear Energy Management School' so-called 'IAEA-NEM' to develop future leaders who plan and manage nuclear energy utilization in their county. Since 2012, Japan Atomic Energy Agency (JAEA) together with the Japan Nuclear Human Resource Development Network (JN-HRD Net), the University of Tokyo (UT), the Japan Atomic Industrial Forum (JAIF) and JAIF International Cooperation Center (JICC) have cohosted the NEM school in Japan in cooperation with IAEA. Since then, the school has been held every year, with the school in 2016 marking the fifth. In the 2016 NEM school, Japanese nuclear energy technology and experience, such as lessons learned from the Fukushima Daiichi Nuclear Power Station accident, were provided by not only lectures by IAEA experts, but also lectures by Japanese experts and leaders in order to offer a unique opportunity for the participants from other countries to learn about particular cases in Japan. Opportunities to visit a variety of nuclear facilities were offered for the participants in the form of technical tours in Fukui and Kobe. Through the school, we contributed to the internationalization of Japanese young nuclear professionals, development of nuclear human resource of other countries including nuclear newcomers, and enhanced cooperative relationship between IAEA and Japan. Additionally, collaborative relationship with JN-HRD Net was strengthened solidly through the integrated cooperation among ministries, universities, manufacturers and research organizations across the county by holding the school in Japan. In this report, findings obtained during the preparatory work and the school period were reported in order to make a valuable contribution towards effectively and efficiently conducting future international nuclear human resource development activities in Japan. (author)
Ando, Y.; Ogi, M.; Tachibana, Y.
2013-12-01
On Japan, wintertime cold wave has social, economic, psychological and political impacts because of the lack of atomic power stations in the era of post Fukushima world. The colder winter is the more electricity is needed. Wintertime weather of Japan and its prediction has come under the world spotlight. The winter of 2012/13 in Japan was abnormally cold, and such a cold winter has persisted for 3 years. Wintertime climate of Japan is governed by some dominant modes of the large-scale atmospheric circulations. Yasunaka and Hanawa (2008) demonstrated that the two dominant modes - Arctic Oscillation (AO) and Western Pacific (WP) pattern - account for about 65% of the interannual variation of the wintertime mean surface air temperature of Japan. A negative AO brings about cold winter in Japan. In addition, a negative WP also brings about cold winter in Japan. Looking back to the winter of 2012/13, both the negative AO and negative WP continued from October through December. If the previous studies were correct, it would have been extremely very cold from October through December. In fact, in December, in accordance with previous studies, it was colder than normal. Contrary to the expectation, in October and November, it was, however, warmer than normal. This discrepancy signifies that an additional hidden circumstance that heats Japan overwhelms these large-scale atmospheric circulations that cool Japan. In this study, we therefore seek an additional cause of wintertime climate of Japan particularly focusing 2012 as well as the AO and WP. We found that anomalously warm oceanic temperature surrounding Japan overwhelmed influences of the AO or WP. Unlike the inland climate, the island climate can be strongly influenced by surrounding ocean temperature, suggesting that large-scale atmospheric patterns alone do not determine the climate of islands. (a) Time series of a 5-day running mean AO index (blue) as defined by Ogi et al., (2004), who called it the SVNAM index. For
The cost of schizophrenia in Japan
Directory of Open Access Journals (Sweden)
Sado M
2013-05-01
Full Text Available Mitsuhiro Sado,1 Ataru Inagaki,2 Akihiro Koreki,1 Martin Knapp,3 Lee Andrew Kissane,4 Masaru Mimura,1 Kimio Yoshimura4 1Department of Neuropsychiatry, Keio University School of Medicine, 2Center for Clinical Psychopharmacology, Institute of Neuropsychiatry, Tokyo, Japan; 3Department of Social Policy, London School of Economics and Political Science, London, UK; 4Department of Health Policy and Management, Keio University School of Medicine, Tokyo, Japan Introduction: Schizophrenia is a disorder that produces considerable burdens due to its often relapsing/remitting or chronic longitudinal course. This burden is felt not only by patients themselves, but also by their families and health care systems. Although the societal burden caused by this disorder has been evaluated in several countries, the magnitude of the societal cost of schizophrenia in Japan has never been estimated. The aim of this study is to clarify the societal burden of schizophrenia by estimating the cost of schizophrenia in Japan in 2008. Methods: A human capital approach was adopted to estimate the cost of schizophrenia. The total cost of schizophrenia was calculated as the sum of the direct, morbidity, and mortality costs. Schizophrenia was defined as disorders coded as F20.0–F20.9 according to the International Classification of Diseases-10. The data required to estimate the total cost was collected from publicly available statistics or previously reported studies. Results: The total cost of schizophrenia in Japan in 2008 was JPY 2.77 trillion (USD 23.8 billion. While the direct cost was JPY 0.770 trillion (USD 6.59 billion, the morbidity and mortality costs were JPY 1.85 trillion (USD 15.8 billion and JPY 0.155 trillion (USD 1.33 billion, respectively. Conclusion: The societal burden caused by schizophrenia is tremendous in Japan, similar to that in other developed countries where published data exist. Compared with other disorders, such as depression or anxiety disorders
Gene : CBRC-CINT-01-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available gi=24256529 /ug=Cin.19191 /len=800 2.9 30% MELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIV...LVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQLLQQLERRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLMVVEQPFLQLVRRCQRMELDHI...VLVLGNILQMVVEQPFLQLVRRCQRMELDHIVLVLGNILLQMVVEQPFLQLVRRCQRMELDHIVLVLGNILQMVVEQPFLQLVRRYQRMELDHIVLVLGKCVSRWLWTNAFRGGITTSMQGSGENFLLGER ...
Energy Technology Data Exchange (ETDEWEB)
Morisaki, Rieko [Energy Communication Planning, 3-9-16 Aobadai, 818-0137 Dazaifu (Japan)
2008-07-01
1. Nuclear 2007 highlights: - A magnitude 6.8 earthquake occurred in Niigata on July 16 2007. Owing to this earthquake, 3 units operating and 1 unit during start-up were shutdown automatically at TEPCO's Kashiwazaki-Kariwa NPS. Now, all 7 units of the NPS are in an outage for investigation. This influenced the capacity factor of Japanese NPPs in FY 2007, which stood at just 60.7%. - Debate on global warming is more and more active in Japan, as it is the host country of the G8 Hokkaido Toyako Summit in July. The Japan Atomic Energy Commission released 'White Paper on Nuclear Energy 2007' in March 2008. In the paper, they first expressed the view that the expansion of the peaceful use of nuclear energy is indispensable. 2. Nuclear overview: a. Energy policy: Electricity share: 25.4% of nuclear. The energy policy of Japan aims at nuclear power generation being maintained at the current level (30 to 40% of the total electricity generation) or increasing even after 2030, for stable energy supply and as a countermeasure against global warming. - Nuclear Fuel Cycle: The active tests at the JNFL reprocessing plant in Rokkasho-mura are in the final phase for commercial operation in 2008. By FY 2010 Plutonium utilization in LWRs in 16 to 18 NPP units. Around FY 2010 Installment of new centrifuges at the uranium enrichment plant at Rokkasho-mura. In FY 2012 Start of commercial operation of MOX fuel fabrication plant. Fast-breeder reactor cycle: Operation of the prototype reactor 'MONJU' has been suspended since a secondary sodium leak in 1995. JAEA (Japan Atomic Energy Agency) completed full-scale remodeling work and is implementing various tests to confirm the capabilities and soundness of MONJU. They aim to start its operation within FY 2008. Around 2025 Building a demonstration FBR. Before 2050 Development of a commercial FBR. - Electricity production (Operating): BWR: 32 units (including 4 units of APWR), PWR: 23 units. - Electricity production
Middle term prospects for Japan's safeguards
International Nuclear Information System (INIS)
Ogawa, T.
2001-01-01
Japan has responded to IAEA requirements on reinforced safeguard regulations. The IAEA additional protocol entered in force in Japan on December 1999. Japan submitted a preliminary information report to IAEA on June 2000 after joint works with the Nuclear Material Control Center (NMCC) of Japan. The first annual report was submitted to IAEA on May 2001. Another activity for the additional protocol is complementary accesses. The total 36 accesses to facilities have been done from November 2000 to September 2001. Procedures of access to managements are under discussion. MEXT (Ministry of Education, Culture, Sports, Science and Technology) has been constructing the Rokkasho Safeguards On-Site Laboratory from 1997, and the Rokkasho Safeguards Center from 2000. The Design Information Verification (DIV) is now ongoing. Much more personal resources will be needed for future inspections. Therefore, the budget for safeguards is increasing in contrast to the flat base budget for the total atomic energy. As for future activity, a MOX (Mixed Oxide Fuels) fuel processing plant is one of the issues for discussion. The construction of the MOX processing plant is supposed to begin on around 2004. The conclusion of additional protocol will be given by IAEA until end of 2002. Shift to integrated safeguards are under discussions by MEXT, NMCC and utilities of Japan parallel with IAEA. Key issues of discussion are cost saving for safeguards, development of personal resources for inspectors and the role of NMCC. (Y. Tanaka)
75 FR 57980 - Polychloroprene Rubber From Japan
2010-09-23
... INTERNATIONAL TRADE COMMISSION [Investigation No. AA1921-129 (Third Review)] Polychloroprene Rubber From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five-year... of the antidumping duty finding on polychloroprene rubber from Japan would be likely to lead to...
Hiraoka, Koichi; Tomaru, Nobuhiro
2009-05-01
Genetic diversity and structure in Fagus crenata were studied by analyzing 14 nuclear microsatellite loci in 23 populations distributed throughout the species' range. Although population differentiation was very low (F (ST) = 0.027; R (ST) = 0.041), both neighbor-joining tree and Bayesian clustering analyses provided clear evidence of genetic divergence between populations along the Japan Sea (Japan Sea lineage) and Pacific (Pacific lineage) sides of Japan, indicating that physical barriers to migration and gene flow, notably the mountain ranges separating the populations along the Japan Sea and Pacific sides, have promoted genetic divergence between these populations. The two lineages of the nuclear genome are generally consistent with those of the chloroplast genome detected in a previous study, with several discrepancies between the two genomes. Within-population genetic diversity was generally very high (average H (E) = 0.839), but decreased in a clinal fashion from southwest to northeast, largely among populations of the Japan Sea lineage. This geographical gradient may have resulted from the late-glacial and postglacial recolonization to the northeast, which led to a loss of within-population genetic diversity due to cumulative founder effects.
APWR - Mitsubishi, Japan/Westinghouse, USA
International Nuclear Information System (INIS)
Aeba, Y.; Weiss, E.H.
1999-01-01
Nuclear power generated by light water reactors accounts for approximately 1/3 of Japan's power supply. Development of the Advanced Pressurized Water Reactor (APWR) was initiated by five PWR electric power companies (Hokkaido, Kansai, Shikoku, Kyushu and Japan Atomic Power), Mitsubishi Heavy Industries, and Westinghouse, with a view to providing a nuclear power source to meet future energy demand in Japan. The APWR was developed based on the results of the Improvement and Standardization Program, promoted by the Ministry of International Trade and Industry, with reconsideration of the needs of age, such as construction cost reduction, enhanced safety and increased reliability. One of the important concepts of the APWR is its large power rating that decreases the construction cost per unit of electric generation capacity. Though the electric output was lower at the early stage of basic design than it is now, uprating to approximately 1530 MW is achieved based on the results of design progress and high efficiency improvements to the steam turbine and reactor coolant pumps. Furthermore, the APWR remarkably enhances reliability, safety operability and maintainability by introducing new technologies that include a radial reflector and advanced accumulators. The first APWR is planned to be built at Tsuruga No. 3 and No. 4 by the Japan Atomic Power Company and will be the largest commercial operation plant in the early 21st century. (author)
Urgent Safety Measures in Japan after Great East Japan Earthquake
International Nuclear Information System (INIS)
Taniura, Wataru; Otani, Hiroyasu
2012-01-01
Due to tsunami triggered by the Great East Japan Earthquake, the operating and refueling reactor facilities at Fukushima Dai-ichi and Dai-ni Nuclear Power Plants caused a nuclear hazard. Given the fact, Japanese electric power companies voluntarily began to compile various urgent measures against tsunami. And then the Nuclear and Industrial Safety Agency (NISA) ordered the licensees to put into practice the voluntarily compiled urgent safety measures, in order to ensure the effectiveness of the means for recovering cooling functions along with avoiding the release of radioactive substances to the possible minimum, even if a huge tsunami following a severe earthquake hits nuclear power plants. The following describes the state and the effect of the urgent safety measures implemented for 44 reactors (under operation) and 1 reactor (under construction) in Japan and also describes the measures to be implemented by the licensees of reactor operation in the future.
Challenge to the enhancement of LWRs in Japan
International Nuclear Information System (INIS)
Inoue, T.
1996-01-01
Japan was way behind western countries in nuclear power development. This is partly because of the defeat in the second world war which bound Japan to the ban on nuclear power development. As a result, Japan was obliged to take the policy of introducing the power reactor, and its technology, from overseas advanced countries in order to promote the development of power reactors for its own country. (orig.)
The internationalization of Japan
International Nuclear Information System (INIS)
Kuroki, T.E.
1989-01-01
There are growing tensions and frictions between the U.S. and Japan. Among them are science and technology issues that relate to the development of superconductor technology, as well as economic, trade and agricultural issues. The structure of this friction is very complex. There are many interconnected issues that cannot be resolved one by one. This article focuses on the relationship between the U.S. and Japan. Some of the complexities behind the issues are discussed by defining different notions of internationalization and by presenting the positive and negative aspects of the Japanese approach that affects the future cooperation and competition between our nations in the area of superconductivity
Divorce in contemporary Japan.
Fukurai, H; Alston, J
1990-10-01
Data from the 1985-86 Japanese census are analysed to explore the determinants of the divorce rates in Japan's forty-seven prefectures, using two theoretical models: (a) the social integration model, which is shown to have a greater utility in predicting Japanese divorce levels than (b), the human capital model. Female emigration patterns play a significant role in affecting the divorce rate. Population increase and net household income are also important predictors of the Japanese divorce rate and urbanization has a great influence in modern Japan. Demographic and aggregate variables such as migration, urbanization, and socioeconomic factors are useful when organized under a social integration model.
Japan's approach to monetary policy
Giovanni P. Olivei
2002-01-01
The goal of monetary policy as conducted by the Bank of Japan is to contribute to the sound development of the national economy through the pursuit of price stability. The objective of price stability, however, is not precisely defined as it has been for other central banks. Following the implementation of the new Bank of Japan Law in 1998, the monetary policy framework is characterized by central bank independence, the primacy of the price stability objective, instrument independence, and po...
Energy Technology Data Exchange (ETDEWEB)
Akahoshi, S. [Ministry of Transportation, Tokyo (Japan)
1994-09-01
Although Japan`s shipbuilding industry has been maintaining a seat for the first place in the world over 30 years or more in a contract award quantity for the new shipbuilding work, Korea got ahead of Japan and has come to be a top at the first time in 1993. Even though the various factors could be thought, it has become a turning point to be reconsidered how Japan`s shipbuilding industry should be from now on for the naval architects and persons concerned in Japan. While Japan`s production of the maritime industrial products has been in general showing the recovering tendency by a demand restoration of the large scale vessels and so forth since 1987 afterward, on the other hand, affected by an influence of the recession of the world economic activities, the total production amount in 1993 has turned to a little bit decrease and its amount was 831.8 billion yen (a ratio to the previous year: 96.4%). Though a business environment surrounding the maritime industry, in order to successively continue the work shop site inside this country as an important industry through this industry from now on, it is thought that a restoration of the price competition should be made an effort on one hand by a standardization of the maritime equipments and tools making an exclusion of the wastefulness as an object, and a strengthening of the international competitiveness at the non-price aspects such as a functionality of the products, a reliability and so forth is indispensable on the other hand. 6 figs., 3 tabs.
Situation of nuclear industry in Japan
International Nuclear Information System (INIS)
2002-08-01
This document is a reprint of a note published by the nuclear service of the French embassy in Japan. It evokes the present day situation of nuclear facilities in Japan, the public acceptance and its attitude in front of accidents, the national energy program, the deregulation and competitiveness of nuclear power, the carrying out of the nuclear program, the future reactors, the fast neutron reactors, the dismantling activities, the fuel enrichment and reprocessing of spent fuels, the use of MOX fuel, the off-site storage, the vitrified and radiological wastes, the geological disposal of wastes, the prospects of the nuclear program, the companies involved in the Japan nuclear industry, the French-Japanese bilateral cooperation, and the ITER project in the domain of nuclear fusion. (J.S.)
Delphi survey of issues after the Great East Japan Earthquake
International Nuclear Information System (INIS)
Maeda, Yasunobu; Seo, Kami; Motoyoshi, Tadahiro; Okada, Shinya
2011-01-01
The Great East Japan Earthquake on March 11, 2011 has catastrophic impacts on Japan. Japan is currently on the way to recovery. However, as the damage on the country as well as society is so serious, Japanese society is urged to change some systems including hazard management, energy policy, information systems and city planning. These changes are accompanied with social group realignments, thus necessarily followed by various risks. To cope with these risk issues, SRA-Japan established the special research committee for the Great East Japan Earthquake. The aim of the committee is, from viewpoints of risk analysts, to create and relate messages about risk issues in 2-3 years, in ten years and in thirty years from the earthquake. To do this, the committee garners SRA-Japan member's opinions about possible risks in Japan by using Delphi method. In SRA-Japan, there are over 600 members in interdisciplinary fields from various backgrounds, thus the messages are expected to be helpful for Japanese society to lower its risks and to optimize the resource allocation. The research is now underway. An interim report will be presented. (author)
Fuel combustion in thermal power plants in Japan
Energy Technology Data Exchange (ETDEWEB)
Kotler, V.R.
1983-11-01
The position of black coal in the energy balance of Japan is discussed. About 75% of electric energy is produced by thermal power plants. Eighty-five per cent of electricity is produced by power plants fired with liquid fuels and 3% by coal fired plants. Coal production in Japan, the forecast coal import to the country by 1990 (132 Mt/year), proportion of coal imported from various countries, chemical and physical properties of coal from Australia, China and Japan are discussed. Coal classification used in Japan is evaluated. The following topics associated with coal combustion in fossil-fuel power plants in Japan are discussed: coal grindability, types of pulverizing systems, slagging properties of boiler fuel in Japan, systems for slag removal, main types of steam boilers and coal fired furnaces, burner arrangement and design, air pollution control from fly ash, sulfur oxides and nitrogen oxides, utilization of fly ash for cement production, methods for removal of nitrogen oxides from flue gas using ammonia and catalysts or ammonia without catalysts, efficiency of nitrogen oxide control, abatement of nitrogen oxide emission from boilers by flue gas recirculation and reducing combustion temperatures. The results of research into air pollution control carried out by the Nagasaki Technical Institute are reviewed.
National Oceanic and Atmospheric Administration, Department of Commerce — The shield volcano consists of more than 20 eruptive centers over a 20 x 30 km area that also includes Japan's first national park. Sixty-nine eruptions have been...
78 FR 66767 - Chlorinated Isocyanurates From China and Japan
2013-11-06
...)] Chlorinated Isocyanurates From China and Japan Determinations On the basis of the record \\1\\ developed in the... reason of imports from China and Japan of chlorinated isocyanurates, provided for in subheadings 2933.69... (LTFV) from Japan and subsidized by the Government of China.\\2\\ \\1\\ The record is defined in sec. 207.2...
The scale of biomass production in Japan
Energy Technology Data Exchange (ETDEWEB)
Matsumura, Yukihiko [School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashihiroshima-shi 739-8527 (Japan); Inoue, Takashi; Fukuda, Katsura [Global Warming Research Department, Mitsubishi Research Institute, Inc., 2-3-6 Ohtemachi, Chiyoda-ku, Tokyo 100-8141 (Japan); Komoto, Keiichi; Hada, Kenichiro [Renewable energy Team, Environment, Natural Resources and Energy Division, Mizuho Information and Research Institute, Inc., 2-3 Kanda-nishikicho, Chiyoda-ku, Tokyo 101-8443 (Japan); Hirata, Satoshi [Technical Institute, Kawasaki Heavy Industries, Ltd., 1-1 Kawasakicho, Akashi-shi, Hyogo 673-8666 (Japan); Minowa, Tomoaki [Biomass Recycle Research Laboratory, National Institute of Advanced and Industrial Science and Technology, 2-2-2 Hiro, Suehiro, Kure-shi, Hiroshima 737-0197 (Japan); Yamamoto, Hiromi [Socioeconomic Research Center, Central Research Institute of Electric Power Industry, 1-6-1 Ohtemachi, Chiyoda-ku, Tokyo 100-8126 (Japan)
2005-11-01
Policymakers working to introduce and promote the use of bioenergy in Japan require detailed information on the scales of the different types of biomass resources generated. In this research, the first of its type in Japan, the investigators reviewed various statistical resources to quantify the scale distribution of forest residues, waste wood from manufacturing, waste wood from construction, cattle manure, sewage sludge, night soil, household garbage, and waste food oil. As a result, the scale of biomass generation in Japan was found to be relatively small, on the average is no more than several tons in dry weight per day. (author)
Entomological journals and publishing in Japan.
Fukatsu, Takema
Here I present an overview of entomological journals and publishing in Japan, thereby providing a convenient portal to the valuable scientific resources for the world's entomological researchers and scientific communities. Currently, except for several international journals published fully in English such as Applied Entomology and Zoology and Entomological Science , many entomological and entomology-related journals in Japan are not indexed by major scientific databases like Web of Science, and therefore they are neither conveniently recognizable nor accessible for the world's entomological communities. However, I point out that many of the contents of such journals are freely available via Japan's public platforms for electronic scientific literature, Japan Science and Technology Information Aggregator, Electronic (J-stage) or Citation Information by National Institute of Informatics (CiNii). Here I list 32 entomological and entomology-related societies and their 45 journals, the majority of which belong to either the Union of Japanese Societies for Insect Sciences (UJSIS), the Union of the Japanese Societies for Systematic Biology (UJSSB), the Union of Japanese Societies for Natural History (UJSNH), or the Union of Japanese Societies for Biological Science (UJSBS), with their respective URL and open-access availability.
Japan, new agenda for energy security
International Nuclear Information System (INIS)
Chrisstoffels, J.H.
2007-07-01
The author argues that the Japanese government will actively seek to strengthen security of supply. Japan has almost no domestic energy reserves. It is Asia's leading energy importer, but it faces increasing competition for resources from China and India. This has led to growing concern among Japanese policy makers. In the spring of 2007 a new Basic Energy Law was drafted that offers a strategic change of direction, away from a policy emphasis on free (energy) trade promotion and liberalisation of domestic energy markets. Japan will boost energy diplomacy towards energy producing countries and increase financial guarantees to Japanese oil and gas development companies. At the same time, Japan will raise efforts to lower its dependency on foreign oil and gas. To this end, it has set ambitious targets for further nuclear power development and the promotion of bio-trade. The author points at a multitude of complexities that may impede the success of these policies, Still, EU policy makers should be aware that Japan's energy policy has changed, driven by the conviction that markets alone cannot be relied upon to guarantee a secure supply of energy. [nl
Japan’s Self Defense Forces After the Great East Japan Earthquake: Toward a New Status Quo
2012-03-01
Retrenchment, SDF Status Quo, Humanitarian Aid Disaster Relief, U.S.– Japan Security Alliance, Japanese Economy , Japanese Norms, Pacifism, Anti...Chemical, Biological, Radiological, and Nuclear CRF Central Readiness Force DDF Dynamic Defense Force DPJ Democratic Party of Japan EAC East...LNG Liquefied Natural Gas METI Ministry of Economy , Trade, and Industry MINUSTAH United Nations Stabilization Mission in Haiti MOD Ministry
Central bank capital, financial strength, and the Bank of Japan
Thomas F. Cargill
2006-01-01
This Economic Letter addresses central bank capital and financial strength in the context of Bank of Japan policy (Cargill 2005). Specifically, it reviews general considerations about central bank capital and financial strength, discusses recent Bank of Japan policy in the context of capital structure, evaluates the Bank of Japan's concern in the context of the broader issue of central bank independence, and draws some lessons from recent Bank of Japan policy.
Current asthma deaths among adults in Japan
Directory of Open Access Journals (Sweden)
Tsugio Nakazawa
2004-01-01
Full Text Available Recent asthma deaths were examined from yearly reports of the Ministry of Health, Labor and Welfare of Japan and from reports published by the Japan Asthma Death Investigation Committee on 811 deaths over the period 1992–2000. The rate and number of recent asthma deaths in Japan have been decreasing rapidly. Most asthma deaths were of patients aged 70–90 years and there has been a marked trend for increased asthma deaths in the elderly. As for the circumstances surrounding the deaths, sudden death, unstable sudden aggravation and intermittent aggravation were mainly noted. Respiratory infections, fatigue and stress were the major courses of fatal attacks contributing to deaths due to asthma. Many of the patients who died from asthma had been diagnosed as having as moderate to severe asthma and many had non-atopic asthma. There are some reports that suggest that the recent decrease in asthma deaths in Japan is correlated with the use of inhaled cortico- steroids.
Elementary particle theory in Japan, 1930-1960
International Nuclear Information System (INIS)
Brown, L.M.; Kawabe, Rokuo; Konuma, Michiji; Maki, Ziro
1991-01-01
The present volume consists of the combined proceedings of two Japan-USA Collaborative Workshops, organized to explore historical developments of particle theory in Japan during the period 1930-1960, i.e., the three decades that include the birth and development of Meson Theory. The first phase of workshops was held during September 1978-July 1979 and the second during July 1984-September 1985. The original versions of these proceedings were published informally; namely, the former was distributed as a series of preprints of the Yukawa Institute (then called RIFP) entitled 'Particle Physics in Japan, 1930-50 Vol. I, II' (RIFP-407 and -408, September 1980); the latter was issued in the form of camera-ready printing from Yukawa Hall Archival Library (YHAL) in May 1988, under the title 'Elementary Particle Theory in Japan, 1935-1960'. Only a small number of copies were printed for both sets of proceedings due to financial limitations of the project. (author)
Delays in clinical development of neurological drugs in Japan.
Ikeda, Masayuki
2017-06-28
The delays in the approval and development of neurological drugs between Japan and other countries have been a major issue for patients with neurological diseases. The objective of this study was to analyze factors contributing to the delay in the launching of neurological drugs in Japan. We analyzed data from Japan and the US for the approval of 42 neurological drugs, all of which were approved earlier in the US than in Japan, and examined the potential factors that may cause the delay of their launch. Introductions of the 42 drugs in Japan occurred at a median of 87 months after introductions in the US. The mean review time of new drug applications for the 20 drugs introduced in Japan in January 2011 or later (15 months) was significantly shorter than that for the other 22 drugs introduced in Japan in December 2010 or earlier (24 months). The lag in the Japan's review time behind the US could not explain the approval delays. In the 31 of the 42 drugs, the application data package included overseas data. The mean review time of these 31 drugs (17 months) was significantly shorter than that of the other 11 drugs without overseas data (26 months). The mean approval lag behind the US of the 31 drugs (78 months) was also significantly shorter than that of the other 11 drugs (134 months). These results show that several important reforms in the Japanese drug development and approval system (e.g., inclusion of global clinical trial data) have reduced the delays in the clinical development of neurological drugs.
Superconducting magnet development in Japan
International Nuclear Information System (INIS)
Yasukochi, K.
1983-01-01
The present state of R and D works on the superconducting magnet and its applications in Japan are presented. On electrical rotating machines, 30 MVA superconducting synchronous rotary condenser (Mitsubishi and Fuji) and 50 MVA generator are under construction. Two ways of ship propulsion by superconducting magnets are developing. A superconducting magnetically levitated and linear motor propelled train ''MAGLEV'' was developed by the Japan National Railways (JNR). The superconducting magnet development for fusion is the most active field in Japan. The Cluster Test program has been demonstrated on a 10 T Nb 3 Sn coil and the first coil of Large Coil Task in IEA collaboration has been constructed and the domestic test was completed in JAERI. These works are for the development of toroidal coils of the next generation tokamak machine. R and D works on superconducting ohmic heating coil are in progress in JAERI and ETL. The latter group has constructed 3.8 MJ pulsed coil. A high ramp rate of changing field in pulsed magnet, 200 T/s, has been tested successfully. High Energy Physics Laboratory (KEK) are conducting active works. The superconducting μ meson channel and π meson channel have been constructed and are operating successfully. KEK has also a project of big accelerator named ''TRISTAN'', which is similar to ISABELLE project of BNL. Superconducting synchrotron magnets are developed for this project. The development of superconducting three thin wall solenoid has been started. One of them, CDF, is progressing under USA-Japan collaboration
International Nuclear Information System (INIS)
Duffield, John S.; Woodall, Brian
2011-01-01
In June 2010, the Japanese cabinet adopted a new Basic Energy Plan (BEP). This was the third such plan that the government has approved since the passage of the Basic Act on Energy Policy in 2002, and it represents the most significant statement of Japanese energy policy in more than four years, since the publication of the New National Energy Strategy (NNES) in 2006. Perhaps more than its predecessors, moreover, the new plan establishes a number of ambitious targets as well as more detailed measures for achieving those targets. Among the targets are a doubling of Japan's 'energy independence ratio,' a doubling of the percentage of electricity generated by renewable sources and nuclear power, and a 30 percent reduction in energy-related CO 2 emissions, all by 2030. This paper explains the origins of the 2010 BEP and why it was adopted. It then describes the content of the plan and how it differs from the NNES. A third section analyzes the appropriateness of the new goals and targets contained in the BEP and their feasibility, finding that achievement of many of the targets was likely to be quite challenging even before the March 2011 earthquake, tsunami, and nuclear crisis. - Highlights: → Origins of Japan's new Basic Energy Plan. → Content of Japan's new Basic Energy Plan. → Feasibility of achieving the targets in Japan's new Basic Energy Plan. → Impact of 2011 earthquake and tsunami on Japanese energy policy.
A review of fast reactor programme in Japan
International Nuclear Information System (INIS)
1998-01-01
This report describes the development and activities on fast reactor in Japan for the period of April 1996 - March 1997. During this period, the 30th duty cycle operation has been started in the Experimental Fast Reactor ''''Joyo''''. The cause investigation on the sodium leak incident has completed and the safety examination are being performed in the Prototype Fast Breeder Reactor ''''Monju''''. The three years design study since FY1994 on the plant optimization of the Demonstration FBR has been completed by the Japan Atomic Power Company (JAPC). Related research and development works are underway at several organizations under the discussion and coordination of the Japanese FBR R and D Steering Committee, which is composed of Power Reactor and Nuclear Fuel Development Corporation (PNC), JAPC, Japan Atomic Energy Research Institute (JAERI) and Central Research Institute of Electric Power Industry (CRIEPI). In November 1996, the Japan Atomic Energy Commission (JAEC) established a Social Gathering Meeting to discuss generally the significance of FBR development in Japan for the future. (author)
Japan's Ambivalent Diplomacy on Climate Change
International Nuclear Information System (INIS)
Pajon, C.
2010-01-01
Japan often pictures itself as an environmental leader. While many examples of Japan's actions against climate change are in line with global climate change norms, others can be in opposition to them. This study, based on first hand interviews with Japanese policy makers and actors from the private and civil society sector, gives an informed perspective on the process through which Japan came to integrate and implement, at the domestic level, the international objective of climate change prevention, pointing out the discrepancies, tensions or synergies that emerged. As the current governance on climate change, and particularly after the Copenhagen conference, tends to reassert the importance of the national level against the global one, the Japanese case can serve as an example of tools and strategies that fully integrate the domestic level
Getah Virus Infection among Racehorses, Japan, 2014
Bannai, Hiroshi; Tsujimura, Koji; Kobayashi, Minoru; Kikuchi, Takuya; Yamanaka, Takashi; Kondo, Takashi
2015-01-01
An outbreak of Getah virus infection occurred among racehorses in Japan during September and October 2014. Of 49 febrile horses tested by reverse transcription PCR, 25 were positive for Getah virus. Viruses detected in 2014 were phylogenetically different from the virus isolated in Japan in 1978. PMID:25898181
Datafile: [nuclear power in] Japan
International Nuclear Information System (INIS)
Anon.
1989-01-01
Japan is third after the USA and France in terms of the Western World's installed nuclear capacity, but it has by far the largest forward programme. Great effort is also being put into the fuel cycle and advanced reactors. There is close co-operation between the government, utilities and manufacturers, but Japan has not sought to export reactors. The government has responded to the growing public opposition to nuclear power with a massive increase in its budget for public relations. Details of the nuclear power programme are given. (author)
International Nuclear Information System (INIS)
Anon.
1991-01-01
The Atomic Energy Commission (AEC) has formulated Japanese nuclear fuel recycling plan for the next 20 years, based on the idea that the supply and demand of plutonium should be balanced mainly through the utilization of plutonium for LWRs. The plan was approved by AEC, and is to be incorporated in the 'Long term program for development and utilization of nuclear energy' up for revision next year. The report on 'Nuclear fuel recycling in Japan' by the committee is characterized by Japanese nuclear fuel recycling plan and the supply-demand situation for plutonium, the principle of the possession of plutonium not more than the demand in conformity with nuclear nonproliferation attitude, and the establishment of a domestic fabrication system of uranium-plutonium mixed oxide fuel. The total plutonium supply up to 2010 is estimated to be about 85 t, on the other hand, the demand will be 80-90 t. The treatment of plutonium is the key to the recycling and utilization of nuclear fuel. By around 2000, the private sector will commercialize the fabrication of the MOX fuel for LWRs at the annual rate of about 100 t. Commitment to nuclear nonproliferation, future nuclear fuel recycling program in Japan, MOX fuel fabrication system in Japan and so on are reported. (K.I.)
Energy Technology Data Exchange (ETDEWEB)
Giacomazzi, J.; Aguiar, E. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Palmero, E.I. [International Agency for Research on Cancer (IARC), Lyon (France); Schmidt, A.V. [Departamento de Estatística, UFRGS, Porto Alegre, RS (Brazil); Skonieski, G.; Filho, D.D. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Bock, H. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Saraiva-Pereira, M.L. [Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Biologia Celular e Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Bioquímica, UFRGS, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Ewald, I.P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (Brazil); Schuler-Faccini, L. [Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Camey, S.A. [Departamento de Estatística, Instituto de Matemática, UFRGS, Porto Alegre, RS (Brazil); Caleffi, M. [Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (Brazil); Giugliani, R. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Laboratório de Identificação Genética, HCPA, Porto Alegre, RS (Brazil); Serviço de Genética Médica, HCPA, Porto Alegre, RS (Brazil); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (Brazil); Departamento de Genética, UFRGS, Porto Alegre, RS (Brazil); Ashton-Prolla, P. [Programa de Pós-Graduação em Medicina: Ciências Médicas, Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (BR); Laboratório de Medicina Genômica, Centro de Pesquisa Experimental, Hospital de Clínicas de Porto Alegre (HCPA), Porto Alegre, RS (BR); Núcleo Mama Porto Alegre, Associação Hospitalar Moinhos de Vento, Porto Alegre, RS (BR); Serviço de Genética Médica, HCPA, Porto Alegre, RS (BR); Programa de Pós-Graduação em Genética e Biologia Molecular, UFRGS, Porto Alegre, RS (BR); Departamento de Genética, UFRGS, Porto Alegre, RS (BR)
2012-05-18
Polymorphisms of hormone receptor genes have been linked to modifications in reproductive factors and to an increased risk of breast cancer (BC). In the present study, we have determined the allelic and genotypic frequencies of the ERα-397 PvuII C/T, ERα-351 XbaI A/G and PGR PROGINS polymorphisms and investigated their relationship with mammographic density, body mass index (BMI) and other risk factors for BC. A consecutive and unselected sample of 750 Brazilian BC-unaffected women enrolled in a mammography screening program was recruited. The distribution of PGR PROGINS genotypic frequencies was 72.5, 25.5 and 2.0% for A1A1, A1A2 and A2A2, respectively, which was equivalent to that encountered in other studies with healthy women. The distribution of ERα genotypes was: ERα-397 PvuII C/T: 32.3% TT, 47.5% TC, and 20.2% CC; ERα-351 XbaI A/G: 46.3% AA, 41.7% AG and 12.0% GG. ERα haplotypes were 53.5% PX, 14.3% Px, 0.3% pX, and 32.0% px. These were significantly different from most previously published reports worldwide (P < 0.05). Overall, the PGR PROGINS genotypes A2A2 and A1A2 were associated with fatty and moderately fatty breast tissue. The same genotypes were also associated with a high BMI in postmenopausal women. In addition, the ERα-351 XbaI GG genotype was associated with menarche ≥12 years (P = 0.02). ERα and PGR polymorphisms have a phenotypic effect and may play an important role in BC risk determination. Finally, if confirmed in BC patients, these associations could have important implications for mammographic screening and strategies and may be helpful to identify women at higher risk for the disease.
Effect of barrier layers in burnthrough experiments with 351-nm laser illumination
International Nuclear Information System (INIS)
Delettrez, J.; Bradley, D.K.; Jaanimagi, P.A.; Verdon, C.P.
1990-01-01
The time-resolved x-ray emission is measured from spherical targets consisting of glass shells overcoated with plastic in which thin signature layers are embedded. These targets are illuminated at 351 nm by the 24-beam OMEGA laser system at the Laboratory for Laser Energetics of the University of Rochester. We measure a large burnthrough rate for bare plastic targets that can only be replicated in one-dimensional hydrodynamic simulations with laser intensities in excess of ten times the nominal intensity. We observe that the burnthrough times are affected by the presence of a thin outer coating (barrier layer). The burnthrough times depend strongly on the barrier-layer material and thickness, whereas one-dimensional simulation results predict only a small effect. Several processes are considered to explain these results: illumination nonuniformity, early shinethrough of the laser light through the plastic, prepulses, filamentation, self-focusing of hot spots, and the Rayleigh-Taylor instability. We conclude that mixing due to the Rayleigh-Taylor instability, enhanced by early shinethrough, is the most probable cause of the observed large burnthrough rates
Childbirth in aristocratic households of Heian Japan.
Andreeva, Anna
2014-01-01
This paper focuses on childbirth in Japan's aristocratic households during the Heian period (794-1185). Drawing on various sources, including court diaries, visual sources, literary records, and Japan's first medical collection, with its assortment of gynaecological and obstetric prescriptions, as well as Buddhist and other ritual texts, this short excursion into the cultural history of childbirth offers an insight into how childbirth was experienced and managed in Heian Japan. In particular, it addresses the variety of ideas, knowledge systems and professionals involved in framing and supporting the process of childbirth in elite households. In so doing, it casts light on the complex background of early Japanese medicine and healthcare for women.
Introductory Overview of Stone Heritages in Japan
Kato, Hirokazu; Oikawa, Teruki; Fujita, Masayo; Yokoyama, Shunji
2013-04-01
As one contribution to 'Global Heritage Stone Resources' (GHSR), some stone heritages in Japan, which are nominated in the interim list, are briefly introduced. The geology of Japanese Islands where are the one of the most active areas in the history of the Earth, is very complicated. Therefore Japanese Islands consist of various kinds of minerals and rocks. Some of them were used to make stone implements and accessories. Japanese people also used to the best possible advantage to built tombstone, gate, pavement ,and the basement and wall of the large building such as temples, shrines, castles and modern buildings. 1. Stone Heritages of Pre-historical age: In the late Pleistocene and the early Holocene, ancient Japanese used obsidian cooled rapidly from rhyolitic magma.to make small implements and accessories. For example, Shirataki, Hokkaido (north island) is the largest place producing obsidian in Japan where Paleolithic people made arrowhead, knives and so on. Another example, Jade yielded in Itoigawa City, Japan Sea coast of central Japan, was made in the metamorphic rock about five hundred million years ago. Itoigawa area is only one place where jade is abundantly produced in Japan. Ancient people had been already collected and processed to ornaments although it is very hard and traded in wide area more than several thousand years ago. 2. Stone Heritages of Historical age: 2.1 Archaeological remains: In the Kofun (old mound) period (250 to 538 AD), stone burial chambers were used for old mounds to preserve against the putrefaction and to protect from the theft. For example, Ishibutai Kofun ("ishi" means "stone" and "butai" means "stage") in Nara old capital city, southwest Japan, is the largest known megalithic structure made of granite in Japan. 2.2 Stone walls of some typical castles Stones used is because of not only the rich reserves of rocks but also restriction of transportation. Osaka (second biggest city) castle, are composed of Cretaceous granite
Explaining Meiji Japans Top Down Revolution
2017-12-01
Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction...Modernization in Japanese Culture, ed. Donald H. Shively (Princeton, NJ: Princeton University Press, 1971), 93–97. 24 David J. Lu, Japan: A Documentary ...but also took advantage of international developments. Japan managed to alter the unequal treaties with his oversight. The Japanese began to study an
Japan's Fiscal Policy and Fiscal Reconstruction
Ihori, Toshihiro; Nakamoto, Atsushi
2005-01-01
This paper investigates the macroeconomic effects of fiscal policy and the fiscal reconstruction movement in Japan. We first summarize Japan's fiscal policy in recent years and discuss advantages and disadvantages of government deficits. Next, we investigate the macroeconomic effects of Japanese fiscal policy and evaluate the plausibility of non-Keynesian effects. We also analyze the possibility of the crowding-in effect of fiscal policy and investigate the spillover effects of deregulation. ...
Trauma and posttraumatic stress disorder in Japan: Results from the World Mental Health Japan Survey
Kawakami, Norito; Tsuchiya, Masao; Umeda, Maki; Koenen, Karestan C.; Kessler, Ronald C.
2014-01-01
The purpose of the study was to report the prevalence of trauma exposure and PTSD, conditional risk of PTSD associated with each trauma exposure in the community population in Japan. An interview survey was conducted of a random sample of adult residents in 11 communities of Japan. Among 4134 respondents (response rate, 55%), data from those who completed the part 2 interview (n = 1682) were analyzed with a weight for this subsample. Lifetime experiences of 27 trauma events and PTSD were assessed using the WHO-Composite International Diagnostic Interview version 3.0. Sixty percent of the part 2 sample reported exposure to at least one lifetime traumatic event. Lifetime and 12-month PTSD prevalences were 1.3% and 0.7%, respectively. Percentage of all months lived with PTSD in the population was predominantly accounted for by physical/sexual assaults and having a child with serious illness, and unexpected death of loved one. Ten percent of respondents reported “private events”, for which respondents did not have to describe the content, which accounted for 19% of months with PTSD. The lower prevalence of PTSD in Japan seems attributable to lower conditional risks of PTSD following these events, as well as different distributions of the events. The greater impact of events that occurred to loved ones rather than to oneself and “private events” on PTSD in Japan warrants further research of cross-cultural assessment of trauma exposure and cultural heterogeneity in the trauma-PTSD relationship. PMID:24572682
The cause of larger local magnitude (Mj) in western Japan
Kawamoto, H.; Furumura, T.
2017-12-01
The local magnitude of the Japan Meteorological Agency (JMA) scale (Mj) in Japan sometimes show a significant discrepancy between Mw. The Mj is calculated using the amplitude of the horizontal component of ground displacement recorded by seismometers with the natural period of T0=5 s using Katsumata et al. (2004). A typical example of such a discrepancy in estimating Mj was an overestimation of the 2000 Western Tottori earthquake (Mj=7.3, Mw=6.7; hereafter referred to as event T). In this study, we examined the discrepancy between Mj and Mw for recent large earthquakes occurring in Japan.We found that the most earthquakes with larger Mj (>Mw) occur in western Japan while the earthquakes in northern Japan show reasonable Mj (=Mw). To understand the cause of such larger Mj for western Japan earthquakes we examined the strong motion record from the K-NET and KiK-net network for the event T and other earthquakes for reference. The observed ground displacement record from the event T shows a distinctive Love wave packet in tangential motion with a dominant period of about T=5 s which propagates long distances without showing strong dispersions. On the other hand, the ground motions from the earthquakes in northeastern Japan do not have such surface wave packet, and attenuation of ground motion is significant. Therefore, the overestimation of the Mj for earthquakes in western Japan may be attributed to efficient generation and propagation properties of Love wave probably relating to the crustal structure of western Japan. To explain this, we then conducted a numerical simulation of seismic wave propagation using 3D sedimentary layer model (JIVSM; Koketsu et al., 2012) and the source model of the event T. The result demonstrated the efficient generation of Love wave from the shallow strike-slip source which propagates long distances in western Japan without significant dispersions. On the other hand, the generation of surface wave was not so efficient when using a
75 FR 67105 - Granular Polytetrafluoroethylene Resin From Italy and Japan
2010-11-01
... Polytetrafluoroethylene Resin From Italy and Japan AGENCY: United States International Trade Commission. ACTION... resin from Italy and Japan. SUMMARY: The Commission hereby gives notice that it has instituted reviews... revocation of the antidumping duty orders on granular polytetrafluoroethylene resin from Italy and Japan...
Memento. Maritime transport of MOX fuels from Europe to Japan
International Nuclear Information System (INIS)
1999-07-01
The maritime transport of MOX fuels from Europe to Japan represents the last of the 3 steps of transport of the nuclear fuel reprocessing-recycling program settled between ORC (Japan), BNFL (UK) and Cogema (France). This document summarizes the different aspects of this program: the companies concerned, the physical protection measures, the US-Japan agreements (accompanying warship), the in-depth safety, the handling of MOX fuels (containers and ships), and the Japan MOX fuel needs. (J.S.)
Present status of marine environmental radioactivity survey in the sea of Japan
International Nuclear Information System (INIS)
Matsuoka, H.
1994-01-01
Science and Technology Agency has been conducting some Marine Environmental Radioactivity Surveys around Japan in cooperation with the relevant organizations (Maritime Safety Agency, Japan Meteorological Agency, Fishery Agency, National Institute of Radiological Sciences, Japan Marine Science and Technology Center, Japan Chemical Analysis Center and Marine Ecology Research Institute). Several artificial radionuclides have been detected but the main origin is supposed to be fall-out. The level trend of marine environmental radioactivity has no anomalies excepting the effect of Chernobyl Accident. The data summarized here are as follows. 1. Marine Environmental Survey of Fisheries near the Nuclear Power Stations, 2. Past Data of Marine Environmental Radioactivity around Japan (Apr. 1982 - Mar. 1991), 3. Marine Environmental Survey of the Sea of Japan (spring, 1993), 4. Marine Environmental Survey of the Sea of Japan (autumn, 1993). In addition, JAPAN-KOREA-RUSSIA JOINT EXPEDITION in the Sea of Japan will start in the middle of March. We are expecting to get valuable data through the EXPEDITION. (J.P.N.)
Courtesy and the challenges of implementing smoke-free policies in Japan.
Bialous, Stella Aguinaga; Mochizuki-Kobayashi, Yumiko; Stillman, Frances
2006-04-01
For decades, the tobacco companies have developed a worldwide campaign to oppose the creation of smoke-free environments. Public health efforts to promote clean indoor air have been uneven throughout the world, and in few places have such efforts faced as many challenges as in Japan. The Japanese market is dominated by Japan Tobacco, which is partly owned by the government, and Philip Morris International is also present in Japan. Japan Tobacco and Philip Morris International have developed campaigns promoting courtesy and tolerance that, until recently, seem to have resonated well with the public. The companies also have supported research promoting ventilation and have funded consultants to act as experts in the area of second-hand smoke exposure. Japan is a critical country to study, partly because of the strength of Japan Tobacco in the country and the growth of Japan Tobacco International in Southeast Asia and the rest of the world, and partly because of Japan's ratification of the World Health Organization Framework Convention on Tobacco Control. This paper uses tobacco industry documents to provide an overview of the tobacco industry's scientific and political efforts to stifle the development of clean indoor measures in Japan. Learning past industry strategies may assist policymakers and advocates in the development of future public health activities.
International Nuclear Information System (INIS)
Kurasawa, Hajime; Konda, Tadashi.
1986-01-01
Strontium isotopic ratios of sixty-seven Tertiary volcanic rocks from the northeastern Honshu, Japan, were determined for the purpose of examining the genesis among the volcanic rocks. Two distince suites of volcanic rocks occur in the northeastern Honshu; the rocks older than 16 Ma (Monzen-Daijima Stege) of predominantly intermediate composition and the rocks younger than 16 Ma (Nishikurosawa-Funakawa Stege) with bimodal suite of mafic and felsic composition. Initial values of 87 Sr/ 86 Sr in the Teriary volcanic rocks from the northeastern Honshu, lie in the range from 0.7033 to 0.7068. High ( 87 Sr/ 86 Sr) I ratios are observed for the rocks older than 16 Ma from the Japan Sea side (H zone). It is noteworthy that the rocks younger than 16 Ma show significantly lower ( 87 Sr/ 86 Sr) I ratios in the Dewa Hill, Japan Sea coast and North Akita areas in the northeastern Honshu (L zone). The rocks younger than 16 Ma from the L zone can also be interpreted as having been originated as a mantle-diapir associated with the spreading of the Japan Sea basin. If the basaltic magma was formed from the diapir, the 87 Sr/ 86 Sr ratio would be close to the range from 0.7033 to 0.7037 as the low-Sr isotopic ratio zone (L zone) in the northeastern Honshu, Japan. (author)
Revitalizing US electronics lessons from Japan
Sprague, John
1993-01-01
Written by one of the few executives who have extensive experience in the electronics industry in both the US and Japan, this book compares market research, design, and manufacturing techniques as used in both countries. Unlike other books on theJapanese business culture, Sprague gives specific advice and recommendations about what companies can do now to compete with Japan, clearly pointing out what is and what is not adaptable from the Japanese approach to business.
Testing the Nuclear Will of Japan
2007-12-01
particularly the United States. This was significant because a soured economic relationship would undoubtedly affect the U.S.-Japan security...around the world, has sometimes soured its image as a serious international player.136 This is because many of the world’s great powers have extended...for International Exchange, 2005. Beer , Lawrence W. “Japan Turning the Corner.” Asian Survey 11, no. 1 (January 1971): 74 – 85. Bueno de Mesquita
Explaining Meiji Japan's top-down revolution
McClain, Kendra M.
2017-01-01
Approved for public release; distribution is unlimited Meiji Japanese leaders consisted of an oligarchy that strived to overcome Western imperialist pressures in Asia. They did so by overturning some deeply rooted Tokugawa-Era traditions in Japanese society and replaced them with Western ones. They understood that Western norms dictated world affairs, so they sought to make Japan strong along Western norms. Modeling the West provided enough traction for Japan to meet Western threats and ma...
Status report of shielding investigation in Japan
International Nuclear Information System (INIS)
Shindo, M.
1964-01-01
The Japan Atomic Energy Research Institute (JAERI) was established in 1954, and immediately proceeded with the construction of a research reactor. The first symposium in Japan on nuclear energy was held in 1957. Most of the papers presented in the field of reactor shielding were limited to shielding materials and their fabrication. In the first stage of our investigations, our efforts were devoted to practical design studies of reactor shielding. As a result of these studies, it was found that the formulae at hand for calculations were inadequate, but at that time no electronic computer was available in Japan nor were theoretical calculations very actively undertaken. Problems on nuclear ship shielding had been investigated at the Ship Research Institute, since 1956 and many fruitful results had been obtained. About that time the Japan Atomic Industry Forum started activities and took the initiative in organizing shielding research. Research workers in the shipbuilding industry in particular have been seriously studying shielding problems. Few years after the first symposium, problems concerning more fundamental studies were treated by many research workers. Shielding experiments using radioisotopes were carried out and many fruitful results were obtained. They are described in the this paper. Medium size electronic computers became available in Japan, permitting a theoretical study group to make an active contribution. They produced some codes, and their results are also described in the following sections. This constituted the second stage of our investigations. A swimming-pool reactor, JRR-4 (Japan Research Reactor-4), has been under construction at JAERI since 1962 and will become critical in autumn 1964. After characteristic tests it will be a very powerful tool for the shielding investigations. This id the beginning of the third stage of investigations
Toward freedom from cancer pain in Japan.
Otsuka, Kuniko; Yasuhara, Hajime
2007-01-01
Life expectancy in Japan is highest in the world. Cancer is the leading cause of mortality in Japan, accounting for about 30 percent of all deaths. Many Japanese cancer patients experience severe pain although they and their families hope to be pain free at the end of their lives. Toward that end, the consumption of morphine in Japan has increased markedly since 1989. The amount of morphine hydrochloride and morphine sulfate consumed in 2001 was 6.1 times that used in Japan in 1989. However, the amount of morphine consumed in Japan is still less than in other developed nations, and was only one-sixth of the amount used in Australia in 2001. As a result, many Japanese cancer patients experience potentially manageable cancer pain, largely because the amount of the drug used by doctors is insufficient for pain control. An increasing number of Japanese doctors now understand that their patients' quality of life is most important in end-of-life care and how to use the three step analgesic ladder of the World Health Organization (WHO). However, other doctors do not understand these issues sufficiently causing some patients to die without good pain control. Both the general population and some medical professionals misunderstand and have prejudice against the use of morphine. Patients often do not participate in decision making about medical treatment because of remaining paternalism in the relationship between Japanese doctors and patients. Thus, cancer pain management in Japan is not as effective as it can be and not all Japanese cancer patients receive appropriate management for their cancer pain. To improve outcomes for Japanese patients, it is necessary for health professional and social work students and practicing professionals to receive contemporary education including an introduction to palliative care and ethics.
Reactor construction programme in Japan
Energy Technology Data Exchange (ETDEWEB)
NONE
1959-04-15
In September last year, the Japanese Government requested the International Atomic Energy Agency to supply three tons of natural uranium for a research reactor, and the Agency has now arranged for its sale to Japan. The metal will be supplied in ingot form and after fabrication it will be used as fuel in a reactor of the natural uranium, heavy water type. The uranium will be obtained from Canada and sold to Japan by IAEA. The Agency had invited tenders for its supply, and after considering the tenders received, the Agency's Board of Governors decided that the Canadian offer to the Agency of three tons of natural uranium free of charge should be accepted and that the selling price to Japan should be US $35. 50 per kilogramme. The price takes into account Article XIV/E of the Agency's Statute which says that the Agency shall establish a scale of charges (including those for storage and handling) for materials furnished to Member States, and that the scale shall be designed to produce revenues to meet expenses in connexion with materials acquired by the Agency and costs of materials and services provided by it under agreements with one or more members. This is the first operation of its kind to be undertaken by the Agency, and the reactor for which the supply is being made will be the first in Japan to be constructed by Japanese scientists and technicians. IAEA's Board of Governors has given the necessary approval to the reactor project for which the Agency is providing assistance
Tanabe, Hitoshi
2015-09-01
Gambling disorder is a psychiatric disorder characterized by persistent and recurrent problematic gambling behavior, associated with impaired functioning, reduced quality of life, and frequent divorce and bankruptcy. Gambling disorder is reclassified in the category Substance-Related and Addictive Disorders in the DSM-5 because its clinical features closely resemble those of substance use disorders, and gambling activates the reward system in brain in much the same way drugs do. Prevalence of gambling disorder in Japan is high rate because of slot machines and pachinko game are very popular in Japan. The author recommend group psychotherapy and self-help group (Gamblers Anonymous), because group dynamics make them accept their wrongdoings related to gambling and believe that they can enjoy their lives without gambling.
China's air pollution and Japan's response to it
International Nuclear Information System (INIS)
Matsuura, S.
1995-01-01
Long-range transport of air pollutants has been a serious global environment problem. Japan's Central Research Institute of Electric Power Industry (CRIEPI) researchers are investigating the possibility of acid rain from China. So far, the acid rain that has appeared in Japan has not had a significant effect. However, because of the high economic growth projected for the coming years in China, acidic fallout from that country is likely to cause serious damage there and in Japan as well. China is one of the largest coal users in the world. One of the biggest factors making air quality worse is the lack of appropriate technologies. Although Japanese desulfurization technologies are well advanced, they cannot be directly applied to stationary pollution sources in China, because of their cost. Japan has sophisticated technologies, but lacks experience in and knowledge of alternative, intermediate, and low-technology solutions. Given this, Japan may attempt to buy pollution control technology equipment from the United States, which provides a wider range of desulfurization technologies, as a part of the Official Development Assistance program. At the same time, international support that includes the establishment of additional global environmental monitoring stations in China are also necessary
Policy of Japan of radioactive waste management
International Nuclear Information System (INIS)
Oyama, A.
1989-01-01
Development and utilization of nuclear power has been steadily pursued in Japan in order to secure a stable source of energy over a long-term period. According to the author, nuclear power plants are operated carefully and safely and have been generating electricity for more than twenty years. In fact, it now accounts for approximately 30% of total electricity generated, and has become an integral part of the energy supply in Japan. The benefits of nuclear technology are now enjoyed not only in the electricity production, but also in the fields such as medicine and other industries. Under such circumstances, radioactive waste management generated in nuclear power plants and reprocessing plants as well as in industrial and medical uses of radiation, is an important part of the nuclear energy policy, and there is also a strong public interest in this field. The government is active in formulating waste management policies based on the basic policies indicated by Japan ATomic Energy Commission (JAEC). This presentation will touch upon the future perspective of radioactive waste management policy in Japan
Introduction of nuclear medicine research in Japan
Energy Technology Data Exchange (ETDEWEB)
Inubushi, Masayuki [Kawasaki Medical School, Division of Nuclear Medicine, Department of Radiology, Kurashiki, Okayama (Japan); Higashi, Tatsuya [National Institutes of Quantum and Radiological Science and Technology, National Institute of Radiological Sciences, Chiba, Chiba (Japan); Kuji, Ichiei [Saitama Medical University International Medical Center, Department of Nuclear Medicine, Hidaka-shi, Saitama (Japan); Sakamoto, Setsu [Dokkyo University School of Medicine, PET Center, Mibu, Tochigi (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai, Miyagi (Japan); Momose, Mitsuru [Tokyo Women' s Medical University, Department of Diagnostic Imaging and Nuclear Medicine, Tokyo (Japan)
2016-12-15
There were many interesting presentations of unique studies at the Annual Meeting of the Japanese Society of Nuclear Medicine, although there were fewer attendees from Europe than expected. These presentations included research on diseases that are more frequent in Japan and Asia than in Europe, synthesis of original radiopharmaceuticals, and development of imaging devices and methods with novel ideas especially by Japanese manufacturers. In this review, we introduce recent nuclear medicine research conducted in Japan in the five categories of Oncology, Neurology, Cardiology, Radiopharmaceuticals and Technology. It is our hope that this article will encourage the participation of researchers from all over the world, in particular from Europe, in scientific meetings on nuclear medicine held in Japan. (orig.)
Current status of the nuclear medicine in Japan
International Nuclear Information System (INIS)
Torizuka, K.
1974-01-01
A brief survey of the current status of Japan nuclear medicine is given. The following data are described (from the material of the 11th Japan Conference of Radioisotopes): 1. the increase of the number of nuclear instruments between 1971 and 1973; 2. the total amount of the cobalt radiation apparatur (inclusive of the cesium apparatus) in the hospitals in 1971- and 1972; 3. the radioactive medicines and nuclids used in Japan; 4. the radioactive isotopes used generally in the therapeutics in 1971 and 1972; 5. the question of labour. (K.A.)
77 FR 64487 - Renewable Energy Policy Business Roundtable in Japan
2012-10-22
... Roundtable in Japan AGENCY: International Trade Administration, Department of Commerce. ACTION: Revised... conjunction with the U.S.-Japan Energy Policy Dialogue. The U.S. Department of Energy--the lead U.S. agency... more about the policy and regulatory landscape for renewable energy developing in Japan at this time...
The educational system in Japan
Spearman, M. L.
1986-01-01
The rapid economic growth of Japan since World War II has resulted in Japan becoming a reference point for developing nations and the West. This remarkable growth results from a combination of factors, one of which has been unyielding attention to education in order to cultivate the human talent necessary to provide the productivity for economic growth. The Japanese education system emphasizes quality of instruction and rewards hard work. Some of the principles of the system are outlined together with a summary of the content of the curriculum, the quantity and quality of instruction, and the influence of culture and environment.
The UK-Japan Young Scientist Workshop Programme...
Albone, Eric; Okano, Toru
2012-01-01
The authors have been running UK-Japan Young Scientist Workshops at universities in Britain and Japan since 2001: for the past three years in England with Cambridge University and, last year, also with Kyoto University and Kyoto University of Education. For many years they have worked jointly with colleagues in a group of Super Science High…
76 FR 8774 - Granular Polytetrafluoroethylene Resin From Japan
2011-02-15
... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-386 (Third Review)] Granular Polytetrafluoroethylene Resin From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five... revocation of the antidumping duty order on granular polytetrafluoroethylene resin from Japan would be likely...
Getting to Grips Again with Dependency. Japan's Energy Strategy
International Nuclear Information System (INIS)
Chrisstoffels, J.H.
2007-08-01
Japan has had to deal with a high level of dependency on energy imports for many decades. Today the country faces an increasingly competitive global energy market that forces it to reinvent its traditional security of supply policies. Unfortunately for Japan, the rise of China and India is increasing the competition for scarce energy supplies among consumer countries, whereas in the past supplier countries competed for access to the attractive Japanese market. To confront the challenges of the new environment the Japanese government has drafted a New National Energy Strategy. This paper analyses the strength of the strategy's proposals and targets, in particular those aimed at improving security of oil and gas supply. To assess the impact of the strategy we place it firmly against the background of Japan's history of energy security policy, as well as Japan's recent experiences with 'strategic resource projects'. This paper finds that Japan's policies in post-1973 history have been impeded by a complex set of factors. Traditionally this set has included Japan's troubled bilateral relations with Russia and China, and Japan's security dependence on the United States. Other factors are Japan's inability to synchronise national and corporate interests, and a lack of cooperation between domestic energy companies. More recently, rising oil prices, growing resource competition with China and lacklustre domestic demand-growth for energy have increased anxiety about security of supply amongst policymakers in Tokyo. In three case studies the paper illustrates in detail how these factors - in combination or by themselves - have structurally compromised Japanese initiatives to improve security of supply. The case studies discuss the Azadegan oil development project in Iran, plans for a pan-Siberian oil pipeline, and the oil and gas projects on Russia's Sakhalin Island. Our analysis of the New National Energy Strategy confirms that energy security is back on Japan's policy
77 FR 60380 - Renewable Energy Policy Business Roundtable in Japan
2012-10-03
... Roundtable in Japan AGENCY: International Trade Administration, Department of Commerce. ACTION: Notice... December 3, 2012 in Tokyo in conjunction with the U.S.-Japan Energy Policy Dialogue. The U.S. Department of... roundtable and other related events will be held in Japan the week of December 3-7, 2012. Participants must...
Theorizing School Bullying: Insights from Japan
Shoko Yoneyama
2015-01-01
This paper identifies a lacuna in the existing paradigms of bullying: a gap caused by the frame of reference being largely limited to the highly industrialized societies of the 'west': Europe, North America and Oceania. The paper attempts to address this gap by presenting research developed in Japan. In Japan, sociological discourse on school bullying, i.e. the analysis of institutional factors relevant to understanding bullying was established relatively early, as was the epistemology now re...
What is nuclear power in Japan?
Suzuki, Toshikazu
2011-03-01
The aggressive use of such non-fossil energy as the atomic energy with high power density and energy production efficiency is an indispensable choice aiming at the low-carbon society. There is a trial calculation that the carbon dioxide emission of 40000 ton can be suppressed by nuclear power generation by one ton of uranium. The basis of nuclear research after the Second World War in Japan was established by the researchers learnt in Argonne National Laboratory. In 2010, NPPs under operation are 54 units and the total electric generating power is 48.85GW. The amount of nuclear power generation per person of the people is 0.38kW in Japan, and it is near 0.34kW of the United States. However, the TMI accident and the Chernobyl disaster should have greatly stagnated the nuclear industry of Japan although it is not more serious than the United States. A lot of Japanese unconsciously associate a nuclear accident with the atomic bomb. According to the investigation which Science and Technology Agency carried out to the specialist in 1999, ``What will be the field where talent should be emphatically sent in the future?'' the rank of nuclear technology was the lowest in 32 fields. The influence of the nuclear industry stagnation was remarkable in the education. The subject related to the atomic energy of a university existed 19 in 1985 that was the previous year of the Chernobyl disaster decreased to 7 in 2003. In such a situation, we have to rely on the atomic energy because Japan depends for 96% of energy resources on import. The development of the fuel reprocessing and the fast breeder reactor has been continued in spite of a heavy failure. That is the only means left behind for Japan to be released from both fossil fuel and carbon dioxide.
76 FR 8773 - Superalloy Degassed Chromium From Japan
2011-02-15
... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-1090 (Review)] Superalloy Degassed Chromium From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five-year... revocation of the antidumping duty order on superalloy degassed chromium from Japan would be likely to lead...
Role of fast breeders in Japan
International Nuclear Information System (INIS)
Oyama, A.; Tomabechi, K.
1978-09-01
To meet increasing future energy demand in Japan utilization of fission energy should be promoted. In particular it is of vital importance to develop and utilize FBRs as soon as possible in order to save the natural uranium needed. If one considers the commercial introduction of FBRs in the mid-1990s in Japan, a delay of only one year will eventually result in an additional demand for natural uranium of more than 20,000 tons, because several LWRs will have to be installed instead. Ten years have passed since the development of FBRs in Japan was initiated as a national project with the highest priority and now the experimental fast reactor JOYO is successfully being operated at 50MW and the prototype fast breeder reactor MONJU has reached the stage of proceeding to construction with a schedule of operation in the mid-1980s. Following operation of MONJU, construction of a large demonstration reactor of 1000 - 15000 MW(e) will be undertaken. Some 2 - 3 years after the construction of the demonstration reactor, a series of reactors will be constructed similar in size and design to promote commercialization of LMFBRs. Strong efforts will be made to put this programme into practice. It is expected that LMFBRs will play an important role in mitigating the serious problem of energy supply in Japan foreseeable around the turn of the century
Establishment of 'Japan Atomic Energy Agency'. Its role and expectation
International Nuclear Information System (INIS)
Nakahara, Toru; Itakura, Shuichiro; Shiozawa, Shusaku; Hino, Ryutaro; Fujii, Yasuhiko; Sakurada, Michio; Kimura, Itsuro; Kikuyama, Kaoru
2005-01-01
In October 2005, the Japan Atomic Energy Agency (JAEA) was established as an independent administrative institution with the integration of the Japan Atomic Energy Research Institute (JAERI) and the Japan Nuclear Cycle Development Institute (JNC). JAEA is the only institute in Japan dedicated to comprehensive research and development in the field of nuclear energy. This paper put together a special article on its role and expectation. Firstly the essentials of comprehensive nuclear research and its future perspective were discussed mainly based on 'Framework for Nuclear Energy Policy' of the Atomic Energy Commission of Japan. Eight articles were followed on specific items such as quantum beams utilization, hydrogen production with nuclear heat, neutron science and ITER project, and put stress on joint works and smooth transfer of related technology to the private sector. (T. Tanaka)
Neuropsychology in Japan: history, current challenges, and future prospects.
Sakamoto, Maiko
2016-11-01
The purpose of this special issue was to describe the cross-cultural differences in neuropsychology throughout the world. The current state of neuropsychology in Japan is discussed in this manuscript. Information on six topics, including (1) the history of Japanese neuropsychology, (2) licensure system, (3) job opportunities, (4) neuropsychological clinical services, (5) neuropsychological tests, and (6) neuropsychological research, was gathered via literature searches, official organization websites, and personal communication with clinical psychologists and other professionals in Japan. Neuropsychology reached Japan from the west in the late 1800s, a period of rapid political and social modernization. Professional associations were founded in the 1960s and 1970s and continued to grow. The need for neuropsychological assessment in Japan is growing; however, credential requirements for neuropsychologists have not yet been established. To practice clinical psychology in Japan, one must obtain a Master's degree and pass a licensure examination that is administered by a private professional foundation. Clinical psychologists often conduct neuropsychological tests; however, they have little training in neuropsychological assessment. While many western neuropsychological tests have been translated into Japanese and are used in clinical settings, the majority of translated tests have not been standardized and their psychometric properties remain poorly understood. Standardization and development of normative data in Japan is warranted. Given that needs for neuropsychological services are increasing, it is essential for clinical psychologists in Japan to improve their skills in neuropsychological evaluations. Japanese graduate schools must work to establish neuropsychology programs to educate and train clinical neuropsychologists.
Development of clean coal technologies in Japan
Energy Technology Data Exchange (ETDEWEB)
Sato, M. [Electric Power Research Industry, Yokosuka (Japan). Central Research Inst.
2013-07-01
In Japan, we have to import almost of primary energy resources from all over the world. We depend on foreign countries for 96% of our primary energy supply. Following the two oil crises in the 1970s, Japan has diversified its energy resources through increased use of nuclear energy, natural gas and coal as well as the promotion of energy efficiency and conservation.
Internet Ethics Issues and Actions in Japan
江澤, 義典
2013-01-01
The International Symposium on Internet Ethics 2012 was planned and organized by the Korea Internet Security Agency and was held in September 2012 at the Lotte Hotel World in Seoul. This note relates to the presentation in Japan, it outlines current Internet ethics issues and actions in Japan. Moreover, four aspects of Japanese civilization were introduced as the bases of these ethics issues.
Low level waste solidification practice in Japan
International Nuclear Information System (INIS)
Sakata, S.; Kuribayashi, H.; Kono, Y.
1981-01-01
Both sea dumping and land isolation are planned to be accomplished for low level waste disposal in Japan. The conceptual design of land isolation facilities has been completed, and site selection will presently get underway. With respect to ocean dumping, safety surveys are being performed along the lines of the London Dumping Convention and the Revised Definitions and Recommendations of the IAEA, and the review of Japanese regulations and applicable criteria is being expedited. This paper discusses the present approach to waste solidification practices in Japan. It reports that the bitumen solidification process and the plastic solidification process are being increasingly used in Japan. Despite higher investment costs, both processes have advantages in operating cost, and are comparable to the cement solidification process in overall costs
Marital Adjustment and Psychological Distress in Japan
Li, Angela; Robustelli, Briana L.; Whisman, Mark A.
2016-01-01
This study was conducted to examine the association between marital adjustment and psychological distress in a large, probability sample of married adults in Japan (N = 710) from the Midlife Development in Japan (MIDJA) study. Results indicate that positive and negative dimensions of marital adjustment were significantly associated with dimensional and categorical measures of psychological distress. Furthermore, the associations between marital adjustment and psychological distress remained significant when statistically controlling for neuroticism, quality of friend and family relationships, and demographic variables. These results demonstrate that the well-established association between marital adjustment and psychological distress found in European-American countries is also found in Japan. Findings support continued research on marital functioning and psychological distress in East Asian countries. PMID:28082761
International Nuclear Information System (INIS)
Toge, Nobu
1993-01-01
This paper presents a brief report on the present status of future accelerator projects at the National Laboratory for High Energy Physics (KEK), Japan. The KEK laboratory has been successfully operating the TRISTAN accelerator complex since 1986. It consists of a 2.5 GeV electron/positron linac, an 8 GeV Accumulation Ring (AR) and a 29 GeV Main Ring (MR). Concurrently with this operation, in response to recommendations by the Japanese High Energy Physics Committee, survey studies have been continued on new accelerator facilities at KEK. They have two major future projects, namely, the asymmetric e + e - B-factory based on TRISTAN (TRISTAN-II) and the Japan Linear Collider (JLC). The purpose of this paper is to outline those research activities and to present an update on their status
Country Report on Building Energy Codes in Japan
Energy Technology Data Exchange (ETDEWEB)
Evans, Meredydd; Shui, Bin; Takagi, T.
2009-04-15
This report is part of a series of reports on building energy efficiency codes in countries associated with the Asian Pacific Partnership (APP) - Australia, South Korea, Japan, China, India, and the United States of America (U.S.). This reports gives an overview of the development of building energy codes in Japan, including national energy policies related to building energy codes, history of building energy codes, recent national projects and activities to promote building energy codes. The report also provides a review of current building energy codes (such as building envelope, HVAC, and lighting) for commercial and residential buildings in Japan.
Measuring energy poverty in Japan, 2004–2013
International Nuclear Information System (INIS)
Okushima, Shinichiro
2016-01-01
This paper first examines energy (or fuel) poverty in Japan from 2004 to 2013, especially around the time of the 2011 Great East Japan Earthquake (GEJE). To analyze the issue, the paper employs various poverty and vulnerability measures with the assistance of our unique dataset. The results indicate the aggravation of energy poverty among lower-income and vulnerable households during the past decade, resulting from both the escalation of energy prices and lowering of income. The analysis also employs a new decomposition technique and identifies the explanatory factors associated with the increase in energy poverty. These results suggest there were major changes in the forces driving the increase in energy poverty before and after the GEJE. After 2011, income alleviates energy poverty in Japan, with energy prices becoming the main driving factor. - Highlights: • This study is the first evaluation of energy poverty in Japan by unique microdata. • Focus on the period of the 2011 Great East Japan Earthquake and Fukushima accident. • Shows the aggravation of energy poverty among lower-income and vulnerable households. • Identifies factors accounting for the changes in energy poverty by decomposition. • Major changes in the explanatory factors before and after the Fukushima accident.
Climate Change Taxes and Energy Efficiency in Japan
International Nuclear Information System (INIS)
Kasahara, S.; Paltsev, S.; Reilly, J.; Jacoby, H.; Ellerman, A.D.
2007-01-01
In 2003 Japan proposed a Climate Change Tax to reduce its CO2 emissions to the level required by the Kyoto Protocol. If implemented, the tax would be levied on fossil fuel use and the revenue distributed to encourage the purchase of energy efficient equipment. Analysis using the MIT Emissions Prediction and Policy Analysis (EPPA) model shows that this policy is unlikely to bring Japan into compliance with its Kyoto target unless the subsidy encourages improvement in energy intensity well beyond Japan's recent historical experience. Similar demand-management programs in the US, where there has been extensive experience, have not been nearly as effective as they would need to be to achieve energy efficiency goals of the proposal. The Tax proposal also calls for limits on international emission trading. We find that this limit substantially affects costs of compliance. The welfare loss with full emissions trading is 1/6 that when Japan meets its target though domestic actions only, the carbon price is lower, and there is a smaller loss of energy-intensive exports. Japan can achieve substantial savings from emissions trading even under cases where, for example, the full amount of the Russian allowance is not available in international markets
International Nuclear Information System (INIS)
Smalyuk, V.A.; Boehly, T.R.; Bradley, D.K.; Goncharov, V.N.; Delettrez, J.A.; Knauer, J.P.; Meyerhofer, D.D.; Oron, D.; Shvarts, D.; Srebro, Y.; Town, R.P.
1999-01-01
Planar, 20 and 40 μm thick CH targets have been accelerated by 351 nm laser beams of the OMEGA laser system [Opt. Commun. 133, 495 (1997)]. Different beam-smoothing techniques were employed including distributed phase plates, smoothing by spectral dispersion, and distributed polarization rotators. The Rayleigh - Taylor evolution of three-dimensional (3D) broadband planar-target perturbations seeded by laser nonuniformities was measured using x-ray radiography at ∼1.3 keV. Fourier analysis shows that the perturbations evolve to longer wavelengths and the shorter wavelengths saturate. The saturation amplitudes and rates of growth of these features are consistent with the predictions of Haan [Phys. Rev. A 39, 5812 (1989)]. copyright 1999 American Institute of Physics
Impacts of the Japan-Mexico EPA on Bilateral Trade
ANDO Mitsuyo; URATA Shujiro
2011-01-01
This paper examines the impacts of the Japan-Mexico EPA on bilateral trade by using two different types of information, trade statistics and the EPA utilization rate. Using trade data, we found that Japan's exports of built-up cars, auto parts, base metals, electrical machinery, precision machinery, and ballpoint pens to Mexico increased sharply. We also found that Japan's imports of live animals and products, leather, and footwear with leather from Mexico increased significantly. These are s...
A review of studies on persuasion in Japan (1)
深田, 博己; 木村, 堅一; 牧野, 幸志; 樋口, 匡貴; 原田, 耕太郎; 山浦, 一保
2001-01-01
The purpose of this study is to review the studies on persuasion in Japan. An examination has been made of 152 persuasion studies published in Japan-141 journal papers and 11 technical books. The present study consists of the following four parts. 1. Overview of persuasion studies in Japan: (1) quantitative characteristics of persuasion studies, (2) change in the number of persuasion studies with the times, (3) viewpoint of the review. 2. General problems of persuasion studies: (1...
Local Government System in Japan
Directory of Open Access Journals (Sweden)
Vladimir V. Redko
2016-12-01
Full Text Available The article is devoted to the issues of the activities of the local government of Japan. Particular attention is drawn to the legal framework and the material basis for the functioning of local self-government bodies. The system of local self-government is considered as a special form of self-government with a specific functional and meaning; system of municipal management and delegation of authority, as well as features of interaction between civil and imperious levels. The allocation of the city with a special status, as well as the financial structure of the local government of Japan, is considered in detail.
[Establishment of anatomical terminology in Japan].
Shimada, Kazuyuki
2008-12-01
The history of anatomical terminology in Japan began with the publication of Waran Naikei Ihan-teimŏ in 1805 and Chŏtei Kaitai Shinsho in 1826. Although the establishment of Japanese anatomical terminology became necessary during the Meiji era when many western anatomy books imported into Janan were translated, such terminology was not unified during this period and varied among translators. In 1871, Tsukumo Ono's Kaibŏgaku Gosen was published by the Ministry of Education. Although this book is considered to be the first anatomical glossary terms in Japan, its contents were incomplete. Overseas, the German Anatomical Society established a unified anatomical terminology in 1895 called the Basle Nomina Anatomica (B.N.A.). Based on this development, Kaibŏgaku Meishŭ which follows the BNA, by Buntarŏ Suzuki was published in 1905. With the subsequent establishment in 1935 of Jena Nomina Anatomica (J.N.A.), the unification of anatomical terminology was also accelerated in Japan, leading to the further development of terminology.
Insights into software development in Japan
Duvall, Lorraine M.
1992-01-01
The interdependence of the U.S.-Japanese economies makes it imperative that we in the United States understand how business and technology developments take place in Japan. We can gain insight into these developments in software engineering by studying the context in which Japanese software is developed, the practices that are used, the problems encountered, the setting surrounding these problems, and the resolution of these problems. Context includes the technological and sociological characteristics of the software development environment, the software processes applied, personnel involved in the development process, and the corporate and social culture surrounding the development. Presented in this paper is a summary of results of a study that addresses these issues. Data for this study was collected during a three month visit to Japan where the author interviewed 20 software managers representing nine companies involved in developing software in Japan. These data are compared to similar data from the United States in which 12 managers from five companies were interviewed.
Japan's spent fuel and plutonium management challenge
International Nuclear Information System (INIS)
Katsuta, Tadahiro; Suzuki, Tatsujiro
2011-01-01
Japan's commitment to plutonium recycling has been explicitly stated in its long-term program since 1956. Despite the clear cost disadvantage compared with direct disposal or storage of spent fuel, the Rokkasho reprocessing plant started active testing in 2006. Japan's cumulative consumption of plutonium has been only 5 tons to date and its future consumption rate is still uncertain. But once the Rokkasho reprocessing plant starts its full operation, Japan will separate about 8 tons of plutonium annually. Our analysis shows that, with optimum use of available at-reactor and away-from-reactor storage capacity, there would be no need for reprocessing until the mid-2020s. With an additional 30,000 tons of away-from-reactor (AFR) spent-fuel storage capacity reprocessing could be avoided until 2050. Deferring operation of the Rokkasho plant, at least until the plutonium stockpile had been worked down to the minimum required level, would also minimize international concern about Japan's plutonium stockpile. The authors are happy to acknowledge Frank von Hippel, Harold Feiveson, Jungming Kang, Zia Mian, M.V. Ramana, and other IPFM members, as well as the generous grant from the MacArthur Foundation for helping make this research possible.
The Issue of Diversity and Multiculturalism in Japan
Qi, Jie; Zhang, Sheng Ping
2008-01-01
The purpose of this paper is to problematize that which has been taken for granted about the notion of multiculturalism in Japan. Multiculturalism is a "hot" issue in Japan. As the Japanese government started to promote "internationalization" since 1980s, slogans such as "international exchange," "cultural…
De novo malignancy after pancreas transplantation in Japan.
Tomimaru, Y; Ito, T; Marubashi, S; Kawamoto, K; Tomokuni, A; Asaoka, T; Wada, H; Eguchi, H; Mori, M; Doki, Y; Nagano, H
2015-04-01
Long-term immunosuppression is associated with an increased risk of cancer. Especially, the immunosuppression in pancreas transplantation is more intensive than that in other organ transplantation because of its strong immunogenicity. Therefore, it suggests that the risk of post-transplant de novo malignancy might increase in pancreas transplantation. However, there have been few studies of de novo malignancy after pancreas transplantation. The aim of this study was to analyze the incidence of de novo malignancy after pancreas transplantation in Japan. Post-transplant patients with de novo malignancy were surveyed and characterized in Japan. Among 107 cases receiving pancreas transplantation in Japan between 2001 and 2010, de novo malignancy developed in 9 cases (8.4%): post-transplant lymphoproliferative disorders in 6 cases, colon cancer in 1 case, renal cancer in 1 case, and brain tumor in 1 case. We clarified the incidence of de novo malignancy after pancreas transplantation in Japan. Copyright © 2015 Elsevier Inc. All rights reserved.
Japan's search for identity in the nuclear age
Energy Technology Data Exchange (ETDEWEB)
Kenzaburo, O.
Japan's position has been one of an outsider in the nuclear age at the same time it has been a victim to the first use of atomic weapons. Quoting from Japanese poets and writers, the author constructs a model of the time to create an image of modern Japan's cultural identity as a result of the Meiji Restoration and the close of World War II. The end of the Emperor System and alienation from the rest of Asia are significant consequences of these events. The author feels that current arguments that Japan should arm itself with nuclear weapons ignore the miseries Japan alone has felt and should be restricted. Although a new Japanism which is oriented away from western culture is emerging today, efforts to rediscover the folk culture can also recapture the nonnuclear vision of 1945. (DCK)
Control of radiation sources in Japan
International Nuclear Information System (INIS)
Maki, S.
2001-01-01
The report refers to the regulations for radioactive material in force in Japan, and to the organizations with responsibilities for regulating radiation sources. An outline of the law regulating the use of radiation sources and radioactive materials is provided, including its scope, types of radiation sources under control, exemptions and the system of notification, authorization and inspection. The experience of Japan with orphan sources is presented in three different cases, and the measures carried out to store the orphan sources in safe conditions. (author)
Gender and the Labour Market: Comparing Austria and Japan
Biffl, Gudrun
2006-01-01
Japan and Austria are among the OECD countries with an average labour force participation rate but an above average gender gap as far as employment opportunities and earnings are concerned. In Japan, women in the main working age have a fairly large margin of labour resources not employed in the market economy. In Austria in contrast, the proportion of unused labour resources of mature workers is high, and the gender gap is less pronounced than in Japan, which suggests that a different combin...
A QUARTER CENTURY OF NUCLEAR WASTE MANAGEMENT IN JAPAN
International Nuclear Information System (INIS)
Masuda, S.
2002-01-01
This paper is entitled ''A QUARTER CENTURY OF NUCLEAR WASTE MANAGEMENT IN JAPAN''. Since the first statement on the strategy for radioactive waste management in Japan was made by the Atomic Energy Commission (AEC) in 1976, a quarter century has passed, in which much experience has been accumulated both in technical and social domains. This paper looks back in this 25-year history of radioactive waste management in Japan by highlighting activities related to high-level radioactive waste (HLW) disposal
Satoh, Tetsurou; Isozaki, Osamu; Suzuki, Atsushi; Wakino, Shu; Iburi, Tadao; Tsuboi, Kumiko; Kanamoto, Naotetsu; Otani, Hajime; Furukawa, Yasushi; Teramukai, Satoshi; Akamizu, Takashi
2016-12-30
Thyroid storm is an endocrine emergency which is characterized by multiple organ failure due to severe thyrotoxicosis, often associated with triggering illnesses. Early suspicion, prompt diagnosis and intensive treatment will improve survival in thyroid storm patients. Because of its rarity and high mortality, prospective intervention studies for the treatment of thyroid storm are difficult to carry out. We, the Japan Thyroid Association and Japan Endocrine Society taskforce committee, previously developed new diagnostic criteria and conducted nationwide surveys for thyroid storm in Japan. Detailed analyses of clinical data from 356 patients revealed that the mortality in Japan was still high (∼11%) and that multiple organ failure and acute heart failure were common causes of death. In addition, multimodal treatment with antithyroid drugs, inorganic iodide, corticosteroids and beta-adrenergic antagonists has been suggested to improve mortality of these patients. Based on the evidence obtained by nationwide surveys and additional literature searches, we herein established clinical guidelines for the management of thyroid storm. The present guideline includes 15 recommendations for the treatment of thyrotoxicosis and organ failure in the central nervous system, cardiovascular system, and hepato-gastrointestinal tract, admission criteria for the intensive care unit, and prognostic evaluation. We also proposed preventive approaches to thyroid storm, roles of definitive therapy, and future prospective trial plans for the treatment of thyroid storm. We hope that this guideline will be useful for many physicians all over the world as well as in Japan in the management of thyroid storm and the improvement of its outcome.
HIV/AIDS and professional freedom of expression in Japan.
Matsuda, Masami
2002-07-01
A senior physician with a government role in Japan made a widely reported and misleading statement about Thailand's policy on HIV/AIDS patients. He claimed that in Thailand the policy is to spend public money on the prevention of HIV infection while allowing AIDS patients to die untreated. The author, a community nursing specialist in Japan with first-hand knowledge of HIV/AIDS policy in Thailand, thought that this statement would influence attitudes negatively in Japan. However, speaking out about this misrepresentation of the facts carried certain risks. Although freedom of expression is valued in Japan, in practice it is not easy to contradict senior medical professionals. The author uses his experience of this difficult professional situation to teach nurses how to approach speaking out in the public interest.
Safeguards activities in Japan
International Nuclear Information System (INIS)
Osabe, Takeshi
1998-01-01
Current Japanese State System for Accountancy and Control (SSAC) has been developing and fully satisfies requirements of both IAEA Safeguards and bilateral partners. However, the public attention on the national and international safeguards activities were increased and the safeguards authorities were required to promote the objective assessment of safeguards implementation to avoid mistrust in safeguards activities which directly influence the public acceptance of nuclear energy in itself. Additionally, since Japan has promoted to complete nuclear fuel cycle including spent fuel reprocessing, enrichment and mixed oxide fuel fabrication this would require further assurance of Japanese non-proliferation commitment. Japan supports the introduction of strengthened safeguards. In this context it is particularly important to strengthen the relationship between national and the IAEA safeguards to contribute actively to the IAEA safeguards in development and utilization of new technologies towards more effective and efficient IAEA safeguards
Solid state ionics: a Japan perspective
Yamamoto, Osamu
2017-12-01
The 70-year history of scientific endeavor of solid state ionics research in Japan is reviewed to show the contribution of Japanese scientists to the basic science of solid state ionics and its applications. The term 'solid state ionics' was defined by Takehiko Takahashi of Nagoya University, Japan: it refers to ions in solids, especially solids that exhibit high ionic conductivity at a fairly low temperature below their melting points. During the last few decades of exploration, many ion conducting solids have been discovered in Japan such as the copper-ion conductor Rb4Cu16I7Cl13, proton conductor SrCe1-xYxO3, oxide-ion conductor La0.9Sr0.9Ga0.9Mg0.1O3, and lithium-ion conductor Li10GeP2S12. Rb4Cu16I7Cl13 has a conductivity of 0.33 S cm-1 at 25 °C, which is the highest of all room temperature ion conductive solid electrolytes reported to date, and Li10GeP2S12 has a conductivity of 0.012 S cm-1 at 25 °C, which is the highest among lithium-ion conductors reported to date. Research on high-temperature proton conducting ceramics began in Japan. The history, the discovery of novel ionic conductors and the story behind them are summarized along with basic science and technology.
What Constitutes Traditional and Modern Eating? The Case of Japan
Directory of Open Access Journals (Sweden)
Gudrun Sproesser
2018-01-01
Full Text Available Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1 comprehensively compile and systematize the various facets of traditional and modern eating; and (2 investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health.
What Constitutes Traditional and Modern Eating? The Case of Japan.
Sproesser, Gudrun; Imada, Sumio; Furumitsu, Isato; Rozin, Paul; Ruby, Matthew B; Arbit, Naomi; Fischler, Claude; Schupp, Harald T; Renner, Britta
2018-01-25
Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1) comprehensively compile and systematize the various facets of traditional and modern eating; and (2) investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health.
What Constitutes Traditional and Modern Eating? The Case of Japan
Imada, Sumio; Furumitsu, Isato; Rozin, Paul; Ruby, Matthew B.; Arbit, Naomi; Fischler, Claude; Schupp, Harald T.; Renner, Britta
2018-01-01
Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1) comprehensively compile and systematize the various facets of traditional and modern eating; and (2) investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health. PMID:29370081
Yamaguchi, Hideka
Japan has adopted a sustainable development strategy since the late 1980s in the effort to address social and environmental damages caused by past Japan-funded projects in partner nations. Even after about a decade and a half of the policy implementation, however, there are few reports which critically examine effects of the adoption of the idea of sustainable development. This dissertation evaluates Japan's foreign aid policy to determine the extent to which new revisions of aid policy have improved the environmental sustainability of the policy. This dissertation reviews the mainstream idea of sustainable development (also known as the sustainable development paradigm in this dissertation) to reveal the nature of the idea of sustainable development that Japan's foreign aid policy depends on. A literature review of two development discourses---modernization theory and ecological modernization theory---and three types of critiques against the sustainable development paradigm---focused on adverse impacts of modern science, globalization, and environmental overuse---reveals core logics of and problems with the sustainable development paradigm. Japan's foreign aid policy impacts on energy sector development in recipient countries is examined by means of a quantitative analysis and a qualitative analysis. Specifically, it examines the effect of Japan's ODA program over fifteen years that proposed to facilitate sustainable development in developing countries. Special emphasis is given to investigation of ODA disbursements in the energy sector and detailed case studies of several individual energy projects are performed. The dissertation discovers that the sustainable development paradigm guiding Japan's ODA has little capacity to accomplish its goals to bring about social and ecological improvement in developing countries. This dissertation finds three fundamental weaknesses in Japanese ODA policy on energy sector development as well as the sustainable development
International Nuclear Information System (INIS)
Hecht, M.M.
1994-01-01
Japan's plutonium economy is based on the most efficient use of nuclear energy, as envisioned under the Atoms for Peace program of the 1950s and 1960s. The nuclear pioneers assumed that all nations would want to take full advantage of atomic energy, recycling waste into new fuel to derive as much energy as possible from this resource
International Nuclear Information System (INIS)
2008-01-01
On 27 November 2008, the Governor of Japan delivered a statement in the Board of Governors concerning Japan's activities in technical cooperation. As requested in that statement, the full text of the statement is herewith circulated for the information of Member States
Brown, James Dean, Ed.; Yamashita, Sayoko Okada, Ed.
Papers on second language testing in Japan include: "Differences Between Norm-Referenced and Criterion-Referenced Tests" (James Dean Brown); "Criterion-Referenced Test Construction and Evaluation" (Dale T. Griffe); "Behavioral Learning Objectives as an Evaluation Tool" (Judith A. Johnson); "Developing Norm-…
Licensing and decommissioning of nuclear installations in Japan
International Nuclear Information System (INIS)
Shimoyama, Shunji.
1986-01-01
The present report discusses the current status of Japan's licensing system and legislation concerning reactor decommissioning operations. Besides Japan is working to promote worldwide nuclear safety research. However, developing nuclear safety regulations that are uniformely applicable is a difficult job due to big differences in geographical, political, economical, and technological conditions. (CW) [de
Continuity and Change in Disaster Education in Japan
Kitagawa, Kaori
2015-01-01
This article aims to describe post-war continuity and change in disaster education in Japan. Preparedness for natural disasters has been a continuous agenda in Japan for geographical and meteorological reasons, and disaster education has been practised in both formal and informal settings. Post-war disaster management and education have taken a…
Beyond the Limitations of Environmental Education in Japan
Imamura, Mitsuyuki
2017-01-01
Environmental education has not spread as widely in Japan as expected and therefore has not had any significant impact on environmental problems, even though many educators and researchers have devoted themselves to environmental educational practice. Why is environmental education not popular in Japan, and what does this tell us? The purpose of…
Directory of Open Access Journals (Sweden)
Takashi Watanabe
2009-06-01
Full Text Available This paper briefly reviews the activities of the International Council for Science (ICSU World Data Centers (WDCs in Japan at a time of great change in the data and information structures of the ICSU ? the creation of the World Data System (WDS in 2009. Seven WDCs are currently operating in Japan: the WDC for Airglow, the WDC for Cosmic Rays, the WDC for Geomagnetism, Kyoto, the WDC for Ionosphere, the WDC for Solar Radio Emission, and the WDC for Space Science Satellites. Although these WDCs are highly active, along-term support system must be established to ensure the stewardship and provision of quality-assessed data and data services to the international science community.
Japan reforms its nuclear safety
International Nuclear Information System (INIS)
Anon.
2013-01-01
The Fukushima Daiichi NPP accident deeply questioned the bases of nuclear safety and nuclear safety regulation in Japan. It also resulted in a considerable loss of public confidence in the safety of nuclear power across the world. Although the accident was caused by natural phenomena, institutional and human factors also largely contributed to its devastating consequences, as shown by the Japanese Diet's and Government's investigation reports. 'Both regulators and licensees were held responsible and decided to fully reconsider the existing approaches to nuclear safety. Consequently, the regulatory system underwent extensive reform based on the lessons learned from the accident,' Yoshihiro Nakagome, the President of Japan Nuclear Energy Safety Organisation, an ETSON member TSO, explains. (orig.)
75 FR 65213 - Removal of Varietal Restrictions on Apples From Japan
2010-10-22
...-0020] RIN 0579-AD08 Removal of Varietal Restrictions on Apples From Japan AGENCY: Animal and Plant... the importation of Fuji variety apples from Japan to allow all varieties of Malus domestica apples... that the risk associated with allowing other varieties of M. domestica apples from Japan into the...
75 FR 11071 - Removal of Varietal Restrictions on Apples from Japan
2010-03-10
... on Apples from Japan AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Proposed rule... Japan to allow all varieties of Malus domestica apples into the United States under the same conditions... apples from Japan to be imported into the United States while continuing to protect against the...
Connecting Higher Education Research in Japan with the International Academic Community
Yonezawa, Akiyoshi
2015-01-01
This study examines the historical, current, and future challenges of higher education research in Japan within a global context. Japanese higher education research has been strongly influenced by the international academic community. At the same time, higher education researchers in Japan have participated in international projects, and Japan has…
School scoliosis screening by Moiré topography - Overview for 33 years in Miyazaki Japan.
Kuroki, Hiroshi; Nagai, Takuya; Chosa, Etsuo; Tajima, Naoya
2018-04-05
Since 1981, we have performed school scoliosis screening (SSS) using Moiré topography in Miyazaki, Japan and attained a certain result in detecting scoliosis. However, this screening system was discontinued due to cessation of repair and production of Moiré topographic equipment. The purpose of this study was to make clear both the results and the problems of SSS by Moiré topography on the basis of our past 33 years' experiences. The subjects were 689,293 students (5th grade boys in 200,329, 5th grade girls in 191,919, 8th grade boys in 151,351, and 8th grade girls in 145,694) who were screened by Moiré topography between 1981 and 2013. The number of students received SSS, the positive rate of Moiré topography, the discovery rate of scoliosis greater than 20°, the reference rate to the second screening, and the positive predictive value of Moiré topography to detect scoliosis greater than 20° were investigated. The number of students received SSS achieved a peak in 1992. The positive rate of Moiré topography and the discovery rate of scoliosis were highest in 8th grade girls. The reference rates to the second screening were 49.8% in 5th grade students and 41.4% in 8th grade students. The positive predictive values were 2.1% in 5th grade students and 7.6% in 8th grade students. SSS by Moiré topography seemed to be effective in detecting scoliosis although both the positive predictive value and the reference rate to the second screening were low. Copyright © 2018. Published by Elsevier B.V.
Clinical statistics of gynecologic cancers in Japan
Nagase, Satoru
2017-01-01
Cervical, endometrial, and ovarian cancers, have both high morbidity and mortality among the gynecologic malignant tumors in Japan. The present study was conducted using both the population-based cancer registry and the gynecologic cancer registry to elucidate the characteristics of gynecologic malignant tumors in Japan. Based on nationwide estimates from the population-based cancer registry in Japan, the morbidities and mortality of cervical, endometrial, and ovarian cancers were obtained and used for analysis. Clinicopathologic factors for cervical cancer, endometrial cancer, ovarian cancer, including age, clinical stage, postsurgical stage, histological type, therapeutic strategy, and prognosis were retrieved from the gynecologic cancer registry published by the Japan Society of Obstetrics and Gynecology and used for analysis. The morbidities of cervical, endometrial, and ovarian cancers were 10,908, 13,606, and 9,384 women in 2012, respectively. The prevalence of endometrial cancer has significantly and consistently been increasing and represents the most common gynecologic malignant tumor in Japan. The mortalities of cervical, endometrial, and ovarian cancers were 2.1, 1.3, and 3.2 per 100,000 in 2012, respectively. In 2014, 52.2% of cervical cancer patients were classified as stage I, 22.5% as stage II, 10.2% as stage III, and 11.2% as stage IV. In addition, 71.9% of endometrial cancer patients were classified as stage I, 6.0% as stage II, 13.3% as stage III, and 7.5% as stage IV. Finally, 43.2% of ovarian cancer patients were classified as stage I, 9.1% as stage II, 27.6% as stage III, and 7.2% as stage IV. Twelve-point six percent of ovarian cancer patients received neoadjuvant chemotherapy. PMID:28198168
Current status of SFR development in Japan
Energy Technology Data Exchange (ETDEWEB)
Ieda, Yoshiaki; Chikazawa, Yoshitaka [Japan Atomic Energy Agency, Tokyo (Japan). Project Promotion Office; Kotake, Shoji [Japan Atomic Power Company, Tokyo (Japan)
2012-03-15
Fast Reactor development experiences and status in Japan are summarized. Even though international SFR circumstances were against in 1980s and 1990s, e.g. CRBRP, SNR-300 and Superphenix terminations, we kept on with our R and D activities steadily aiming at positive development targets in Japan. As results of our efforts, it has shown that our commercialized SFR concept, Japan Sodium-cooled Fast Reactor (JSFR) could meet the targets in the Feasibility Study on Commercialized Fast Reactor Cycle Systems (FS) and the Fast Reactor Cycle Technology Development (FaCT) project. Further, Monju has finally achieved restart in May 2010 after having been shut for almost 15 years. A future plan of Monju is to be determined based on a direction of the national nuclear and energy policies that will be established in 2012. The undergoing FaCT project is pursuing commercialization of fast reactor cycle system around 2050 under cooperation of MEXT (Ministry of Education, Culture, Sports, Science and Technology), METI (Ministry of Economy, Trade and Industry), utilities, venders and JAEA (Japan Atomic Energy Agency). As results of the FaCT Phase I, feasibility of the key technologies for JSFR has been evaluated and the project is waiting for launching the phase II due to the Tohoku large earthquake. It is considered that the nuclear development policy might be affected by the Tohoku large Earthquake/Tsunami in Japan. Nevertheless the significance of nuclear energy will not be changed and thus we will focus on the issues learnt from Fukushima accidents and reflect into the improvement of the safety of Monju and the safety design criteria for the next generation Fast Reactor systems. (orig.)
Current status of SFR development in Japan
International Nuclear Information System (INIS)
Ieda, Yoshiaki; Chikazawa, Yoshitaka
2012-01-01
Fast Reactor development experiences and status in Japan are summarized. Even though international SFR circumstances were against in 1980s and 1990s, e.g. CRBRP, SNR-300 and Superphenix terminations, we kept on with our R and D activities steadily aiming at positive development targets in Japan. As results of our efforts, it has shown that our commercialized SFR concept, Japan Sodium-cooled Fast Reactor (JSFR) could meet the targets in the Feasibility Study on Commercialized Fast Reactor Cycle Systems (FS) and the Fast Reactor Cycle Technology Development (FaCT) project. Further, Monju has finally achieved restart in May 2010 after having been shut for almost 15 years. A future plan of Monju is to be determined based on a direction of the national nuclear and energy policies that will be established in 2012. The undergoing FaCT project is pursuing commercialization of fast reactor cycle system around 2050 under cooperation of MEXT (Ministry of Education, Culture, Sports, Science and Technology), METI (Ministry of Economy, Trade and Industry), utilities, venders and JAEA (Japan Atomic Energy Agency). As results of the FaCT Phase I, feasibility of the key technologies for JSFR has been evaluated and the project is waiting for launching the phase II due to the Tohoku large earthquake. It is considered that the nuclear development policy might be affected by the Tohoku large Earthquake/Tsunami in Japan. Nevertheless the significance of nuclear energy will not be changed and thus we will focus on the issues learnt from Fukushima accidents and reflect into the improvement of the safety of Monju and the safety design criteria for the next generation Fast Reactor systems. (orig.)
Characteristics of primary sclerosing cholangitis in Japan.
Takikawa, Hajime
2007-10-01
At a workshop on primary sclerosing cholangitis (PSC) held during Digestive Disease Week - Japan 2003, 388 PSC cases in Japan were analyzed. Two peaks in the age distribution were also observed in this survey. Jaundice and itching, major symptoms in PSC patients included in the diagnostic criteria, were observed in only 28% and 16%, respectively. Alkaline phosphatase levels were less than twofold of the upper limit of the normal range in 35%. In this regard, the diagnostic criteria in 2003 from the Mayo Clinic, including cholestatic symptoms and two- to threefold increases in serum alkaline phosphatase, should be modified in Japan. Inflammatory bowel diseases were complicated in 37%, and autoimmune pancreatitis (AIP) in 7.2%. PSC cases with inflammatory bowel diseases were younger than the average, creating the firstpeak in age distribution, and have similar characteristics compared to patients with PSC in foreign countries. In addition, even after the exclusion of cases of sclerosing cholangitis complicated with AIP, the second peak in the age distribution was clearly evident. Recently, a concept of immunoglobulin G4-related sclerosing cholangitis has been postulated, which has a similar pathogenesis to AIP but without apparent pancreatic lesions. PSC patients without apparent involvement of the pancreas may be present in older patients and seem to be specific to Japan.
International Nuclear Information System (INIS)
Yonezawa, Minoru
2015-01-01
I would like to congratulate INIS on its 45th anniversary. Japan is a founding member of this international cooperation program, and the Japan Atomic Energy Agency (formerly, Japan Atomic Energy Research Institute — JAERI) was appointed as the national center of INIS by the Japanese government. We have contributed to the collection, classification, indexing, abstracting and submission of nuclear literature published in our country, as well as promoted the INIS database within our country. I have been engaged in INIS activities for many years and have a lot of experience with INIS. On the occasion of INIS’ 45th anniversary, I would like to look back on this experience. I started my career at JAERI in 1984. The first regional training seminar for the Far East was held in Tokyo in October 1984. I was assigned to the Library Division of JAERI, but I worked as support staff for the regional training seminar. During the seminar, I had an opportunity to attend the technical tour with the seminar participants to the University of Library and Information Science, research laboratories, etc., in Tsukuba Science City. This was my first involvement with INIS. It was a very impressive and interesting experience
Waste inventory, waste characteristics and waste repositories in Japan
International Nuclear Information System (INIS)
Shimooka, K.
1997-01-01
There are two types of repositories for the low level radioactive wastes in Japan. One is a trench type repository only for concrete debris generated from the dismantling of the research reactor. According to the safety assurance system, Japan Atomic Energy Research Institute (JAERI) has disposed of the concrete debris arose from the dismantling of the Japan Power Demonstration Reactor (JPDR). The other type is the concreted pit with engineered barriers. Rokkasho Low Level Radioactive Waste Disposal Center has this type of repository mainly for the power plant wastes. Japan Nuclear Fuel Ltd. (JNFL) established by electric power companies is the operator of the LLW disposal project. JNFL began the storage operation in 1992 and buried approximately 60,000 drums there. Two hundred thousand drums of uniformly solidified, waste may be buried ultimately. 4 refs, 3 tabs
Taeniasis and cysticercosis due to Taenia solium in Japan.
Yanagida, Tetsuya; Sako, Yasuhito; Nakao, Minoru; Nakaya, Kazuhiro; Ito, Akira
2012-01-17
Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the recent increase in international tourism and immigration is spreading the disease into non-endemic developed countries such as the United States. Although there has been concern that the number of cysticercosis cases is increasing in Japan, the current situation is not clear. This is largely because taeniasis and cysticercosis are not notifiable conditions in Japan and because there have been no comprehensive reviews of T. solium infections in Japan conducted in the last 15 years. Herein, we provide an overview of the status of T. solium infection in Japan over the past 35 years and point out the potential risks to Japanese society.
Japan Atomic Energy Research Institute in the 21st century
International Nuclear Information System (INIS)
Sato, Y.
2001-01-01
Major nuclear research institutes in Japan are the Japan Atomic Energy Research Institute (JAERI), Nuclear Cycle Development Institute (JNC), National Research Institute of Radiological Science (NIRS), and the Institute of Physical and Chemical Research (RIKEN). In the 50s and 60s JAERI concentrated on the introduction of nuclear technology from overseas. Energy security issues led to the development of a strong nuclear power programme in the next two decades resulting in Japan having 50 light water cooled nuclear power plants in operation. Japan also worked on other reactor concepts. The current emphasis of JAERI is on advanced reactors and nuclear fusion. Its budget of 270 million US$ supports five research establishments. JAERI has strong collaboration with industry and university system on nuclear and other advanced research topics (neutron science, photon science). In many areas Japan has strong international links. JAERI has also been transferring know-how on radioisotope and radiation applications to the developing countries particularly through IAEA-RCA mechanisms. (author)
In the Wake of TICAD V: Japan-Africa Relations Today
Directory of Open Access Journals (Sweden)
Tarrósy István
2014-12-01
Full Text Available The paper looks at how Japan, one of the major donors of African countries, has been redefining its positions on the African continent in terms of bilateral aid and business opportunities, triangular collaboration and multilateral development projects in an increasingly ‘interpolar’ world of international relations. The discussion includes China's expanding presence all over Africa as an important ‘reference point’ for the Japanese public at large and how that may influence Japanese pragmatic foreign policy towards the continent and Japan's involvement in African development. What are Japan's priorities in the wake of hosting the fifth Tokyo International Conference on African Development (TICAD V early in June 2013 in Yokohama? How does Japan go along with its confident manner of inclusive development and ownership in African societies when at the same time it is challenged by China and other emerging actors? What are the items on Japan's agenda for a re-intensified Africa policy?
Nuclear fuel cycle in Japan : status and perspective
International Nuclear Information System (INIS)
Suzuki, Atsuyuki
1996-01-01
Nearly one third of electricity in Japan is being generated by nuclear fission primarily by light-water reactors. The industries to supply uranium fuel for these reactors have been well established including the capability for uranium enrichment. From the onset of nuclear program in Japan, a country with thin energy resources, the emphasis has been placed on maximizing the efficiency of uranium utilization. Thus the national nuclear program set forth by the Japan Atomic Energy Commission has consistently called for the establishment of closed fuel cycle, or for recycling of nuclear fuel. As part of such efforts in private sectors, the first commercial reprocessing plant is now under construction at Rokkasho-mura. The program to develop technologies for recycling nuclear fuel in a fast reactor system is also in progress steadily under the governmental support, while the Monju accident casts a long shadow on the future of fast reactor development in Japan. Even though the price of uranium has been stable at relatively low level in recent years, the uranium market in the longer time range is somewhat unpredictable. In Asian countries, a rapid growth of nuclear power production is foreseen in the 21st century. Under such circumstances, the effort to pursue the recycling option in Japan is important not only for its own energy security but also for stabilization of future uranium market in the world. The recycling option can also offer more flexible, easier and safer ways of radioactive waste management. Since the recycling option means utilization of plutonium in an industrial scale, special attention is inevitably required from the viewpoint of nuclear non-proliferation. It is the Japan's national policy to develop recycling technologies in compliance with the NPT and IAEA safeguard system as well as to maintain the transparency of its developmental program. (author)
76 FR 76760 - Gray Portland Cement and Cement Clinker From Japan
2011-12-08
... and Cement Clinker From Japan Determination On the basis of the record \\1\\ developed in the subject... duty order on gray Portland cement and cement clinker from Japan would be likely to lead to... and Cement Clinker from Japan: Investigation No. 731- TA-461 (Third Review). By order of the...
77 FR 32998 - Tin- and Chromium-Coated Steel Sheet From Japan
2012-06-04
...-Coated Steel Sheet From Japan Determination On the basis of the record \\1\\ developed in the subject five... order on tin- and chromium-coated steel sheet from Japan would be likely to lead to continuation or... USITC Publication 4325 (May 2012), entitled Tin- and Chromium-Coated Steel Sheet from Japan...
JTEC panel on nuclear power in Japan. Final report
International Nuclear Information System (INIS)
Hansen, K.F.; Behnke, W.B.; Cousin, S.B.; Evans, E.A.; Olander, D.R.
1990-10-01
The report examines the status and direction of nuclear power-related research and development in Japan in six areas: the nuclear fuel cycle, nuclear materials, instrumentation and control technology, CAD/CAM, nuclear safety research, and nuclear plant construction. Overall findings suggest that the nuclear power industry in Japan is at an advanced state of development; in particular, Japan is now technologically self-sufficient. Long-term goals of the Japanese program include closure of the complete fuel cycle and pursuit of the liquid metal fast breeder reactor as the future base system
Japan's New Trade Policy:Good or Bad for ASEAN?
Jean-François BRUN; Marie-Aimée TOURRES
2001-01-01
Because Japan is a primary investor and trading partner of all the troubled economies, in the midst of the crisis, Japan was called in to help the crisis-stricken countries by opening its market to cheaper imports from South East Asia. The article analyses the opening to trade of the Japanese economy with the help of a gravity equation on panel data using a Hausman-Taylor estimator. We show that there is no certainty that such a role, that is the opening of Japan, will have positive effects f...
Public acceptance (PA) of nuclear energy in Japan
International Nuclear Information System (INIS)
Ishii, Makoto
1994-01-01
Japan's nuclear development is carried out in the spirit of the Atomic Energy Basic Law that it adopted in 1955. The only nation in the world devastated by nuclear weapons, Japan strongly hopes for the abolishment of nuclear weapons and promotes the peaceful use of nuclear energy. Since Japan is in poor in natural resources nuclear power has now become a major foundation of our society and economy. As far as the Japanese people's awareness of nuclear power generation is concerned, 60% recognize it as necessary although 70% are concerned about its safety. The public acceptance (PA) of nuclear energy is facing a critical juncture at thus point due to such imminent issues as the use of plutonium and the disposal of high-level wastes. The entire Japanese government is currently striving to promote PA measures targeting various population groups. This paper reports on the peaceful use of nuclear energy and Japan's stance on this issue; people's awareness; and the current state of nuclear energy PA measures. 1 fig
Mobility perspective for a local city in Japan
Directory of Open Access Journals (Sweden)
Hirotaka Koike
2014-07-01
Another solution to excessive automobile dependency is bicycles, which are a convenient and inexpensive transportation mode all over the world. In Japan, however, automobile-oriented transportation and urban policies have prevailed, leaving the bicycle long neglected. Still, recent years have seen the bicycle gain recognition as a healthy, environmentally friendly alternative to the automobile, especially after the Great East Japan Earthquake in 2011. Utsunomiya City has been actively pursuing a mobility policy of bicycle utilization since 2003 and is regarded as one of the leaders in its promotion. The potential success in Utsunomiya to overcome automobile dependency will make it a model for many local cities in Japan that suffer from similar problems.
78 FR 60897 - Certain Welded Large Diameter Line Pipe From Japan
2013-10-02
... Diameter Line Pipe From Japan Determination On the basis of the record \\1\\ developed in the subject five... order on certain welded large diameter line pipe from Japan would likely to lead to continuation or... Line Pipe from Japan: Investigation No. 731-TA-919 (Second Review). By order of the Commission. Issued...
Over-Education and Its Opportunity Cost in Japan
Kucel, Aleksander; Molina, Ivette Fuentes; Raya, Josep Maria
2016-01-01
In this paper, we investigate the determinants of over-education in Japan and evaluate its opportunity costs for university graduates. To this end, we use the REFLEX data. Results reveal that over-education level in Japan is high and it brings an important wage penalty for Japanese workers. Large firm and high occupations point toward a…
Japan: Super-Aging Society Preparing for the Future
Muramatsu, Naoko; Akiyama, Hiroko
2011-01-01
Japan has the highest proportion of older adults in the world. Aging is not only an immediate personal issue but also a salient factor in crucial public policies, such as pensions, health, and long-term care. The Great East Japan Earthquake, tsunami, and nuclear power plant disaster of March 2011 has highlighted current and emerging issues of a…
Media Education in Japan (Retrospect and Present Trends).
Takakuwa, Yasuo
This overview of the development of media education in Japan begins with a discussion of the motion picture as entertainment and the public attitude toward film in Japan during the early years of the century. The introduction of film education into the schools in the 1920s--both teaching by film and teaching about film--is then described together…
High-level manpower movement and Japan's foreign aid.
Furuya, K
1992-01-01
"Japan's technical assistance programs to Asian countries are summarized. Movements of high-level manpower accompanying direct foreign investments by private enterprise are also reviewed. Proposals for increased human resources development include education and training of foreigners in Japan as well as the training of Japanese aid experts and the development of networks for information exchange." excerpt
Effectiveness of rotavirus vaccines against hospitalisations in Japan.
Fujii, Yoshiyuki; Noguchi, Atsuko; Miura, Shinobu; Ishii, Haruka; Nakagomi, Toyoko; Nakagomi, Osamu; Takahashi, Tsutomu
2017-07-11
In Japan, rotavirus hospitalisation occurs at a rate from 2.8 to 13.7 per 1000 child-years among children age less than 5 years, and it imposes a substantial burden to the healthcare system in the country. While both monovalent (RV1) and pentavalent (RV5) rotavirus vaccines are licensed in Japan, neither has been incorporated in the national infant immunization programme. In this study, we estimated vaccine effectiveness (VE) in Japan. This study was conducted in Yuri-Kumiai General Hospital located in a city in the north-western part of Japan. Age-eligible children for rotavirus vaccination were enrolled if they were hospitalized for rotavirus gastroenteritis between September 2013 and August 2016. Rotavirus gastroenteritis was defined by the detection of rotavirus antigen by immunochromatography. "Vaccinated" was defined as infant inoculated with at least one dose of either RV1 or RV5. A conditional logistic regression analysis was performed by modelling the year of birth, year of admission, residence of the children and vaccination status, and by matching the age of cases with that of test-negative controls. The adjusted odds ratio of the vaccinated over unvaccinated was then used to calculate VE in the formula of (1 - adjusted odds ratio) × 100. Out of the 244 patients enrolled, rotavirus antigen was detected in 55 (22.5%) of whom 10 (18.2%) were vaccinated, whereas 94 (49.7%) of 189 test-negative controls were vaccinated. During the study period, the vaccine uptake rate in the controls increased from 36.2% to 61.8%. On the other hand, the vaccination coverage over the three years was 64.2% in Yuri-Honjo city (three quarters of the catchment), and 91.4% in Nikaho city (one quarter of the catchment). The VE was calculated to be 70.4% (95% confidence interval: 36.0-86.4%, P = 0.002). The point estimate of the VE was lower but its 95% confidence interval overlaps those of the efficacies obtained from clinical trials in Japan. The rotavirus vaccine was
International Nuclear Information System (INIS)
Hirose, M.; Aritomi, M.; Saegusa, T.; Hayashi, T.; Takeda, T.; Onishi, K.; Kawakami, K.
2004-01-01
Since June 1997 the standards/specifications and inspection/certification of various products in Japan have been reviewed by Ministries and Agencies, with the aim of reducing direct government intervention to a necessary minimum and creating a free and fair socio-economic system that is fully opened to the international community and based on the rules of self-responsibility and market principles. Reflecting this policy the administrative regulations which prescribe technical standards as specific requirements have been revised by degrees into performance prescriptions. Detailed provisions in ordinances and notices have been abolished gradually to utilize voluntary standards and rules. In the nuclear energy field voluntary standards are being developed to make up statutory performance requirements by the Atomic Energy Society of Japan (AESJ) and the Japan Society of Mechanical Engineers (JSME) together with other organizations such as the Japan Electric Association, the Thermal and Nuclear Power Engineering Society. These voluntary standards and rules by these organizations have been established in order to maintain openness, transparency, fairness, professionalism and promptness and to promote development and globalization
Martin, L G
1989-07-01
Japan's rapidly aging population has become a top policy issue, especially as the increasing costs of pensions and medical care are debated. With the highest life expectancy on earth, the Japanese potentially face long periods of retirement, as well as the possibility of long periods of disability. Although family support of the elderly is thought to have been strong traditionally, the recent decline in co-residence with children is 1 indication that the way support is given may be changing. This issue is of particular concern to the government, which wants to avoid any greater responsibility for the elderly than is necessary given the dramatic population aging yet to come. The government is also encouraging employers to provide more employment opportunities for the elderly at the same time that it is trying to raise the eligibility age for the receipt of public pensions. There is resistance on the part of employers, however, because wages and retirement allowances in Japan are positively related to length of employment. Furthermore, it is not clear whether elderly Japanese of the future will be as willing to work, if they learn to enjoy increased leisure early in their careers. Nevertheless, it is unlikely that population aging will lead to Japan's economic decline. Although the savings rate may decline somewhat, restructuring of the economy and continued overseas investment should keep the economy growing in the long run. Important in both the care of the frail elderly and the continued growth of the economy will be the roles played by middle-aged Japanese women.
Total-factor energy efficiency of regions in Japan
Energy Technology Data Exchange (ETDEWEB)
Honma, Satoshi [Faculty of Economics, Kyushu Sangyo University, 2-3-1 Matsukadai, Higashi-ku, Fukuoka 813-8503 (Japan); Hu, Jin-Li [Institute of Business and Management, National Chiao Tung University (China)
2008-02-15
This study computes the regional total-factor energy efficiency (TFEE) in Japan by employing the data envelopment analysis (DEA). A dataset of 47 prefectures in Japan for the period 1993-2003 is constructed. There are 14 inputs, including three production factors (labor employment, private, and public capital stocks) and 11 energy sources (electric power for commercial and industrial use, electric power for residential use, gasoline, kerosene, heavy oil, light oil, city gas, butane gas, propane gas, coal, and coke). GDP is the sole output. Following Fukao and Yue [2000. Regional factor inputs and convergence in Japan - how much can we apply closed economy neoclassical growth models? Economic Review 51, 136-151 (in Japanese)], data on private and public capital stocks are extended. All the nominal variables are transformed into real variables, taking into consideration the 1995 price level. For kerosene, gas oil, heavy oil, butane gas, coal, and coke, there are a few prefectures with TFEEs less than 0.7. The five most inefficient prefectures are Niigata, Wakayama, Hyogo, Chiba, and Yamaguchi. Inland regions and most regions along the Sea of Japan are efficient in energy use. Most of the inefficient prefectures that are developing mainly upon energy-intensive industries are located along the Pacific Belt Zone. A U-shaped relation similar to the environmental Kuznets curve (EKC) is discovered between energy efficiency and per capita income for the regions in Japan. (author)
Total-factor energy efficiency of regions in Japan
International Nuclear Information System (INIS)
Honma, Satoshi; Hu, Jin-Li
2008-01-01
This study computes the regional total-factor energy efficiency (TFEE) in Japan by employing the data envelopment analysis (DEA). A dataset of 47 prefectures in Japan for the period 1993-2003 is constructed. There are 14 inputs, including three production factors (labor employment, private, and public capital stocks) and 11 energy sources (electric power for commercial and industrial use, electric power for residential use, gasoline, kerosene, heavy oil, light oil, city gas, butane gas, propane gas, coal, and coke). GDP is the sole output. Following Fukao and Yue [2000. Regional factor inputs and convergence in Japan-how much can we apply closed economy neoclassical growth models? Economic Review 51, 136-151 (in Japanese)], data on private and public capital stocks are extended. All the nominal variables are transformed into real variables, taking into consideration the 1995 price level. For kerosene, gas oil, heavy oil, butane gas, coal, and coke, there are a few prefectures with TFEEs less than 0.7. The five most inefficient prefectures are Niigata, Wakayama, Hyogo, Chiba, and Yamaguchi. Inland regions and most regions along the Sea of Japan are efficient in energy use. Most of the inefficient prefectures that are developing mainly upon energy-intensive industries are located along the Pacific Belt Zone. A U-shaped relation similar to the environmental Kuznets curve (EKC) is discovered between energy efficiency and per capita income for the regions in Japan
International Nuclear Information System (INIS)
Kubota, Masafumi
2012-01-01
A law enacted on June 20 to establish a new Nuclear Regulatory Authority (NRA) fully separated from the nuclear promotional authorities. It added the provision, which says nuclear safety should be guaranteed not only to defend lives, people's health and the environment but also to 'contribute to Japan's national security', to Article 2 of the Atomic Energy Basic Law. NRA integrated the existing regulatory authorities for safety, security and safeguards, into one. Supporters of an amendment quietly slipped into the law were denying it could provide cover for military use of nuclear technology, but arouse international concern about recycling program of extracting plutonium from spent fuels. Nuclear policy minister said: 'The safeguards are in place to prevent nuclear proliferation. The world 'security' precisely means the prevention of nuclear proliferation.' If not used explicitly about safeguards, they left room for stretched interpretation. The author recommended the world' contribute to Japan's national security' should be deleted instead of explaining appropriately, both at home and abroad, the use of nuclear power in Japan limited to peaceful purposes. (T. Tanaka)
Sawa, Yoshiki; Takayama, Morimasa; Goto, Tsuyoshi; Takanashi, Shuichiro; Komiya, Tatsuhiko; Tobaru, Tetsuya; Maeda, Koichi; Kuratani, Toru; Sakata, Yasushi
2017-07-25
Transcatheter aortic valve replacement (TAVR) has been an alternative less invasive therapy for high-surgical risk/inoperable patients with aortic valve stenosis (AS) in Japan. We report 5-year outcomes of the first pivotal clinical trial of TAVR in Japan (PREVAIL JAPAN).Methods and Results:A total of 64 patients with AS who were considered unsuitable candidates for surgery were enrolled at 3 centers in Japan (mean age: 84.3±6.1 years, female: 65.6%, STS score: 9.0±4.5%). Transfemoral approach (TF) and transapical approach (TA) was performed in 37 patients and 27 patients, respectively. At 5 years, freedom from all-cause death was 52.7% (TF: 51.3%, TA: 56.3%). Risk of all stroke at 5-year was 15.8% (TF: 8.9%, TA: 25.5%) and risk of major adverse cardiac and cerebrovascular events at 5 years was 58.0% (TF: 51.3%, TA: 69.2%). Mild or greater aortic regurgitation (AR) at 1 week was not associated with increased all-cause death at 5 years (69.1%) compared with none or trace AR (48.3%) (P=0.184). Patients with high STS score (>8) had higher mortality rate than those with low STS scores (≤8). The 5-year data from PREVAIL JAPAN show the clinical benefit of TAVR and suggest that balloon-expandable TAVR is an effective treatment option for Japanese patients with severe AS who are not suitable for surgery. (Funded by Edwards Lifesciences Limited; ClinicalTrials.gov number, NCT01113983.).
Kojima, Seiichiro; Watanabe, Norihito; Koizumi, Jun; Kokubu, Shigehiro; Murashima, Naoya; Matsutani, Shoichi; Obara, Katsutoshi
2018-03-01
To investigate the current status of portal vein thrombosis (PVT) in Japan, the Clinical Research Committee of the Japan Society of Portal Hypertension undertook a questionnaire survey. A questionnaire survey of 539 cases of PVT over the previous 10 years was carried out at institutions affiliated with the Board of Trustees of the Japan Society of Portal Hypertension. The most frequent underlying etiology of PVT was liver cirrhosis in 75.3% of patients. Other causes included inflammatory diseases of the hepatobiliary system and the pancreas, malignant tumors, and hematologic diseases. The most frequent site was the main trunk of the portal vein (MPV) in 70.5%, and complete obstruction of the MPV was present in 11.5%. Among the medications for PVT, danaparoid was given to 45.8%, warfarin to 26.2%, heparin to 17.3%, and anti-thrombin III to 16.9%. Observation of the course was practiced in 22.4%. Factors contributing to therapeutic efficacy were implementation of various medications, thrombi localized to either the right or left portal vein only, non-complete obstruction of the MPV and Child-Pugh class A liver function. A survival analysis showed that the prognosis was favorable with PVT disappearance regardless of treatment. The questionnaire survey showed the current status of PVT in Japan. Any appropriate medication should be given to a patient with PVT when PVT is recognized. It is necessary to compile a large amount of information and reach a consensus on safe and highly effective management of PVT. © 2017 The Japan Society of Hepatology.
Taeniasis and cysticercosis due to Taenia solium in Japan
Directory of Open Access Journals (Sweden)
Yanagida Tetsuya
2012-01-01
Full Text Available Abstract Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the recent increase in international tourism and immigration is spreading the disease into non-endemic developed countries such as the United States. Although there has been concern that the number of cysticercosis cases is increasing in Japan, the current situation is not clear. This is largely because taeniasis and cysticercosis are not notifiable conditions in Japan and because there have been no comprehensive reviews of T. solium infections in Japan conducted in the last 15 years. Herein, we provide an overview of the status of T. solium infection in Japan over the past 35 years and point out the potential risks to Japanese society.
Operational experiences of INES in Japan
International Nuclear Information System (INIS)
1997-01-01
Japan has introduced IAEA's INES in August, 1992. As of September, 1997, the total number of domestic nuclear events which have evaluated by using the INES system has amounted 119. In Japan, when a nuclear event occurs at a nuclear power plant, a provisional evaluation is performed immediately by Nuclear Power Operation Administration Office, MITI. The final evaluation of events is implemented a few months after event occurrence by the Evaluation Committee on Incidents and Failures of Nuclear Power Plant which holds a neutral position. The results of the evaluation are transmitted to IAEA according to the INES reporting criteria
Groundwater flow analyses in Japan. 1. Case studies in Hokkaido and Northeast Japan
International Nuclear Information System (INIS)
Inaba, Hideo; Maekawa, Keisuke; Koide, Kaoru; Yanagizawa, Koichi
1995-01-01
An extensive study program has been carried out to estimate hydrogeological characteristics of deep underground in Japan. As a part of this program, groundwater flow analysis in Hokkaido and Northeast Japan were conducted. For the analyses of these area, hydrogeological models representing topography, geology, distribution of hydraulic conductivity were developed using available informations from open literature. By use of these models, steady state three-dimensional groundwater flow under a saturated/unsaturated condition was calculated by means of finite element method. The results are as follows: (1) Distribution of piezometric head corresponds with topography in the study area. (2) Piezometric head distribution is hydrostatic below E.L.-1000m in the study area. (3) Hydraulic gradient in the study area is less than 0.04 below E.L.-500m. (4) Difference of boundary conditions at the shore side of these models does not affect the results of the analyses. (author)
Present status of research activities on transmutation of actinides in Japan
International Nuclear Information System (INIS)
Amano, Hiroshi
1978-01-01
In Japan, the idea to make use of transmutation for the final disposal method of HLW was first examined by Ichimiya, Amano, Hamada et al., when the Japan Atomic Industry forum had organized a study committee for HLW treatment in 1973. This article has the scope to outline the present research activities on transmutation of actinides in Japan
The mystery of Japan's missing centenarians explained
Directory of Open Access Journals (Sweden)
Yasuhiko Saito
2012-03-01
Full Text Available This report elucidates the issue of Japan's missing centenarians, which was uncovered in 2010. We provide the latest figures from verification efforts, discuss sources of centenarian information in Japan, examine possible causes, and evaluate the effect of the missing centenarians on official statistics. In Japan 234,354 people registered before 1910 remained on the family registers in 2010, without being crossed out. They would have been 100 years old at least and represent 0.5Š of the births recorded between 1872 and 1910. The impact of this group on life expectancy statistics, however, is effectively nil.
Outline of developing projects of atomic bomb in Japan and USA
International Nuclear Information System (INIS)
Fukui, Shuji
2007-01-01
The content of the title connecting with the World War II is described hoping that younger researchers of nuclear physics could know some of the facts that scientists and the military of Japan and USA, respectively, had have developing projects of atomic bomb by fission reaction, although there are no official documents of those in Japan, even if there are some unofficial documents that are uncertain partly in Japan. Described are a chronological table, the content of research and development of atomic bombs, Japan's experiments by Kikuchi Laboratory of Osaka Imperial University and Nishina Laboratory of RIKEN, as well as the USA's action such as production of fissile nuclide, Pu-239 and U-235, selection of the site to fabricate atomic bomb, investigation the state of research and development of atomic bombs in Germany, Italy and Japan. (S.Y.)
Towards an uncertain future? The strengthening of Japan's autonomy in Asia-Pacific
Directory of Open Access Journals (Sweden)
Shiguenoli Miyamoto
2014-01-01
Full Text Available Recently, Japan has been increasing tensions with China regarding the Pinnacle Senkaku/Diaoyu islands. Due to the Chinese military development, Japan has been working on its political and military strengthening in Asia. This essay presents two possible scenarios for Japan.
RESEARCH ON THE LEGAL PROBLEMS OF THE PORT MANAGEMENT SYSTEM IN JAPAN
TAKAHASHI, Koji; KASUGAI, Yasuo; FUKUDA, Isao
2014-01-01
Across the world, port management is increasingly adopting a scheme of separatinginfrastructure and operations. In the midst of this global trend, Japan experienced the Great Hanshin andAwaji Earthquake in 1995 and the Great East Japan Earthquake in 2011, both of which devastated majorports, forcing Japan to face challenges related to its port management system. In addition, with majorearthquakes expected to strike again in the future, it is urgent for Japan to solve the current problems. Jap...
ASYLUM SEEKERS IN JAPAN: A HARD ROAD
Directory of Open Access Journals (Sweden)
Rini Shahriyani Shahrullah
2012-07-01
Full Text Available Japan has ratified the 1951 Convention regarding the status of Refugees and the 1967 Protocol relating to the Status of Refugees since 1981 and 1982, yet Japan only accepted an exceptionally low number of refugees in the course 30 years since it ratified the Convention. Japan needs to closely revise and align its national policies with international agreements that it is signatory to. The main framework with which Japan’s government still tackles the issue of refugees is tightly restrained by its overall controlling immigration policies in an attempt to remain a homogenous nation. Japan has a long way to go in order to fully comply with the spirit of the Convention, the Protocol, and international instruments relating to the Status of Refugees. Jepang telah meratifikasi Konvensi Mengenai Status Pengungsi 1951 dan Protokol tentang Kedudukan Pengungsi 1967 sejak tahun 1981 dan 1982, namun Jepang hanya menerima sejumlah kecil pengungsi dalam kurun waktu 30 tahun sejak diratifikasinya konvensi tersebut. Jepang harus meninjau kembali dan memastikan bahwa kebijakan-kebijakan nasional negaranya telah sesuai dengan perjanjian internasional yang telah ditandatangani Jepang. Kerangka kerja pemerintah Jepang dalam menangani isu pengungsi sangat dibatasi oleh berbagai pengetatan kebijakan imigrasi yang dikeluarkan dalam semangat mempertahankan homogenitas bangsa. Jepang memiliki banyak pekerjaan rumah yang harus dilakukan agar dapat memenuhi semangat konvensi, protokol, dan berbagai instrumen internasional terkait status pengungsi.
The Advisory Committee of International Nuclear Information System (INIS) for Japan
International Nuclear Information System (INIS)
Kunii, Katsuhiko; Itabashi, Keizo
2016-10-01
Under the International Atomic Energy Agency (IAEA), the International Nuclear Information System (INIS) Programme commenced in 1970 and ever since INIS has been acting as a database system available worldwide through information networks each time providing bibliographic information then full text documents of literature, technical reports, etc. on peaceful use of nuclear science and technology, thoroughly supported and maintained by INIS Secretariat in Vienna, on the other hand the inputs for INIS are provided by Member States and Organizations in their own boundaries. As for the INIS activity in Japan, while, the Japan Atomic Energy Research Institute (JAERI), then succeeded as the Japan Atomic Energy Agency (JAEA) as of today, the both have been responsible with the INIS activity in Japan as the INIS National Centre for Japan based on the request of the “former” Science and Technology Agency of the Japanese Government, an advisory committee had have a very important role for the INIS activity in Japan by enthusiastically advising the whole related to the activity from advanced and comprehensive viewpoints of expertise. This report describes about it, the Advisory Committee of International Nuclear Information System (INIS) for Japan, successfully been held 34 times from Oct. 1970 to Mar. 2005. Included are the history and its records, change of the member and topics of the Advisory Committee, and the minutes. (author)
Proceedings of the fifth Australia-Japan workshop on plasma diagnostics
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The fifth Australia-Japan Workshop on Plasma Diagnostics was held at Japan Atomic Energy Research Institute (JAERI), Naka, Japan, from December 15 to 17 in 1999. The first workshop was held at JAERI, Naka in 1989, and the workshops have been held almost every two years in Australia and Japan under the Agreement between the Government of Japan and the Government of Australia on cooperation in the field of Science and Technology. In the workshops, latest research works for plasma diagnostics and plasma experiment have been presented and discussed. The research works of both countries have been developed, and the mutual understanding became deeper through the workshops. In the fifth workshop, the statuses of JT-60U (JAERI), LHD (National Institute for Fusion Science) and H-1NF (Australian National University) were introduced, and the latest research works for plasma diagnostics were also presented. The active and deeper discussions were performed. This report contains twenty-eight papers presented at the workshop. The 25 of the presented papers are indexed individually. (J.P.N.)
Research on energy supply, demand and economy forecasting in Japan
International Nuclear Information System (INIS)
Shiba, Tsuyoshi; Kamezaki, Hiroshi; Yuyama, Tomonori; Suzuki, Atsushi
1999-10-01
This project aims to do research on forecasts of energy demand structure and electricity generation cost in each power plant in Japan in the 21st century, considering constructing successful FBR scenario. During the process of doing research on forecasts of energy demand structure in Japan, documents published from organizations in inside and outside of Japan were collected. These documents include prospects of economic growth rate, forecasts of amount for energy supply and demand, the maximum amount of introducing new energy resources, CO2 regulation, and evaluation of energy best mixture. Organizations in Japan such as Economic Council and Japan Energy Economic Research Institute have provided long-term forecasts until the early 21st century. Meanwhile, organizations overseas have provided forecasts of economic structure, and demand and supply for energy in OECD and East Asia including Japan. In connection with forecasts of electricity generation cost in each power plant, views on the ultimate reserves and cost of resources are reviewed in this report. According to some views on oil reserves, making assumptions based on reserves/production ratio, the maximum length of the time that oil reserves will last is 150 years. In addition, this report provides summaries of cost and potential role of various resources, including solar energy and wind energy; and views on waste, safety, energy security-related externality cost, and the price of transferring CO2 emission right. (author)
ASME factory authorization system and the situation in Japan
International Nuclear Information System (INIS)
Futagawa, Kiyoshi
1978-01-01
Since about three or four years ago, the enterprises of machinery, iron and steel and welding materials in Japan are paying much attention to the acquisition of ASME (American Society of Mechanical Engineers) certificates or authorization to stamp the code symbols. That is, over 70 factories in Japan have undergone ASME examination, and consequently acquired the authorization or certificates. Such authorization is divided into over 20 kinds, of which about 7 are possessed by the companies in Japan. In nuclear field, the kinds of authorization are N (nuclear vessel), NPT (nuclear vessel parts), NV (nuclear vessel safety valve), and MM (material manufacturing). In non-nuclear fields, they are S (power boilers), U (pressure vessels, in Div. 1), and U2 (pressure vessels in Div. 2). The following matters are described: ASME setup, authorization procedures of ASME for factories, the kinds of authorization, factories in Japan holding the authorization or certificates, and renewal of the authorization. (Mori, K.)
The disappointments for nuclear energy in Japan
International Nuclear Information System (INIS)
2004-01-01
Several dysfunctions are reported in this paper: A reactor (Onagawa) closed after a nitrogen leakage; a small leakage of radioactive water in the nuclear power plant of Mihama assessment raised to five deaths, the operator stops its nuclear power plants for inspection, the Japan face to its ageing nuclear power plants, the truth about the cost of M.O.X., the seven reactors of Japan closed for inspection after cracks and leaks hidden to authorities, Tokai MURA accident. (N.C.)
Imported melioidosis in Japan: a review of cases
Directory of Open Access Journals (Sweden)
Hadano Y
2018-01-01
Full Text Available Yoshiro Hadano Department of Infectious Diseases, St. Mary’s Hospital, Kurume, Fukuoka, Japan Abstract: Fourteen cases of reported melioidosis in Japan were reviewed. The mean age was 52.4 years (33–69 years, and all patients were male. All of the presumed exposures originated in Southeast Asia. The most common underlying disease was diabetes mellitus, including those patients with impaired glucose tolerance (n=8. As for mode of onset, 13 patients had acute infections and one had chronic infection. Of these 14 patients, the most common infection site on admission was lung (n=8, followed by bone (n=5, skin (n=4, gastrointestinal abscess formation (n=3, urinary tract (n=3, aorta (n=2, mediastinal lymph node swelling (n=1, and central nervous system (n=1. Bacteremia was observed in nine patients, and Burkholderia pseudomallei isolates were mostly susceptible to ceftazidime and carbapenem. Overall mortality was 14.3%. Melioidosis is a rare infection in Japan, with all known cases to date having been imported from Southeast Asia. Diabetes was a common risk factor. Keywords: melioidosis, Burkholderia pseudomallei, Japan, Southeast Asia
Toward establishing basic rights of victims in Japan
Directory of Open Access Journals (Sweden)
Morosawa Hidemichi
2008-01-01
Full Text Available The author talks about improving victim rights in Japan and his important role in it. A period of Victims’ Renaissance in Japan began in the 1990s when the Japanese Association of Victimology and Mito Victim Assistance Cener, first non-governmental community-based integrated victim support center in Japan were established. Since May 1999 to May 2004, four laws such as “Crime Victim Protection Law”, “Child Abuse Prevention Law”, “Law for Proscribing Stalking Behavior” and so on were enacted and six laws were reformed. The word “rights of victim”, did not appear in any laws. After 2000, the National Association of Crime Victims and Surviving Families (NAVS played an important role. This Association achieved a great success in securing victims a position as the subject of rights. In June 2007, Japan changed the Criminal Procedure Law. This new law will be effective on six months after the day of promulgation. Japanese Government will promulgate it till the end of 2007. Under this new law, crime victims will be allowed to take part in criminal trials, and also make statements during trials.
Features of standardized nursing terminology sets in Japan.
Sagara, Kaoru; Abe, Akinori; Ozaku, Hiromi Itoh; Kuwahara, Noriaki; Kogure, Kiyoshi
2006-01-01
This paper reports the features and relationships between standardizes nursing terminology sets used in Japan. First, we analyzed the common parts in five standardized nursing terminology sets: the Japan Nursing Practice Standard Master (JNPSM) that includes the names of nursing activities and is built by the Medical Information Center Development Center (MEDIS-DC); the labels of the Japan Classification of Nursing Practice (JCNP), built by the term advisory committee in the Japan Academy of Nursing Science; the labels of the International Classification for Nursing Practice (ICNP) translated to Japanese; the labels, domain names, and class names of the North American Nursing Diagnosis Association (NANDA) Nursing Diagnoses 2003-2004 translated to Japanese; and the terms included in the labels of Nursing Interventions Classification (NIC) translated to Japanese. Then we compared them with terms in a thesaurus dictionary, the Bunrui Goihyo, that contains general Japanese words and is built by the National Institute for Japanese Language. 1) the level of interchangeability between four standardized nursing terminology sets is quite low; 2) abbreviations and katakana words are frequently used to express nursing activities; 3) general Japanese words are usually used to express the status or situation of patients.
Status of the HTGR development program in Japan
International Nuclear Information System (INIS)
Saito, S.
1991-01-01
According to the revision of the Long-Term Program for Development and Utilization of Nuclear Energy issued by the Japanese Atomic Energy Commission, High Temperature Engineering Test Reactor (HTTR), which is the first HTGR in Japan, will be constructed by the Japan Atomic Energy Research Institute (JAERI) in order to establish and upgrade the technology basis for an HTGR, serving at the same time as a potential tool for new and innovative basic research. The budget for the construction of the HTTR was approved by the Government and JAERI is now proceeding with the construction design of the HTTR, focussing the first criticality in the end of FY 1995. In order to establish and upgrade HTGR technology basis systematically and efficiently, and also to carry out innovative basic research on high temperature technologies, Japan will perform necessary R and D mainly at JAERI, which is a leading organization of the R and D. In addition, in order to promote the R and D on HTGRs more efficiently, Japan will promote the existing international cooperation with the research organizations in foreign countries. (author). 5 figs, 3 tabs
Empowered? Evaluating Japan's national energy strategy under the DPJ administration
International Nuclear Information System (INIS)
Valentine, Scott; Sovacool, Benjamin K.; Matsuura, Masahiro
2011-01-01
In August 2009, after 54 years of virtually unbroken rule, Japan's Liberal Democratic Party (LDP) was ousted from power by the Democratic Party of Japan (DPJ). The DPJ's campaign platform included a pledge to facilitate extreme reductions in greenhouse gas (GHG) emissions. Yet, at the COP16 meeting in Cancun, Japan announced that it would not accept further emission reduction targets without broader commitment from all nations. This paper seeks to explain this dichotomy by employing a targeted stakeholder evaluation based on surveys with 321 Japanese citizens to assess the extent to which influential stakeholder groups in Japan supports a potentially costly transition to a low-carbon energy infrastructure amidst severe economic challenges that the nation faces. Findings help explain Japan's adversarial role in COP16 negotiations in Cancun, despite the stated GHG reduction ambitions of Japan's current ruling party. The analysis concludes that if the DPJ does embrace aggressive CO 2 reduction targets in the future, the strategic focus will likely mirror the former ruling party's energy policy of bolstering nuclear power generation capacity and promoting energy efficiency improvements while exhibiting lukewarm commitment to supporting capacity development in alternative sources of energy supply such as solar panels and wind turbines. - Research highlights: → Public consensus exists regarding which energy policy goals are important in Japan. → Minor perceptual differences are not of a catalytic nature. → Public consensus does not deviate significantly from past LDP energy policy. → Unlikely that the DPJ will pursue costly energy transition initiatives. → Likely that the DPJ energy strategy will be substantively similar to LDP strategy. → Any differences in strategy will focus on CO 2 reduction magnitude not substance.
International Nuclear Information System (INIS)
Matsui, T.
1975-01-01
A report is given on the basic research and development in food irradiation in Japan. Two new irradiation facilities are extensively described. Basic research is performed in radiation chemistry of fruits, potatoes, fish products, meat products and model systems. Microbiological research is concerned with Clostridium botulinum and radicidation and radurization studies, as well as effects of combination treatment on Micrococcus radiodurans. Radiation treatment of grain, frutis, vegetables, potatoes, fish, meat and meat products and other commodities is performed. Wholesomeness studies are dealing with the nutritional value and animal feeding studies are carried out with irradiated potatoes, onions, rice, wheat, and sausages. Two short chapters are concerned with legislation and marketing. (MG) [de
Directory of Open Access Journals (Sweden)
John Lie
2013-12-01
Full Text Available Psy’s “Gangnam Style” was the global pop music and video sensation of 2012, but it failed to go viral in Japan. The involuted nature of the Japanese popular music industry—especially the imperative of indigenization—stunted the song’s dissemination. Simultaneously, the song failed to resonate with its potential base of Japanese K-pop fans, who valorized beauty and romance. In making sense of the Japanese reception of “Gangnam Style,” the author also analyzes the sources of both the Korean Wave and the anti–Korean Wave in Japan.
World's third-largest producer of nuclear power. Japan in need of energy
International Nuclear Information System (INIS)
Anon.
2008-01-01
Japan is the third largest oil consumer in the world behind the United States and China, and the second largest net importer of oil. Japan boasts one of the largest economies in the world. The country continues to experience a moderate economic recovery that began in 2003, following a decade of economic stagnation. Japan's real gross domestic product (GDP) grew by 2.5% in 2005 and 2.3% in 2004. The modest upturn over the last few years reflects higher business confidence in Japan, a surge in export demand led by exports to China, and robust consumer spending. Unemployment in Japan fell to 4.4% in 2005, down from an early 2003 peak of 5.5%. Japan has virtually no domestic oil or natural gas reserves, and in 2005 was the second largest net importer of crude oil in the world. Despite the country's dearth of hydrocarbon resources, Japanese companies have actively pursued upstream oil and natural gas projects overseas. Japan remains one of the major exporters of energy-sector capital equipment, and Japanese companies provide engineering, construction, and project management services for energy projects. (orig.)
Promoting Tourism Destination through Film-Induced Tourism: The Case of Japan
Directory of Open Access Journals (Sweden)
Wadim Strielkowski
2017-01-01
Full Text Available Purpose – This paper describes the marketing potential of film-induced tourism in marketing Japan, as a popular tourism destination for non-Asian visitors. In particular, it focuses on the popular culture and on engaging young people from Europe, America, and Australia in discovering and promoting its cultural heritage. Design/Methodology/Approach – The number of Western tourists to Japan rose by 50 % between 2010 and 2015. Many of these tourists are attracted by the films associated with Japan in one way or another. We assume that, even though the majority of incoming tourists in Japan are Chinese visitors, the marketing potential of film-induced tourism in Japan represents a source of untapped potential. One can trace the increase in the popularity of Japan as the tourism destination to a number of new Western films taking place in Japan. Findings and implications – We employ the monthly data on the combined box office revenues of recent films set in Japan, as well as the monthly statistics on the number of visitors from Australia, Europe, and North America. We find causality between the popularity of the films and the number of tourists from the destinations that are mostly impacted by those films. Limitations – The research is limited by the issue of popularity of Western culture and films in Asia. One should remember that just 3 million out of 19 million foreign tourists that visited Japan in 2015 were non-Asian. Originality – The popularity of films either related to or taking place in Japan is enormous in the Western world. Headed by the recent 2015 Hungarian dark comedy “Liza, the Fox-Fairy”, there is a whole array of films drawing from both exotic and cosmopolitan Japanese culture. The Japanese setting offers a picturesque scenery for melodramas, such as “Lost in translation” (USD 119.7 million in box office revenues or “Memories of a Geisha” (USD 162 million, horrors and thrillers, including “The Grudge” (USD
Cancer incidence and novel therapies developed in Japan
Directory of Open Access Journals (Sweden)
Masaru Iwasaki
2012-01-01
Full Text Available According to the ministry of Health, Labour and welfare of Japan, Cancer has been the leading cause of death in Japan since 1981. [1] As per the data in 2010, in Japan, one in every three deaths was due to cancer. [2] The Japanese Government has introduced so far, three terms of 10 years strategies for Cancer control since 1984 till date. The budget allocated for cancer control in 2009 was 52.5 billion yen in Japan. [3] Lung is the leading site for cancer in both males and females in Japan. In males, following the lung, stomach, liver, colon and pancreas are other leading sites while in the females, stomach, colon, pancreas and breast are the other leading sites.[1] In 2006, the cancer incidence was 694,000 and the male cancer incidence was 1.4 times as large as that of females. The peak age for cancer deaths in males is their fifties while in the females it is the sixties among Japanese. In addition to the conventional treatments such as surgery, radiotherapy and chemotherapy, some of other therapies in practice in Japan are the Hyperthermia [4] that uses high temperatures to kill or damage the cancer cells, the Ion Beam therapy using proton beams [5] to damage the DNA of the cells as cancer cells have high rate of cell divisions and lesser ability to repair DNA damage, the molecular targeted therapies that interfere with a specific molecular target involved in tumour growth and progression [6] and most importantly the autologous cell based Immunotherapies. Modern Cancer Immunotherapy started in the 1970s in Japan. The immunopotentiators using compounds from Bacteria, Beta Glucans from fungi were the first forms of modern Immunotherapy. Then was the era of direct injection of cytokines such as Interleukins, Interferons etc. The adverse effects associated with the injection of cytokines led to development of cell based Immunotherapies in the 1980s. [7] Immuno-cell therapies involve isolation of immune cells which are then processed and re
Current trends in rehabilitation engineering in Japan.
Ohnabe, Hisaichi
2006-01-01
In 2005, the elderly generation comprised 20% of the Japanese population. This percentage will grow to approximately 30% in 2030, meaning that nearly one in three people in Japan will be 65 years of age or older. Japan is the first nation in the world to face this situation. This article uses the context of Japanese society to give an overview of the elderly and people with disabilities; the International Classification of Functioning, Disability, and Health model; rehabilitation engineering-related policy; and education. In addition, we examine how governmental programs and Japanese law regarding technical aids may evolve by 2030. Partner robots, intelligent powered wheelchairs, nursing robots, and other technologies are introduced as examples of rehabilitation engineering and assistive technology. We also discuss the volunteer activities of the Rehabilitation Engineering Society of Japan (RESJA) in response to the Asian tsunami disaster and the achievements of a group of students from a Japanese senior high school of industry.
Status of cold fusion research in Japan
International Nuclear Information System (INIS)
Kitamura, Akira
2015-01-01
In Japan, the Condensed Matter Nuclear Science (CMNS) works have been centering around the Japan CF-Research Society (JCFRS) established in 1999. Recently, about 10 research groups were actively working in the CMNS field, and have been exchanging information mainly in the annual meetings of JCFRS in addition to the International ICCF conferences. For many years efforts have been exclusively devoted to clarification of the underlying physics of excess heat phenomenon and isotopic composition change. Recently, however, an entrepreneur group, Clean Planet Inc., has entered into the CMNS field in Japan, and joined Mizuno to form the above-mentioned group and made a presentation at the LANR/CF Colloquium, at MIT in March 2014. In their work they used glow discharge to form surface nanostructures on nickel mesh wires that are to be subjected to deuterium exposure. They claimed excess power on the order of kilowatts with a coefficient of performance of 1.9. Confirmation of their claim by third parties is highly expected
Review of mental-health-related stigma in Japan.
Ando, Shuntaro; Yamaguchi, Sosei; Aoki, Yuta; Thornicroft, Graham
2013-11-01
The aim of this study is to understand the nature and characteristics of mental-health-related stigma among Japanese people. We searched relevant studies in English or Japanese published since 2001 using MEDLINE and PsycINFO, and found 19 studies that examined mental-health-related stigma in Japan. Regarding knowledge about mental illness, reviewed studies showed that in the Japanese general population, few people think that people can recover from mental disorders. Psychosocial factors, including weakness of personality, are often considered the cause of mental illness, rather than biological factors. In addition, the majority of the general public in Japan keep a greater social distance from individuals with mental illness, especially in close personal relationships. Schizophrenia is more stigmatized than depression, and its severity increases the stigmatizing attitude toward mental illness. The literature also showed an association between more direct social contact between health professionals and individuals with mental illness and less stigmatization by these professionals. Less stigmatization by mental health professionals may be associated with accumulation of clinical experience and daily contact with people who have mental illness. Stigmatizing attitudes in Japan are stronger than in Taiwan or Australia, possibly due to institutionalism, lack of national campaigns to tackle stigma, and/or society's valuing of conformity in Japan. Although educational programs appear to be effective in reducing mental-health-related stigma, future programs in Japan need to address problems regarding institutionalism and offer direct social contact with people with mental illness. © 2013 The Authors. Psychiatry and Clinical Neurosciences © 2013 Japanese Society of Psychiatry and Neurology.
Koreans in Japan: Their Influence on Korean-Japanese Relations.
1979-09-01
1963. 31. The Republic of Korea National Red Cross, The Dispersed Families in Korea, Seoul, 1977. 32. Sato , Shoki, Koreans in Japan - The...1975. 34. Sumiya, Mikio , Kankoku no Keizai (The Korean Economy), Iwanami Shoten, Tokyo, Japan, 1974. 35. U.S. Government Printing Office, U.S. Army Area
Energy Technology Data Exchange (ETDEWEB)
Paulitz, Henrik; Eisenberg, Winfrid; Thiel, Reinhold
2013-03-06
On 11 March 2011, a nuclear catastrophe occurred at the Fukushima Dai-ichi nuclear power plant in Japan in the wake of an earthquake and due to serious safety deficiencies. This resulted in a massive and prolonged release of radioactive fission and decay products. Approximately 20% of the radioactive substances released into the atmosphere have led to the contamination of the landmass of Japan with 17,000 becquerels per square meter of cesium-137 and a comparable quantity of cesium-134. The initial health consequences of the nuclear catastrophe are already now, after only two years, scientifically verifiable. Similar to the case of Chernobyl, a decline in the birth rate was documented nine months after the nuclear catastrophe. Throughout Japan, the total drop in number of births in December 2011 was 4362, with the Fukushima Prefecture registering a decline of 209 births. Japan also experienced a rise in infant mortality, with 75 more children dying in their first year of life than expected statistically. In the Fukushima Prefecture alone, some 55,592 children were diagnosed with thyroid gland nodules or cysts. In contrast to cysts and nodules found in adults, these findings in children must be classified as precancerous. There were also the first documented cases in Fukushima of thyroid cancer in children. The present document undertakes three assessments of the expected incidence of cancer resulting from external exposure to radiation. These are based on publications in scientific journals on soil contamination in 47 prefectures in Japan, the average total soil contamination, and, in the third case, on local dose rate measurements in the fall of 2012. Taking into consideration the shielding effect of buildings, the medical organization IPPNW has calculated the collective lifetime doses for individuals at 94,749 manSv, 206,516 manSv, and 118,171 manSv, respectively. In accordance with the risk factors set by the European Committee on Radiation Risk (ECRR) for death
Suicide prevention strategies in Japan: a 15-year review (1998-2013).
Takeshima, Tadashi; Yamauchi, Takashi; Inagaki, Masatoshi; Kodaka, Manami; Matsumoto, Toshihiko; Kawano, Kenji; Katsumata, Yotaro; Fujimori, Maiko; Hisanaga, Ayaka; Takahashi, Yoshitomo
2015-02-01
Suicide is a global public health problem and solutions to it can be found only through a global dialog. The suicide rate in Japan has been alarming, but Japan has made substantial efforts to reduce this rate, making prevention a high priority. This report reviews the developmental stages of a comprehensive policy of suicide prevention in Japan from 1998 to 2013. Our review suggests that suicide prevention activities were facilitated by the 2006 Basic Act for Suicide Prevention and the 2007 General Principles of Suicide Prevention Policy. Along with the establishment of a Special Fund program for local governments, the Basic Act and General Principles led to the development of a comprehensive and multi-sector approach to suicide prevention. Suicide rates in Japan, especially among middle-aged men, decreased consistently after 2009, suggesting that the initiatives were effective. Continuous monitoring is needed to evaluate Japan's suicide prevention policy.
Japan, world leader of photovoltaic energy
International Nuclear Information System (INIS)
Strasser, F.
2006-01-01
Since the beginning of the 1970's, the potentialities of photovoltaic energy has been recognized by the Japanese government which has sustained this technology in two ways. First, by the financing of R and D programs, and second, by giving subsidies to citizens for the installation of solar panels. Today, Japan is the world leader of photovoltaic energy, both for the installed power and for the production of solar cells. In 2003, the International Energy Agency was reporting 1.809 GW of worldwide installed capacity among which 48% was in Japan (0.86 GW) with respect to 0.4 GW in Germany, 0.275 GW in the USA and only 20 MW in France. This capacity would have exceeded 1.1 GW at the end of 2004. Half of the solar modules are manufactured in Japan. The ministry of economy, trade and industry (METI) has fixed ambitious goals for 2010: the overall new energy sources much represent 3% of the primary energy (with respect to 1% today) and the installed capacity must reach 4.8 GW. The road-map of the New Energy and Industrial Technology Development Organisation (NEDO) foresees 100 GW by 2030. (J.S.)
Historical Change of Equilibrium Water Temperature in Japan
Miyamoto, H.
2015-12-01
Changes in freshwater ecosystems due to a climate change have been great concern for sustainable river basin management both for water resources utilization and ecological conservation. However, their impact seems to be difficult to evaluate because of wide variety of basin characteristics along a river network both in nature and social environment. This presentation uses equilibrium water temperature as a simple criterion index for evaluating the long-term changes of stream thermal environment due to the historical climate change in Japan. It examines, at first, the relationship between the equilibrium water temperature and the stream temperature observed for 7 years at a lower reach in the Ibo River, Japan. It analyzes, then, the seasonal and regional trends of the equilibrium water temperature change for the last 50 years at 133 meteorological station sites throughout Japan, discussing their rising or falling characteristics. The correlation analysis at the local reach of the Ibo River shows that the equilibrium water temperature has similar trend of change as the stream temperature. However, its value tends to be higher than the stream temperature in summer, while lower in winter. The onset of the higher equilibrium water temperature fluctuates annually from mid February to early April. This onset fluctuation at each spring could be influenced by the different amount of snow at the antecedent winter. The rising or falling trends of the equilibrium water temperature are analyzed both annually and seasonally through the regression analysis of the 133 sites in Japan. Consequently, the trends of the temperature change could be categorized by 12 patterns. As for the seasonal analysis, the results shows that there are many sites indicating the falling trend in spring and summer, and rising trends in autumn and winter. In particular, winter has the strong rising tendency throughout Japan. As for the regional analysis, the result illustrates the precise rationality; e
Another Neolithic in Holocene Japan
Directory of Open Access Journals (Sweden)
Masaki Nishida
2002-12-01
Full Text Available In the Japanese Islands, small sedentary villages sustained by hunting, gathering, fish- ing and cultivation emerged around 10 000 years ago. This life style of the Jomon people continued for around 7000 years without any drastic changes in material culture, subsistence strategy and vil- lage size until the diffusion of continental civilization into Japan approximately 2500 years ago. This indicates that the incipient sedentary society of the Jomon Period was very stable, a state which is not indicative of civilized society after that time. After the prehistoric situation in Japan, we are able to classify sedentary society into two phases; sedentism with stability and sedentism with instability (civilized society. Therefore it is possible to say that the emergence of sedentism and cultivation are not direct factors which promote the emergence of civilization.
DEFF Research Database (Denmark)
Tonami, Aki; Watters, Stewart
2013-01-01
There is a growing awareness in the Nordic region of Asia’s increased interest in the Arctic region and Arctic affairs, including in relation to Greenland. However, with the possible exception of China, there has been little Western scholarly work to analyze exactly why Asian countries...... are interested in the Arctic. Looking at the Arctic engagement of Japan and Singapore, this paper finds that their interest in the Polar Regions is not necessarily a new phenomenon and that Arctic policy, as with the development of other foreign policy objectives, is a complex mix of national, bureaucratic...... and group interests. For Greenlandic and Danish policymakers, it may be useful to understand the genesis of Japan and Singapore’s Arctic policies and that their interest is complex and multi-faceted....
International Nuclear Information System (INIS)
Cumin, D.; Joubert, J.P.
2003-01-01
This work analyzes the Japan nuclear policy, in the frame of its foreign and safety policy in Pacific Asia, since the end of the cold war, especially the relations with the Usa and China. The Japan is a civil power because it has submitted the military institution to juridical restrictions and because it does not rely on the armed force to promote its national interests. The anti nuclear speech is joined with the acknowledgement of the dissuasion necessity, of the control of industrial processes and energy channels susceptible of military applications. Cultivating the ambiguity, the Japanese government can send a dissuasive message, perfectly legible, kind of communication of latent intimidation constituted by the virtual nuclear power of a state that takes part to the non proliferation treaty. (N.C.)
International Nuclear Information System (INIS)
Foeldiak, G.
1974-01-01
A survey of the following general data on the use of radioisotopes in Japan is given (from the material of the 11th Japan Conference on Radioisotopes): 1. number of the organizations using radioactive isotopes, grouped according to special working fields and instruments; 2. amount of the unsealed sources (Ci) used in the different special working fields in 1971, 4. amount of the sealed sources (Ci) used between 1966 and 1971. 5. number of the institutions using sealed sources, grouped according to special working fields (March, 1972), 6. number of the accelerators applied, grouped according to special working fields (March, 1972), 7. number of the nuclear instruments in the education and research institutes (March, 1972), 8. amount of the collected radioactive waste material between 1960 and 1971 (number of containers). (K.A.)
Current Indoor Air Quality in Japan.
Jinno, Hideto
2016-01-01
People spend more than two thirds of their daily time indoors. Hence, maintaining a healthy indoor environment is indispensable for the prevention of building related illness. In Japan, guidelines for indoor air quality have been established for 13 volatile/semi-volatile organic compounds (VOCs/SVOCs). These guidelines are now under revision by the Committee on Sick House Syndrome: Indoor Air Pollution. In order to gain information on the current indoor air pollutants and their levels, we carried out a nation-wide survey of VOCs and aldehydes in indoor residential air during 2012-2013. In this review, I concisely summarized the current indoor air quality of Japan.
Status of SCRF cavity and ADS development in Japan
International Nuclear Information System (INIS)
Yamamoto, Akira
2011-01-01
SCRF cavity technology has progressed with high-energy particle accelerator programs in Japan. It was first applied for TRISTAN program at KEK, in early 1980s, and it is expected to be a key technology to realize the next energy-frontier lepton collider such as ILC, and/or intensity-frontier proton accelerators hopefully to be realized in Japan. The JPARC project as a joint program between JAEA and KEK is scoping to realize ADS program with the linac upgrade using a superconducting cavity system, as a future program. The talk will cover an overview of the SCRF cavity development and the ADS development in Japan. (author)
The law for the Japan Atomic Energy Research Institute
International Nuclear Information System (INIS)
1985-01-01
The Act for Japan Atomic Energy Research Institute has been promulgated anew. Contents are the following : general rules, officials, advisors and personnel, duties, financial affairs and accounts, supervision, miscellaneous rules, penal provisions, and additional rules. (In the additional rules, the merger into JAERI of Japan Nuclear Ship Research and Development Agency is treated.) Japan Atomic Energy Research Institute conducts research etc. for the development of atomic energy comprehensively and efficiently, thereby contributing to the promotion of atomic energy research, development and utilization, according to the Atomic Energy Fundamental Act. Duties are atomic energy basic and application research, reactor relation, training of the personnel, RIs relation, etc. (Mori, K.)
Attitudes toward the Homeless: A U.S.-Japan Comparison.
Guzewicz, Tony D.; Takooshian, Harold
1993-01-01
Compares attitudes toward the homeless in Japan and the United States through a survey of 268 Japanese and 254 U.S. adults and adolescents interviewed in public places. In Japan, homelessness is seldom discussed, and poverty, which may be as widespread as in the United States, is often not recognized. (SLD)
Tokugawa Japan and Industrial Revolution Britain: Two Misunderstood Societies
Ellington, Lucien
2013-01-01
In this article, the author presents a truer picture than economic historians have previously had of the economies of Tokugawa Japan, and Britain during the Industrial Revolution. Though substantially different, both societies were prosperous compared to most of the rest of the world. Japan's economic success began in the Tokugawa period…
Shinmura, Hiromi; Wakabayashi, Chihiro; Kunisawa, Naoko; Kayaba, Kazunori; Miura, Yoshihiko; Ojima, Toshiyuki; Yanagawa, Hiroshi
2008-03-01
Smoking cessation is one of the most important items for improvement of health in Japan. The Japanese government started a new campaign called the "Health Japan 21" to promote better health of Japanese citizens in the 21st century. The purpose of the present study was to observe the situation of the municipalities throughout Japan regarding implementation of anti-smoking countermeasures and setting of the level of target values to be achieved over the next ten years. Mail questionnaire forms were sent to 953 municipalities which had formulated specific local plans for the promotion of health. Of this total, 793 (83.2%) responded to the inquiry. The most commonly implemented countermeasure against smoking was restricting smoking only to limited areas in municipality offices (75%), followed by providing support for stopping smoking (35%), and providing a complete smoke free environment in municipality offices (32.4%). Proportions of local governments putting a ban on smoking on public roads (7.5%), giving publicity to restaurants with smoking restrictions (vending machines and restricting tobacco advertisement. Most municipalities have made much of anti-smoking activities. However, measures for school children were not satisfactorily implemented. The execution rates for anti-smoking activities are low in small-scale municipalities and therefore it is necessary to provide particular support in these cases.
Japan Sea expeditions for studies on water circulation and transport processes of radionuclides
International Nuclear Information System (INIS)
Togawa, Orihiko; Ito, Toshimichi; Kobayashi, Takuya; Otosaka, Shigeyoshi; Suzuki, Takashi
2006-02-01
The Japan Sea expeditions at the Japan Atomic Energy Agency (JAEA from October 1, 2005, former JAERI: Japan Atomic Energy Research Institute until September 30, 2005) were started on its participation in the first and second Japanese-Korean-Russian joint expeditions in 1994 and 1995 to investigate the situation on marine pollution due to radioactive wastes dumped in the Japan Sea and other seas around Japan. After the joint expeditions, JAEA continued to conduct the Japan Sea expeditions not only to monitor the impacts of radioactive wastes dumped in the Japan Sea, but also to investigate water circulation and the migration behavior of radionuclides in the Japan Sea. Taking account of some difficulties and constraints due to the political boundaries in the Japan Sea, the expeditions were carried out, separating the sea into two regions; one is the Japanese exclusive economical zone (EEZ) and the other is the Russian EEZ. The data of observations and measurements obtained in the two regions were analyzed together. The program of the Japan Sea expeditions included large-volume seawater sampling at different depths and seabed sediment sampling for measurements of representative anthropogenic radionuclides. To investigate the migration behavior of the radionuclides more in detail, associated oceanographic observations were also implemented; CTD/MBS (conductivity-temperature-depth meter with multi-bottle sampler) casts, analysis of dissolved oxygen and nutrients, deployment and recovery of mooring systems with current meters and sediment traps, and so on. Additional seawater samples were taken with CTD/MBS for further analysis on land. This report summarizes the results of the Japan Sea expeditions (Phase 1) conducted and/or jointed by JAEA from 1994 to 2002. First the report explains oceanographic features of the Japan Sea, main expeditions in the past and the summarized results of the Japanese-Korean-Russian joint expeditions. Then the report gives an outline of the
International Nuclear Information System (INIS)
Anon.
1988-01-01
Intended for Canadian readers, this popular account was suggested by the Sixth Pacific Basin Nuclear Conference. Economic, political, geographic, sociological and historical aspects of the nuclear programmes of China, South Korea and Japan are discussed. The importance of past, present and future Canadian nuclear trade with the area is indicated
Japan's Energy and Climate Policy: Towards Dispelling the Uncertainties
International Nuclear Information System (INIS)
Cornot-Gandolphe, Sylvie; Mathieu, Carole
2015-05-01
Four years after the Great East Japan Earthquake and a few months before the opening of the Paris Climate Conference, Japan is about to clarify its energy and climate policy. Already in spring 2014, the Cabinet of Prime Minister Shinzo Abe released the 4. Strategic Energy Plan, drawing the first lessons for the post-Fukushima era. The zero-nuclear scenario was abandoned, although it was established that dependence on nuclear should be as low as possible. Later in 2014, two expert panels were requested to work on quantitative targets for 2030, both in terms of future split between sources for power generation and in terms of greenhouse gas (GHG) emission reduction. The Cabinet's final decisions are expected for June 2015. The draft proposals are already known and suggest that Japan is determined to find a proper balance between system stability, energy security and cost control objectives on the one hand, and the need to reduce domestic GHG emissions on the other hand. Because this task is highly challenging, the government's proposals are unlikely to gain unanimous support, neither domestically nor from the international community. Taking into account the March 2015 decision to decommission five reactors, Japan now has 43 operable nuclear power plants with a capacity of 40.47 GW. Should all of them come back online, their total capacity would be sufficient to meet the draft 2030 target (20-22% share of electricity production), provided that electricity consumption does not rise significantly and that the lifetime of the nuclear plants is extended to 60 years. Although the approved restart of some nuclear units is a milestone for Japan's nuclear industry and energy mix, there are still uncertainties around the scale and timing of the restart, in particular because of the local opposition. Japan aims at increasing the share of renewable electricity production, which is set to reach 22-24% in 2030. Such target does not seem particularly ambitious, knowing that the
Formation rate of water masses in the Japan Sea
International Nuclear Information System (INIS)
Kawamura, Hideyuki; Ito, Toshimichi; Yoon, Jong-Hwan
2007-01-01
Water masses in the subsurface and the intermediate layer are actively formed due to strong winter convection in the Japan Sea. It is probable that some fraction of pollution is carried into the layer below the sea surface together with these water masses, so it is important to estimate the formation rate and turnover time of water masses to study the fate of pollutants. The present study estimates the annual formation rate and the turnover time of water masses using a three-dimensional ocean circulation model and a particle chasing method. The total annual formation rate of water masses below the sea surface amounted to about 3.53±0.55 Sv in the Japan Sea. Regarding representative intermediate water masses, the annual formation rate of the Upper portion of the Japan Sea Proper Water (UJSPW) and the Japan Sea Intermediate Water (JSIW) were estimated to be about 0.38±0.11 and 1.43±0.16 Sv, respectively, although there was little evidence of the formation of deeper water masses below a depth of about 1500 m in a numerical experiment. An estimate of turnover time shows that the UJSPW and the JSIW circulate in the intermediate layer of the Japan Sea with timescales of about 22.1 and 2.2 years, respectively. (author)
Outlook for coal and air quailty legislation in Japan
International Nuclear Information System (INIS)
Nagata, Nobuo
1992-01-01
Japan imported over 110 million tons of coal in fiscal year 1991 ending 31 March 1992. The recent demand prospect assumes that coal imports will amount up to 150 million tons at the end of the century despite the long-term energy forecast (May 1990). Stable and reasonable imports of coal will be very important for the national economy because Japan can not rely on domestic coal which will inevitably be decreasing from a production level of only about eight million tons in 1991. Regarding environmental standards, Japan has enacted the world's most severe regulations to eliminate emissions of SOx, NOx, etc. However, the restriction of emissions of carbon dioxide remains an important subject with regard to global greenhouse issues. Japan has been proposing a so-called open-quotes New Earth 21 Programclose quotes which emphasizes the importance of clean uses of coal with a view to keeping pace with the requirements of rapidly developing ASEAN and other countries. Coal water mixture (CWM) produced in China began to be regularly exported to Japan in March 1992. On the other hand, a large-scale CWM production and combustion project of 500,000 tons/year was launched last fall in the Onahama/Nakoso area, about 200 km north of Tokyo. It is expected to begin commercial operation in June 1993
International Nuclear Information System (INIS)
2011-01-01
The French institute of radiation protection and nuclear safety (IRSN) collects and analyses regularly the published data concerning the contamination of the Japanese terrestrial environment caused by the Fukushima Dai-ichi power plant accident. This synthesis presents a status of the data recently obtained since the previous similar notes of April 12 and May 25. The note presents the detailed activity analysis of several surface soil samples (Iitate Maeda, Namie, Hirono, Fukushima..), a mapping of 137 Cs and 134 Cs cumulated deposits in a 80 km area around the damaged power plant, the evolution of radioactive deposits since March 2011 in different places (Fukushima, Hitachinaka, Saitama, Utsunomiya), the evolution of the 134 Cs+ 137 Cs and 131 I contamination of agriculture food products and of drinking water. The IRSN has detected also a significant contamination of some tea samples imported from the Omaezaki region and intercepted by the French customs. Some information about tea and bamboo shoots cultivation and processing in Japan is added in appendix. (J.S.)
Lens dislocation has a possible relationship with laser iridotomy
Directory of Open Access Journals (Sweden)
Mutoh T
2012-12-01
Full Text Available Tetsuya Mutoh,1,2 Kevin F Barrette,2 Yukihiro Matsumoto,1 Makoto Chikuda11Department of Ophthalmology, Dokkyo Medical University Koshigaya Hospital, Koshigaya City, Saitama, Japan; 2Department of Ophthalmology, Boston University School of Medicine, Boston, MA, USAAbstract: We report our recent experience of four eyes with spontaneous lens dislocation in four patients with no history of trauma or any systemic disease associated with zonular dialysis. Lens dislocation developed with 0.5 to 6 months following laser iridotomy. All patients were male and two eyes were complicated with acute primary angle closure glaucoma preoperatively. Case 1 showed bilateral lens dislocation, while cases 2 and 3 involved unilateral lens dislocation. Cases 2 and 3 showed lenses completely dislocated into the vitreous cavity. All cases needed lens removal and scleral fixation of intraocular lenses. Final visual acuity was 1.2 in all cases. We suspect that laser iridotomy may induce localized zonular dialysis that results in progressive zonular weakness, leading to lens dislocation.Keywords: lens dislocation, laser iridotomy, primary angle closure glaucoma
The Role of Akt Isoforms in Colorectal Cancer
2015-09-01
AD_________________ Award Number: W81XWH-13-1-0198 TITLE: The Role of Akt Isoforms in Colorectal Cancer PRINCIPAL INVESTIGATOR: Jatin Roper...CONTRACT NUMBER The Role of Akt Isoforms in Colorectal Cancer 5b. GRANT NUMBER W81XWH-13-1-0198 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER...substantially reduces colorectal tumorigenesis in our genetically engineered mouse model. We also successfully ablated novel downstream targets of Akt in our
Japan's regulatory and safety issues regarding nuclear materials transport
International Nuclear Information System (INIS)
Saito, T.; Yamanaka, T.
2004-01-01
This paper focuses on the regulatory and safety issues on nuclear materials transport which the Government of Japan (GOJ) faces and needs to well handle. Background information about the status of nuclear power plants (NPP) and nuclear fuel cycle (NFC) facilities in Japan will promote a better understanding of what this paper addresses
Yoshiki Hotta and the dawn of zebrafish molecular neurogenetics in Japan.
Higashijima, Shin-Ichi; Okamoto, Hitoshi
2012-03-01
Abstract: After coming back to Japan to work in the Department of Physics at the University of Tokyo, Yoshiki Hotta spent a year or so on searching for behavioral mutants of goldfish. Although this endeavor did not succeed, he remained an adamant supporter of the development of zebrafish research in Japan. Here we review how his support helped zebrafish neurogenetics in Japan gain a unique position in the world research community.
Travel-related illness at a tertiary care hospital in Osaka, Japan
Hadano,Yoshiro; Shirano,Michinori; Goto,Tetsushi
2016-01-01
Yoshiro Hadano, Michinori Shirano, Tetsushi Goto Center for Infectious Diseases, Osaka City General Hospital, Osaka, Japan Abstract: We analyzed the travel-related health problems in persons returning to Japan from overseas. Data were extracted retrospectively for all patients visiting the infectious diseases department of Osaka City General Hospital, Osaka, Japan, between July 2012 and September 2013. There were 209 sick returning travelers during the period of the study. ...
Political economy of tobacco control policy on public health in Japan.
Desapriya, E B R; Iwase, Nobutada; Shimizu, Shinji
2003-02-01
Tobacco use, particularly smoking, remains the number one cause of preventable disease and mortality in Japan. This review of the tobacco control policy and public health is the first to offer a composite review of the subject within Japan. This review attempts to evaluate the most important aspects of the current political economy of the tobacco control policy, and concludes that more effective control policies must be employed to minimize the impact of smoking on the public's health in Japan. Further the article attempts to place the approaches in the larger context of tobacco control, providing a vision for the future of tobacco prevention and control based on current knowledge. Tobacco use will remain the leading cause of preventable illness and death in Japan, until tobacco prevention and control efforts are commensurate with the harm caused by tobacco. Taken together, the results of various studies have clearly shown that control measures can influence tobacco smoking patterns, and in turn, the rate of tobacco-related problems. Government tobacco taxes have not kept pace with inflation for years. Availability of tobacco is virtually unlimited with easy access and the prices being very low due to the strong currency of Japan. Thus Japan must be one of the most tobacco accessible countries. It is important to ensure that people are not conditioned to smoke tobacco by an unduly favourable economic and commercial environment. For that reason, prevention advocates have called for substantial regulation of tobacco products and appeal for both tobacco tax increases and tobacco taxes to be indexed to inflation. In this review, present tobacco related public health policies in Japan are discussed with implication for prevention of tobacco related problems. Continued research in this area will be necessary to determine the most effective policies of reducing tobacco related problems in Japan.
Analyses of CO2 emissions embodied in Japan-China trade
International Nuclear Information System (INIS)
Liu Xianbing; Ishikawa, Masanobu; Wang Can; Dong Yanli; Liu Wenling
2010-01-01
This paper examines CO 2 emissions embodied in Japan-China trade. Besides directly quantifying the flow of CO 2 emissions between the two countries by using a traditional input-output (IO) model, this study also estimates the effect of bilateral trade to CO 2 emissions by scenario analysis. The time series of quantifications indicate that CO 2 emissions embodied in exported goods from Japan to China increased overall from 1990 to 2000. The exported CO 2 emissions from China to Japan greatly increased in the first half of the 1990s. However, by 2000, the amount of emissions had reduced from 1995 levels. Regardless, there was a net export of CO 2 emissions from China to Japan during 1990-2000. The scenario comparison shows that the bilateral trade has helped the reduction of CO 2 emissions. On average, the Chinese economy was confirmed to be much more carbon-intensive than Japan. The regression analysis shows a significant but not perfect correlation between the carbon intensities at the sector level of the two countries. In terms of CO 2 emission reduction opportunities, most sectors of Chinese industry could benefit from learning Japanese technologies that produce lower carbon intensities.
Directory of Open Access Journals (Sweden)
Reilis Fuentes-Guilarte
2016-05-01
Full Text Available El objetivo fue establecer el comportamiento microestructural de una unión disímil de acero inoxidable austenítico AISI 321 y de la aleación A 351 grado HK 40 obtenida por fundición mediante soldadura manual por arco eléctrico y electrodos revestidos del tipo E 309 L-16. La estructura ferrita–austeníta que se forma en la unión del acero con la aleación es resultado del elevado contenido de carbono de la segunda. La baja velocidad de enfriamiento del cordón de soldadura revela ausencia de discontinuidades en el retículo cristalino de la zona afectada térmicamente y atenúa la formación de carburos de cromo del tipo Cr23C6, que puede formar la aleación A 351 grado HK 40 durante la difusión del volumen de fracción en masa del cromo.
Development of nuclear powered ship in Japan
International Nuclear Information System (INIS)
Sato, Hiroshi
1976-01-01
The development of nuclear merchant ship in Japan was started in 1955 by the establishment of Nuclear Ship Study Group, and since then, the investigation, test and research on nuclear ships have been continued. As a result, a nuclear ocean observation and supply ship was designed for trial. Researches were carried out also in JAERI and Institute for Technical Research of Ships. Meanwhile, the nuclear icebreaker Lenin was completed in Soviet Union in 1959, the nuclear ship Savannah set out for maiden voyage in U.S. in 1962, and the construction of the nuclear ore carrier Otto Hahn was prepared in FRG. Japan Nuclear Ship Development Corp. was established in 1963, and started the design and construction of the first nuclear ship in Japan, Mutsu. The basic policy in the construction is the improvement of nuclear ship technology, the securing of safety, and the use of domestic technologies as far as possible. The progress of the design, construction and test of the Mutsu is described. Owing to the problem of radiation leak, the development of nuclear ships stagnated for a while, but the nuclear plant of the Mutsu demonstrated the expected performance in the functional test, land criticality test and zero output test, and it is expected that the bud of the independent development brought up so far can bear valuable fruit. The independent development of marine nuclear reactors should be continued by selecting the way most suitable to Japan. (Kako, I.)
Post-Fukushima Japan: The continuing nuclear controversy
International Nuclear Information System (INIS)
Fam, Shun Deng; Xiong, Jieru; Xiong, Gordon; Yong, Ding Li; Ng, Daniel
2014-01-01
The Fukushima disaster was a wake-up call for the nuclear industry as well as a shocking revelation of the inner workings of the Japanese power sector. The political fallout from the event was far-reaching, pushing governments into abandoning nuclear expansion, turning instead to fossil fuels and renewable energy alternatives. While the move away from nuclear energy was deemed a move critical to political survival in Europe, we find that political candidates running on anti-nuclear platforms did not win elections, while the pro-nuclear Liberal Democratic Party won government in the 2012 elections. Against this backdrop, we analyse the energy conflict in Japan using a framework of values versus interests and consider the regulatory and cultural conditions that contributed to the disaster. A number of considerations lie in the way of an organised phase-out of nuclear power in Japan. We also consider the possible policy paths Japan may take. - Highlights: • As Europeans urgently phase-out nuclear power, Japan voted out such a government despite high anti-nuclear sentiment. • Regulatory climate within the nuclear industry was dysfunctional as a result of being captured by the ‘nuclear village’. • New ‘independent’ nuclear authority is made up of previously captured agency. • With a pro-nuclear government, and lack of really independent nuclear authority, old problems may yet arise. • Japanese government has to choose between lowering emissions, low popular support for nuclear power, and affordable electricity
Military aspect of nuclear policy of Japan
International Nuclear Information System (INIS)
Fujita, Yuko
2011-01-01
Military aspect of nuclear policy of Japan was outlined. In 1952 Prime Minister Yoshida asked to prepare production of weapons for rearmament and to establish Science and Technology Agency such as to overcome lack of science research budget and inefficiency of research and cooperation. Kaya and Fushimi proposed establishment of Atomic Energy Commission as recommendation of Science Council of Japan. In 1954 Nakasone proposed budget for nuclear energy with yen 235 million to construct reactor. In 1955 Japanese delegation participated in international conference on peaceful use of nuclear energy at Geneva and nonpartisan members proposed Atomic Energy Basic Law, which limited the use of nuclear technology to peaceful purposes, ensured three principles - democratic methods, independent management, and transparency - as the basis of nuclear research and promoted international co-operation. In 1956 Atomic Energy Commission and Science and Technology Agency were established with other organizations under this law. According to internal report in the age of Prime Minister Sato, nuclear policy in Japan would be (1) no holding nuclear weapon for the time being, (2) maintaining economic and technical potential of nuclear weapon production and (3) considering no restraint for this policy whether Japan participated in NPT or not. Fuel cycle program of Monju reactor and reprocessing for power production seemed to be deployed corresponding to (3) above. Irradiated blanket of Monju reactor could be reprocessed to produce highly purified plutonium suited for nuclear bombs. (T. Tanaka)
Radioactivity survey data in Japan
International Nuclear Information System (INIS)
1981-06-01
Strontium-90 and cesium-137 in Japan were determined in rain and dry fallout, airborne dust, service water, total diet, rice, milk, vegetables, sea fish, shellfish, and seaweeds. The results were shown in tables. (J.P.N.)
Ethics Education for Professionals in Japan: A Critical Review
Maruyama, Yasushi; Ueno, Tetsu
2010-01-01
Ethics education for professionals has become popular in Japan over the last two decades. Many professional schools now require students to take an applied ethics or professional ethics course. In contrast, very few courses of professional ethics for teaching exist or have been taught in Japan. In order to obtain suggestions for teacher education,…
International Nuclear Information System (INIS)
Le Ngoc, Boris; Jouette, Isabelle
2015-01-01
A set of articles addresses the restart of nuclear plants in Japan. The first one presents the Sendai nuclear plant, evokes the commitment of the Japanese nuclear safety authority (the NRA) at each step of the restart process, the agreement of local populations, the loading of the nuclear fuel, a successful crisis exercise, and the benefits expected from this restart. The second article addresses the restart process with its administrative aspects, the implication of local authorities, its technical aspects, and investments made to improve nuclear safety. The third article proposes an interview of the nuclear expert of the French embassy in Tokyo. He outlines that the restart of nuclear plants will be progressive, comments how Sendai restart has been commented in the Japanese press, evokes how this restart is part of the Japanese Prime Minister's policy, evokes the role and challenges of nuclear energy in Japan for the years to come, and the role France may play. The last article discusses the role of nuclear energy in Japan in 2015: importance of the old 3E policy (Energy, Environment, Economy) which is put into question again by the Fukushima accident, creation of a new nuclear safety authority as a first step before restarting nuclear reactors
Textbook Development and Selection in Japan and the United States.
Tani, Masaru; And Others
1993-01-01
Reports on a study trip by 13 U.S. social studies educators and publishers to Japan. Compares development, marketing, and selection of textbooks in the United States and Japan. Concludes that both nations should improve textbooks and textbook selection processes. (CFR)
Eosinophilic Chronic Rhinosinusitis in Japan
Directory of Open Access Journals (Sweden)
Junichi Ishitoya
Full Text Available ABSTRACT: Chronic rhinosinusitis is a heterogeneous disease. In Europe and the United States, it has recently been divided into two subgroups: chronic rhinosinusitis with nasal polyps (CRSwNP and chronic rhinosinusitis without nasal polyps (CRSsNP. The majority of CRSwNP cases have a strong tendency to recur after surgery and show eosinophil-dominant inflammation. However, this definition has proved difficult to apply in Japan and East Asia, because more than half of the CRSwNP cases do not exhibit eosinophil-dominant inflammation in these areas of the world. In Japan in the 1990s, refractory CRSwNP to the standard treatment was focused on in clinical studies and the term ''eosinophilic chronic rhinosinusitis'' (ECRS was introduced to identify this subgroup of chronic rhinosinusitis in 2001.ECRS is different from non-ECRS in terms of many clinical features: symptom appearance, occurrence site of nasal polyps, CT scan findings, the histology of nasal polyps, blood examination findings, clinical course after surgery, and co-morbid asthma, etc. In this review, we describe these clinical features and mention how to make a clinical diagnosis of ECRS as well as how to treat it. Finally, we discuss the pathophysiology of ECRS. The concept of ECRS in Japan would be applicable for CRSwNP in other countries including Europe and the United States. KEY WORDS: chronic rhinosinusitis, clinical feature, diagnosis, eosinophilic chronic rhinosinusitis, eosinophils
Japan after the Quake: Prospects for climate policy
International Nuclear Information System (INIS)
Luta, Alexandru
2011-01-01
The triple calamity of 11 March 2011 has dealt a serious blow domestically to the credibility of the Japanese nuclear industry, putting the country's energy policy in flux.The severe impact on the country's infrastructure, the unwieldiness of its bureaucracy and the chaotic political situation preclude Japan's energy policy from explicitly re-orientating itself before the middle of 2012, but political consensus seems to be emerging that the country's mid-term pledge on emission reductions will need to be curtailed.The bill on renewable energy passed under Prime Minister Kan marked a step in the right direction, but was shallow and politically opportunistic. Its future impact on policy is uncertain.With other policy instruments on climate proposed by the Democratic Party of Japan toothless or abandoned, Tokyo's ability to engage in significant mitigation activities domestically is in question.Opposition to a second commitment period to the Kyoto Protocol remains firm; Japan will continue to pursue bilateral mechanisms outside the UNFCCC framework.Given its frail domestic policy and a stated readiness to act internationally outside multilateral frameworks, Japan's promise to carry out significant mitigation activities even in the absence of a clear and comprehensive post-2012 legal instrument should be viewed with a critical eye.(Author)
Return of vitrified wastes from France to Japan
International Nuclear Information System (INIS)
2000-01-01
The radioactive wastes resulting from the burnup of nuclear fuels in nuclear reactors represent 3 to 5% of the spent fuel. These wastes cannot be reused nor recycled and thus are vitrified after reprocessing. Japanese power companies have signed contracts with Cogema in France and BNFL in the UK for the reprocessing of their spent fuels. Then, the ultimate reprocessed wastes are sent back to Japan for storage. This information dossier takes stock of different questions relative to the transport of the vitrified wastes from France to Japan: why France sends back containers of vitrified wastes to Japan? What is a vitrified wastes container made of? How containers are transported? What is the regulatory frame applicable to these transports? Which safety measures are taken during transport? Which physical protection is applied? Which temporary storage facilities are used before and after transportation? How is performed the ultimate storage of wastes in Japan? Which quality and safety warranties are taken? Which emergency plans and exercises are provided? What are the applicable civil liability regimes? And what kind of information is given to the public about these transports. Some general information about energy and nuclear power worldwide, energy and environment, radioactivity, BNFL, Cogema and ORC is given in appendixes. (J.S.)
Engineering experiences through nuclear power development in Japan
International Nuclear Information System (INIS)
Uchida, Hideo
2004-01-01
This keynote paper deals with: energy issues and nuclear power development in Japan, problems of radiation protection, licensing and safety regulations, research on LOCA and ECCS, stress corrosion cracks related to pressure vessels, nuclear fuel failures, steam generators, incidents, waste management and fuel cycle facilities. In conclusion it is stated that: on order to cope with global matters vitally affecting the electricity generation, taking into consideration Japanese specific energy issues, the nuclear power development has been an indispensable policy of Japan. In order to proceed with further development of nuclear power plants, it is necessary to obtain proper understanding by the public, showing assurance of the safety and reliable operation of nuclear power plants through daily plant operation. The nuclear safety issues should be considered from a global point of view. It is necessary to establish common safety standards which could harmonize the safety level of nuclear power plants in the world. The safety goal concerning severe accidents should be established as an internationally agreeable one. Japan has accumulated highly technological experience in maintenance of nuclear power plants. It is believed that the cumulative experiences in Japan can contribute to the further improvement of safety of nuclear power plants throughout the world, and for this aim a mutual information exchange should be encouraged
Radiological consequence of Chernobyl nuclear power accident in Japan
International Nuclear Information System (INIS)
Uchiyama, Masafumi; Nakamura, Yuji; Kankura, Takako; Iwasaki, Tamiko; Fujimoto, Kenzo; Kobayashi, Sadayoshi.
1988-03-01
Two years have elapsed since the accident in Chernobyl nuclear power station shocked those concerned with nuclear power generation. The effect that this accident exerted on human environment has still continued directly and indirectly, and the reports on the effect have been made in various countries and by international organizations. In Japan, about the exposure dose of Japanese people due to this accident, the Nuclear Safety Commission and Japan Atomic Energy Research Institute issued the reports. In this report, the available data concerning the envrionmental radioactivity level in Japan due to the Chernobyl accident are collected, and the evaluation of exposure dose which seems most appropriate from the present day scientific viewpoint was attempted by the detailed analysis in the National Institute of Radiological Sciences. The enormous number of the data observed in various parts of Japan were different in sampling, locality, time and measuring method, so difficulty arose frequently. The maximum concentration of I-131 in floating dust was 2.5 Bq/m 3 observed in Fukui, and the same kinds of radioactive nuclides as those in Europe were detected. (Kako, I.)
Hasegawa, Junichi; Sekizawa, Akihiko; Tanaka, Hiroaki; Katsuragi, Shinji; Osato, Kazuhiro; Murakoshi, Takeshi; Nakata, Masahiko; Nakamura, Masamitsu; Yoshimatsu, Jun; Sadahiro, Tomohito; Kanayama, Naohiro; Ishiwata, Isamu; Kinoshita, Katsuyuki; Ikeda, Tomoaki
2016-03-21
To clarify the problems related to maternal deaths in Japan, including the diseases themselves, causes, treatments and the hospital or regional systems. Descriptive study. Maternal death registration system established by the Japan Association of Obstetricians and Gynecologists (JAOG). Women who died during pregnancy or within a year after delivery, from 2010 to 2014, throughout Japan (N=213). The preventability and problems in each maternal death. Maternal deaths were frequently caused by obstetric haemorrhage (23%), brain disease (16%), amniotic fluid embolism (12%), cardiovascular disease (8%) and pulmonary disease (8%). The Committee considered that it was impossible to prevent death in 51% of the cases, whereas they considered prevention in 26%, 15% and 7% of the cases to be slightly, moderately and highly possible, respectively. It was difficult to prevent maternal deaths due to amniotic fluid embolism and brain disease. In contrast, half of the deaths due to obstetric haemorrhage were considered preventable, because the peak duration between the initial symptoms and initial cardiopulmonary arrest was 1-3 h. A range of measures, including individual education and the construction of good relationships among regional hospitals, should be established in the near future, to improve primary care for patients with maternal haemorrhage and to save the lives of mothers in Japan. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Japan steps up overseas pace to compensate for nuclear doldrums at home
International Nuclear Information System (INIS)
Shepherd, John
2015-01-01
The recent re-election of Japan's prime minister Shinzo Abe is seen by many commentators as a largely positive move, in terms of political support for a slow revival of Japan's commercial nuclear fortunes. But Japan's nuclear companies cannot expect a return to 'business as usual' anytime soon and so have set their sights on overseas markets. The government has supported Japan's industrial giants as they renew efforts to enter foreign markets, such as Vietnam and Turkey. It is hardly surprising to note that this move is not popular with some environmentalists and opposition politicians. Critics argue that Japan is not best-placed to be selling its nuclear know-how and technologies elsewhere in the light of the Fukushima-Daiichi disaster. But those critics fail to acknowledge advances made since plants such as Fukushima-Daiichi were built in the 1960ies. A report released by Japan's Institute of Energy Economics (IEE) towards the end of last December showed why nuclear firms desperately need to tap business opportunities overseas.
Establishment of the Japan Atomic Energy Agency
International Nuclear Information System (INIS)
Okazaki, Toshio
2006-01-01
A goal of the 21. century is for society to pursue 'sustainable economic development and prosperous life by recycling resources', thus rejecting 'development based on the waste of resources'. For Japan, which has limited energy resources, it is important to secure safe, inexpensive, environmentally friendly energy resources having long-term availability. To contribute to long-term energy security and solve global environmental issues, and to create advanced competitive science and technology, the Japan Atomic Energy Agency (JAEA) was established by integrating the Japan Atomic Energy Research Institute (JAERI) and the Japan Nuclear Cycle Development Institute (JNC) in October 2005. JAEA is endeavoring to establish nuclear fuel cycles, to contribute to social improvement through hydrogen production initiated by atomic energy, and to pursue research and development of thermonuclear fusion and quantum beam technology. This paper reviews the main R and D activities of JAEA. The structure of the paper is the following: 1. Introduction; 2. Japan Atomic Energy Agency; 3. Efforts to Commercialize the Fast Reactor Cycle; 4. Monju Progress; 5. Geological Disposal of High-Level Radioactive Waste R and D; 6. High Temperature Gas-Cooled Reactor System R and D; 7. Fusion Research and Development; 8. LWR Spent Fuel Reprocessing Technology; 9. Quantum Beam Technologies; 10. Nuclear Safety Research and Regulatory Applications; 11. Basic Science and Engineering Research; 12. Contribution to the Enhanced International Nonproliferation Regimes; 13. Conclusions. To summarize, JAEA will promote the above R and D activities, addressing the following commitments: - On problems that atomic energy faces, we shall extend technical assistance in response to the government and the industrial sectors. - We shall produce technical options to attain political goals to secure medium to long-term stable energy supplies and to solve global environmental issues. - With the high potentials of atomic
A Hybrid Tsunami Risk Model for Japan
Haseemkunju, A. V.; Smith, D. F.; Khater, M.; Khemici, O.; Betov, B.; Scott, J.
2014-12-01
Around the margins of the Pacific Ocean, denser oceanic plates slipping under continental plates cause subduction earthquakes generating large tsunami waves. The subducting Pacific and Philippine Sea plates create damaging interplate earthquakes followed by huge tsunami waves. It was a rupture of the Japan Trench subduction zone (JTSZ) and the resultant M9.0 Tohoku-Oki earthquake that caused the unprecedented tsunami along the Pacific coast of Japan on March 11, 2011. EQECAT's Japan Earthquake model is a fully probabilistic model which includes a seismo-tectonic model describing the geometries, magnitudes, and frequencies of all potential earthquake events; a ground motion model; and a tsunami model. Within the much larger set of all modeled earthquake events, fault rupture parameters for about 24000 stochastic and 25 historical tsunamigenic earthquake events are defined to simulate tsunami footprints using the numerical tsunami model COMCOT. A hybrid approach using COMCOT simulated tsunami waves is used to generate inundation footprints, including the impact of tides and flood defenses. Modeled tsunami waves of major historical events are validated against observed data. Modeled tsunami flood depths on 30 m grids together with tsunami vulnerability and financial models are then used to estimate insured loss in Japan from the 2011 tsunami. The primary direct report of damage from the 2011 tsunami is in terms of the number of buildings damaged by municipality in the tsunami affected area. Modeled loss in Japan from the 2011 tsunami is proportional to the number of buildings damaged. A 1000-year return period map of tsunami waves shows high hazard along the west coast of southern Honshu, on the Pacific coast of Shikoku, and on the east coast of Kyushu, primarily associated with major earthquake events on the Nankai Trough subduction zone (NTSZ). The highest tsunami hazard of more than 20m is seen on the Sanriku coast in northern Honshu, associated with the JTSZ.
Commencement of Geoparks, Geology day and International Earth Science Olympiad, IYPE in Japan
Tsukuda, Eikichi; Kodama, Kisaburo; Miyazaki, Teruki
2010-05-01
The GSJ is the main supporting organization of IYPE Japan, which is an implementation body of IYPE in Japan, serving as its secretariat. During the IYPE triennial activity, the GSJ has been supporting development of Geparks, establishment of "the Geology Day" and the Earth Science Olympiad activities with some academic societies, and has distributed geological maps with IYPE logo. The GSJ also established an outreach network "Geo-networks Tsukuba" as a local legacy of the IYPE, and has managed it with a local government, research organizations, nonprofit corporations and local media to increase geological and environmental literacy of public, especially among young people. The GSJ-AIST has also contributed internationally to IYPE by joining two international projects, OneGeology and the CCOP Book project. Geoparks in Japan are characterized by following features. The Japanese Islands and the surrounding seas are situated in the area of unique geologic features; the place where several tectonic plates meet and collide. This causes earthquakes and volcanic activities, and makes Japan one of most dynamic areas on the earth. The dynamics of the earth bring about not only geological hazards but also a lot of blessings. In August of 2009, three Geoparks, the Toya Caldera and Usu Volcano Geopark, the Itoigawa Geopark and the Unzen Volcanic Area Geopark, were accepted to join the Global Geopark Network from Japan for the first time. Since its launch in 2006, the GSJ has been playing a major role in promoting Geoparks in Japan together with Geological Society of Japan. The GSJ hosts the Japan Geopark Committee (JGC) for quality evaluation, serving as the information center of Geoparks in Japan. The Geology Day of Japan (10th of May) has been set up by the academic societies for geology in Japan and GSJ in 2007. The Geology Day is expected to provide the chances for the public to enjoy field trips and excursions and to understand the importance of geo-diversity. The Day
Climate Change Policy Measures in Japan: NEDO's Activities to Promote CDM/JI
International Nuclear Information System (INIS)
Fukasawa, Kazunori; Seki, Kazuhiko; Sakurai, Takeshi
2004-01-01
The Kyoto Protocol, which obliges developed countries to reduce emissions of greenhouse gases (GHG), was adopted at the third session of the conference of the parties to the United Nations Framework Convention on Climate Change (UNFCCC) in Kyoto, Japan, on I I December 1997. Japan subsequently ratified the Kyoto Protocol in 2002 and is required thereunder to reduce GHG emissions by 6% below 1990 levels by 2008-2012. Japan, having already tackled development and promotion of energy conservation technologies after the second oil crisis, emits the lowest level of CO 2 of developed countries approximately 9.4 tons per capita in the year 2000. Consequently, Japan is able to contribute to CO 2 emissions reduction in developing economies as well as in economies in transition by application of Japan's energy conservation technologies. Because the Clean Development Mechanism (CDM) and Joint implementation (JI) of the Kyoto Mechanisms are efficient tools, the Japanese government's policy towards emission reduction makes active use of CDM/JI, thereby supporting domestic efforts in realizing Japan's reduction commitment. The Ministry of Economy, Trade and Industry (METI) of Japan is one of the key ministries to administer Governmental policy making on climate change, and is undertaking establishment of a system to facilitate the Kyoto Mechanisms. The New Energy and Industrial Technology Development Organization (NEDO), under the jurisdiction of METI, supports CDM and JI project activities implemented by Japanese private sector enterprises. In this report, the authors briefly introduce climate change policy measures in Japan and NEDO's activities to promote CDM/Jl. (Author)
Medical technology in Japan the politics of regulation
Altenstetter, Christa
2014-01-01
Compared to its American and European counterparts, Japan lags in adopting innovative medical devices and making new treatments and procedures available. Christa Altenstetter examines the contextual conditions of Japan's medical profession and its regulatory framework. Altenstetter looks into how physicians and device companies connect to the government and bureaucracy, the relationships connecting Japanese patients to their medical system and governmental bureaucracy, and how relationships between policymakers and the medical profession are changing.
van Gulik, Thomas M.; Nimura, Yuji
2005-01-01
An isolation policy was adopted in feudal Japan from 1639 to 1853 owing to the fear of foreign influence. During those 200 years of isolation, all foreigners were withheld from the country with the exception of the Dutch, who were permitted to establish a trading post on a small island in the Bay of
Hart, T M
1967-10-01
The enactment of the Eugenic Protection Act in Japan was followed by many changes. The population explosion was stemmed, the birth rate was halved, and while the marriage rate remained steady the divorce rate declined. The annual total of abortions increased until 1955 and then slowly declined. The highest incidence of abortions in families is in the 30 to 34 age group when there are four children in the family. As elsewhere abortion in advanced stages of pregnancy is associated with high morbidity and mortality. There is little consensus as to the number of criminal abortions. Reasons for criminal abortions can be found in the legal restrictions concerning abortion: Licensing of the abortionist, certification of hospitals, taxation of operations and the requirement that abortion be reported. Other factors are price competition and the patient's desire for secrecy. Contraception is relatively ineffective as a birth control method in Japan. Oral contraceptives are not yet government approved. In 1958 alone 1.1 per cent of married women were sterilized and the incidence of sterilization was increasing.
International Nuclear Information System (INIS)
Ito, Hitoshi
1995-01-01
The basic research on food irradiation in Japan was begun around 1955 by universities and national laboratories. In 1967, food irradiation was designated to the specific general research on atomic energy, and the national project on large scale was continued until 1983. As the result, the treatment of germination prevention for potatoes was approved by the Ministry of Health and Welfare in 1972. The Co-60 gamma ray irradiation facility of Shihoro Agricultural Cooperative is famous as the facility that succeeded in the practical use of food irradiation for the first time in the world. But the practical use of food irradiation stagnates and the research activities were reduced in Japan due to the circumstances thereafter. The effect of radiation to foods and living things is explained. The features of the radiation treatment of foods are small temperature rise, large transmissivity, no residue, the small loss of nutrition and large quantity, continuous treatment. The safety of irradiated foods is explained. The subjects for hereafter are discussed. (K.I.)
22 CFR 126.14 - Special comprehensive export authorizations for NATO, Australia, and Japan.
2010-04-01
... NATO, Australia, and Japan. 126.14 Section 126.14 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL... authorizations for NATO, Australia, and Japan. (a) Comprehensive authorizations. With respect to NATO members, Australia, Japan, and Sweden, the Directorate of Defense Trade Controls may provide the comprehensive...
FBR/VHTR deployment scenarios in Japan
International Nuclear Information System (INIS)
Richards, Matt; Kunitomi, Kazuhiko
2008-01-01
Co-deployment of Fast Breeder Reactors (FBRs) and Very High Temperature Reactors (VHTRs) can be used as the nuclear technologies to meet a significant portion of Japan's future energy demands. The FBR provides the fissile fuel for energy security and sustainability, and can be used to provide a significant portion of the electricity demand. The VHTR can provide flexible energy outputs (electricity, hydrogen, and high-temperature heat) with high efficiency, can operate with a wide variety of fuel cycles, and can be sited at locations that have limited availability of cooling water. These features, combined with its passive safety and high degree of proliferation resistance, make the VHTR an ideal complement for co-deployment with the FBR in Japan and also a very low-risk technology of export to foreign countries. In addition to hydrogen production, the high-temperature thermal energy produced by the VHTR fleet can be used for a wide variety of process-heat applications, and the VHTR can play a key role for significantly reducing greenhouse-gas emissions. This paper describes assessments for deploying FBRs and VHTRs in Japan using a closed fuel cycle, with the FBRs supplying the fissile material to sustain the combined FBR/VHTR fleet. (author)
Radioactivity survey data in Japan
International Nuclear Information System (INIS)
1981-09-01
Strontium-90 and cesium-137 in Japan were determined in rain and dry fallout, airborne dust, service water, freshwater, soils, total diet, milk, vegetables, tea, sea fish, freshwater fish, shellfish, and seaweeds. The results were shown in tables. (J.P.N.)
Seismic resistance design of nuclear power plant building structures in Japan
International Nuclear Information System (INIS)
Kitano, Takehito
1997-01-01
Japan is one of the countries where earthquakes occur most frequently in the world and has incurred a lot of disasters in the past. Therefore, the seismic resistance design of a nuclear power plant plays a very important role in Japan. This report describes the general method of seismic resistance design of a nuclear power plant giving examples of PWR and BWR type reactor buildings in Japan. Nuclear facilities are classified into three seismic classes and is designed according to the corresponding seismic class in Japan. Concerning reactor buildings, the short-term allowable stress design is applied for the S1 seismic load and it is confirmed that the structures have a safety margin against the S2 seismic load. (J.P.N.)
Seismic resistance design of nuclear power plant building structures in Japan
Energy Technology Data Exchange (ETDEWEB)
Kitano, Takehito [Kansai Electric Power Co., Inc., Osaka (Japan)
1997-03-01
Japan is one of the countries where earthquakes occur most frequently in the world and has incurred a lot of disasters in the past. Therefore, the seismic resistance design of a nuclear power plant plays a very important role in Japan. This report describes the general method of seismic resistance design of a nuclear power plant giving examples of PWR and BWR type reactor buildings in Japan. Nuclear facilities are classified into three seismic classes and is designed according to the corresponding seismic class in Japan. Concerning reactor buildings, the short-term allowable stress design is applied for the S1 seismic load and it is confirmed that the structures have a safety margin against the S2 seismic load. (J.P.N.)
International Nuclear Information System (INIS)
Inagaki, Masayo; Koga, Taeko; Morishima, Hiroshige; Kimura, Shojiro; Ohta, Masatoshi
2012-01-01
The concentrations of 222 Rn existing in air have been studied by using a convenient and highly sensitive Pico-rad detector system at Masutomi spa in Yamanashi Prefecture, Japan. The measurements in air were carried out indoors and outdoors during the winter of 2000 and the summers of 1999 and 2005. The concentrations of 222 Rn in spring water in this region were measured by the liquid scintillation method. The concentrations of natural radionuclides contained in soils surrounding spa areas were also examined by means of the γ-ray energy spectrometry technique using a Ge diode detector to investigate the correlation between the radionuclides contents and 222 Rn concentrations in air at each point of interest. The atmospheric 222 Rn concentrations in these areas were high, ranging from 5 Bq/m 3 to 2676 Bq/m 3 . The radon concentration at each hotel was high in the order of the bath room, the dressing room, the lobby, and the outdoor area near the hotel, with averages and standard deviations of the concentration of 441 ± 79 Bq/m 3 , 351 ± 283 Bq/m 3 , 121 ± 5 Bq/m 3 , and 23 ± 1 Bq/m 3 , respectively. The source of 222 Rn in the air in the bath room is more likely to be the spring water than the soil. The spring water plays carries the radon to the atmosphere. Our measurements indicated that the 222 Rn concentration in the air was affected by the 222 Rn concentration in spring water rather than that in soil. (author)
Energy Technology Data Exchange (ETDEWEB)
Zorn, T. [Hokkaido Univ., Graduate School of Agriculture, Div. of Forestry, Institute of Forest Policy, Sapporo (Japan)
1996-06-01
Japan`s balance in environmental-oriented water resources management is contradictory. Some improvements have been achieved, for instance in the treatment of industrial discharges and, in particular, in reducing emissions of toxic heavy metals. Conversely, with other forms of pollution, such as the organic load, no progress has been made so far; in some instances the situation has even deteriorated. However, measures for an advanced protection of waters are planned. New construction, extension, and modernization of wastewater treatment plants are a priority objective in environmental policy. A positive impact on water quality can be expected when the implementation of an emission-charges system for industries and the development of sewerage systems for households, based on the polluter-pays-principle, will be completed. (orig.) [Deutsch] Japans umweltorientierte, wasserwirtschaftliche Bilanz ist zwiespaeltig. Es wurden partiell einige Verbesserungen erzielt, wie z.B. bei der Reinigung industrieller Abwaesser und besonders der Minderung von Eintraegen toxischer Schwermetalle. Bei anderen Belastungsformen, so etwa bei den organischen, liegen dagegen kaum Fortschritte, teilweise sogar Verschlechterungen vor. Ein weitergehender Gewaesserschutz ist jedoch geplant. Neu- und Ausbau sowie Verbesserung von Klaeranlagen sind erklaertes Hauptziel der Umweltpolitik. Mit einer Verbesserung der Gewaesserqualitaet ist zu rechnen, wenn die Installation des Emissionsabgabensystems fuer Industriebetriebe und der Ausbau der Entsorgungseinrichtungen fuer Haushalte, die sich nach dem Verursacherprinzip orientieren, erfolgreich abgeschlossen sind. (orig.)
Current status and perspectives of cysticercosis and taeniasis in Japan.
Yamasaki, Hiroshi
2013-02-01
This mini-review describes recent epidemiological trends in cysticercosis and taeniasis in Japan. Some of the topics discussed herein were presented at the first symposium on "Current perspectives of Taenia asiatica researches", that was held in Osong in Chungbuk Province, South Korea, in October 2011 and organized by Prof. K. S. Eom, Chungbuk National University School of Medicine. To better understand the trends in the occurrence of cysticercosis and taeniasis in Japan, clinical cases reported in 2005 have been updated. In addition, the current status of Taenia asiatica infections successively occurring in Japan since 2010 is also discussed.
Okinawa Fri, 25 May 2018 02:07:00 GMT Scuba Savior: 3d MLG Marine saves life in Okinawa Fri, 25 May 2018 by @USForcesJapan Facebook Facebook Followers, We hope you've brushed up on your USFJ knowledge over the weekend, b... Followers, We hope you've brushed up on your USFJ knowledge over the weekend
The 1991 Japan Solar Energy Society. Japan Wind Energy Association Joint Conference
1991-09-01
Thie paper summarizes the lectures presented at the research presentation conference held by the Japan Solar Energy Society and the Japan Wind Energy Association. The contents include a lecture relating to photovoltaic cells intended for efficiency improvement; a lecture relating to a light power generation system including the field test reports, improvements on peripheral devices and output characteristics; a lecture relating to optical chemistry; a lecture relating to heat pumps utilizing solar heat and well water; a lecture relating air conditioning utilizing photovoltaic cells; a lecture relating to heat systems utilizing solar heat directly; a lecture relating to heat collection; a lecture relating to cold heat for cooling using earth tubes; a lecture relating to direct utilization of ground water heat and solar heat; a lecture relating to underground heat storage; a lecture relating to accumulation of cold heat and hot heat; a lecture relating to insolation on the amount of insolation and spectroscopy; a lecture relating to light collection intended of energy saving; a lecture relating to improving materials including light collecting plates and thin films; a lecture relating to development and characteristics of solar cars; and a lecture relating to wind energy.
PRECURSORY SLOPE DEFORMATION AROUND LANDSLIDE AREA DETECTED BY INSAR THROUGHOUT JAPAN
Directory of Open Access Journals (Sweden)
T. Nakano
2016-06-01
Full Text Available Interferometric Synthetic Aperture Radar (InSAR technique is able to detect a slope deformation around landslide (e.g., Singhroy et al., 2004; Une et al., 2008; Riedel and Walther, 2008; Sato et al., 2014. Geospatial Information Authority (GSI of Japan has been performing the InSAR analysis regularly by using ALOS/PALSAR data and ALOS-2/PALSAR-2 data throughout Japan. There are a lot of small phase change sites except for crustal deformation with earthquake or volcano activity in the InSAR imagery. Most of the phase change sites are located in landslide area. We conducted field survey at the 10 sites of those phase change sites. As a result, we identified deformation of artificial structures or linear depressions caused by mass movement at the 9 sites. This result indicates that InSAR technique can detect on the continual deformation of landslide block for several years. GSI of Japan will continue to perform the InSAR analysis throughout Japan. Therefore, we will be able to observe and monitor precursory slope deformation around landslide areas throughout Japan.
Investigation of uranium resources out of Japan. Summary on investigation techniques
International Nuclear Information System (INIS)
2001-03-01
Investigation of uranium resources in Japan was begun on 1954 by inland survey of the Geological Survey Bureau in the Agency of Industrial Science and Technology, Ministry of Industrial Trade and Industry, and then it was inherited to the Atomic Fuel Corporation and the Power Reactor and Nuclear Fuel Development Corporation (PNC). Since 1960s, under expectation of rapid growth of nuclear power generation and increase of uranium demand, as it was elucidated to be impossible to fill to its inland demand in quality and quantity, investigation of uranium resources out of Japan by private companies and its basic survey out of Japan by government were promoted. However, in accompanying with revise of PNC to be Japan Nuclear Cycle Development Institute, withdraw of the ore mining business was determined. According to the determination, as a result of investigation on inheritance of right of mining out of Japan to inland companies, rights in Canada were finished to inherit on November, 2000. Here were described on outlines on investigation, investigative method, and investigative business on uranium resources. (G.K.)
Occurrence of human respiratory syncytial virus in summer in Japan.
Shobugawa, Y; Takeuchi, T; Hibino, A; Hassan, M R; Yagami, R; Kondo, H; Odagiri, T; Saito, R
2017-01-01
In temperate zones, human respiratory syncytial virus (HRSV) outbreaks typically occur in cold weather, i.e. in late autumn and winter. However, recent outbreaks in Japan have tended to start during summer and autumn. This study examined associations of meteorological conditions with the numbers of HRSV cases reported in summer in Japan. Using data from the HRSV national surveillance system and national meteorological data for summer during the period 2007-2014, we utilized negative binomial logistic regression analysis to identify associations between meteorological conditions and reported cases of HRSV. HRSV cases increased when summer temperatures rose and when relative humidity increased. Consideration of the interaction term temperature × relative humidity enabled us to show synergistic effects of high temperature with HRSV occurrence. In particular, HRSV cases synergistically increased when relative humidity increased while the temperature was ⩾28·2 °C. Seasonal-trend decomposition analysis using the HRSV national surveillance data divided by 11 climate divisions showed that summer HRSV cases occurred in South Japan (Okinawa Island), Kyushu, and Nankai climate divisions, which are located in southwest Japan. Higher temperature and higher relative humidity were necessary conditions for HRSV occurrence in summer in Japan. Paediatricians in temperate zones should be mindful of possible HRSV cases in summer, when suitable conditions are present.
Return of vitrified residues from France to Japan
International Nuclear Information System (INIS)
1995-08-01
For more than 15 years now, COGEMA facilities in La Hague have received, stored and reprocessed spent fuel from France, Japan and other countries: Germany, Switzerland, Belgium and the Netherlands. According to contracts, COGEMA ensures the reprocessing service, consisting in separating the recyclable products (uranium and plutonium) from the wastes which are then duly conditioned and returned to their owners for final disposal. The transportation aspects of returning the reprocessed residues to Japan is presented. (K.A.)
Education Programme About Radiation at School in Japan
International Nuclear Information System (INIS)
Ukai, M.
2015-01-01
After Fukushima–Daiichi Nuclear Power Plant accident Japanese have thought “Basic radiation knowledge for school education” is very important. Ministry of Education, Culture, Sports, Science and Technology of Japan published supplemental learning textbooks on radiation for school students and teachers written in Japanese in October 2011 just after the accident. These textbooks show the clear explanation of radiation and cover the various topics especially on the accident. Japan Atomic Energy Agency has also published new textbook for secondary school students and teachers written in English in January 2015. English version textbooks are very useful for Japanese students who want be a teacher and also for students from foreign countries in our University. Using these textbooks new class have stated at our University. In this presentation the education programmes at school in Japan and the effects of these textbooks as a practical tool will be discussed. (author)
Japan in Maritime Asia: Security, Commerce, and Sovereignty
Directory of Open Access Journals (Sweden)
Philip Thai
2015-12-01
Full Text Available Catherine L. Phipps, Empires on the Waterfront: Japan’s Ports and Power, 1858–1899. Cambridge, MA: Harvard University Asia Center, 2015. 308 pp. $39.95 (cloth. Noell Wilson, Defensive Positions: The Politics of Maritime Security in Tokugawa Japan. Cambridge, MA: Harvard University Asia Center, 2015. 258 pp. $39.95 (cloth. Historiography on Japan’s place within the world of maritime Asia has undergone dramatic reinterpretation in recent decades. Scholars of the early modern era have thoroughly demolished the shibboleth of sakoku (“closed country”, the supposed isolation of Tokugawa Japan before the sudden arrival of Western gunboats in the 1850s. The active pursuit of diplomatic and commercial ties by shogun and daimyo alike embedded Japan firmly within global circuits of exchange (e.g., Hellyer 2010; Toby 1984. Scholars of the modern era, for their part, have been inspired by the “imperial turn” to put overseas empires at the heart of national narratives. Bookending the Tokugawa and Meiji periods, the two studies under review here push the frontiers of this research agenda further. Noell Wilson’s political history focuses on the buildup of domainal defense on the coast and the devolution of shogunal monopoly on violence. At the heart of this dialectical relationship was the “Nagasaki system”—the security arrangements that originated in the eponymous port and were eventually implemented throughout Japan. Catherine Phipps’s economic history examines the commercial expansion of Meiji Japan by tracing maritime networks of exchange, transportation, and information at multiple spatial scales. Forged in the crucible of Western imperialism, such ties simultaneously compromised the sovereignty of the nation while laying the foundations for empire. Both works offer compelling cases for the centrality of maritime relations in understanding core issues in Japanese history...
Recent Progress of Seismic Observation Networks in Japan
Okada, Y.
2013-04-01
Before the occurrence of disastrous Kobe earthquake in 1995, the number of high sensitivity seismograph stations operated in Japan was nearly 550 and was concentrated in the Kanto and Tokai districts, central Japan. In the wake of the Kobe earthquake, Japanese government has newly established the Headquarters for Earthquake Research Promotion and started the reconstruction of seismic networks to evenly cover the whole Japan. The basic network is composed of three seismographs, i.e. high sensitivity seismograph (Hi-net), broadband seismograph (F-net), and strong motion seismograph (K-NET). A large majority of Hi-net stations are also equipped with a pair of strong motion sensors at the bottom of borehole and the ground surface (KiK-net). A plenty of high quality data obtained from these networks are circulated at once and is producing several new seismological findings as well as providing the basis for the Earthquake Early Warning system. In March 11, 2011, "Off the Pacific coast of Tohoku Earthquake" was generated with magnitude 9.0, which records the largest in the history of seismic observation in Japan. The greatest disaster on record was brought by huge tsunami with nearly 20 thousand killed or missing people. We are again noticed that seismic observation system is quite poor in the oceanic region compared to the richness of it in the inland region. In 2012, NIED has started the construction of ocean bottom seismic and tsunami observation network along the Japan Trench. It is planned to layout 154 stations with an average spacing of 30km, each of which is equipped with an accelerometer for seismic observation and a water pressure gauge for tsunami observation. We are expecting that more rapid and accurate warning of earthquake and tsunami becomes possible by this observing network.
Recent Progress of Seismic Observation Networks in Japan
International Nuclear Information System (INIS)
Okada, Y
2013-01-01
Before the occurrence of disastrous Kobe earthquake in 1995, the number of high sensitivity seismograph stations operated in Japan was nearly 550 and was concentrated in the Kanto and Tokai districts, central Japan. In the wake of the Kobe earthquake, Japanese government has newly established the Headquarters for Earthquake Research Promotion and started the reconstruction of seismic networks to evenly cover the whole Japan. The basic network is composed of three seismographs, i.e. high sensitivity seismograph (Hi-net), broadband seismograph (F-net), and strong motion seismograph (K-NET). A large majority of Hi-net stations are also equipped with a pair of strong motion sensors at the bottom of borehole and the ground surface (KiK-net). A plenty of high quality data obtained from these networks are circulated at once and is producing several new seismological findings as well as providing the basis for the Earthquake Early Warning system. In March 11, 2011, 'Off the Pacific coast of Tohoku Earthquake' was generated with magnitude 9.0, which records the largest in the history of seismic observation in Japan. The greatest disaster on record was brought by huge tsunami with nearly 20 thousand killed or missing people. We are again noticed that seismic observation system is quite poor in the oceanic region compared to the richness of it in the inland region. In 2012, NIED has started the construction of ocean bottom seismic and tsunami observation network along the Japan Trench. It is planned to layout 154 stations with an average spacing of 30km, each of which is equipped with an accelerometer for seismic observation and a water pressure gauge for tsunami observation. We are expecting that more rapid and accurate warning of earthquake and tsunami becomes possible by this observing network.
76 FR 11509 - Brass Sheet and Strip From France, Germany, Italy, and Japan
2011-03-02
...)] Brass Sheet and Strip From France, Germany, Italy, and Japan AGENCY: United States International Trade... and strip from France, Germany, Italy, and Japan. SUMMARY: The Commission hereby gives notice that it... France, Germany, Italy, and Japan would be likely to lead to continuation or recurrence of material...
Status of LMFBR development project in Japan
International Nuclear Information System (INIS)
Nagane, G.; Akebi, M.; Matsuno, Y.
1987-01-01
Initiation of the LMFBR development project in Japan was decided by the Atomic Energy Commission of Japan in 1966. In 1967, the Power Reactor and Nuclear Fuel Development Corporation (PNC) was established to realize the project as a part of its tasks of a wide scope covering all the reseatch and development activities concerning fuel cycle. In the present paper the status of experimental fast reactor (Joyo), which is the first milestone of the LMFBR project, prototype fast reactor (Monju) and R and D activities supporting the project including that for larger LMFBRs in the future is described. (author)
The Arctic policy of China and Japan
DEFF Research Database (Denmark)
Tonami, Aki
2014-01-01
At the May 2013 Arctic Council Ministerial Meeting, five Asian states, namely China, Japan, India, Singapore and South Korea, were accepted to become new Permanent Observers at the Arctic Council. Nonetheless, little attention has been paid to the Asian states and their interest in the Arctic. Most...... discussions have focused on China and the assessment of China’s interest in the Arctic is divided. This paper attempts to fill this gap by presenting and comparing the various components of the Arctic policies of China and Japan. Referring to Putnam’s model of the “two-level game” and Young’s categorization...
Human rights in Japan: progress and challenges
Directory of Open Access Journals (Sweden)
Yolanda Muñoz González
2007-11-01
Full Text Available The aim of this paper is to present an overview of the improvements and challenges that Japan has been facing between 1983 and 2007. The paper explores the interaction among the different stakeholders –i.e. the Japanese Government, international organizations and civil society- to advance full access to citizenship regarding gender equality, the elimination of social and physical barriers for the inclusion of people with disabilities and elderly persons; ethnic minorities –specifically the situation of the Ainu people and the Buraku community – and the persons considered as “foreigners” living in Japan.
Analysis Of Japans Economy Based On 2014 From Macroeconomics Prospects
Directory of Open Access Journals (Sweden)
Dr Mohammad Rafiqul Islam
2015-02-01
Full Text Available Abstract Japan is the worlds third largest economy. But currently economic situations of Japan are not stable. It is not increasing as expected. Since 2013 it was world second largest economy but Japan loosed its placed to China in 2014 due to slow growth of important economic indicators. By using the basic Keynesian model we will provide a detailed analysis of the short and long run impacts of the changes for Japans real GDP rate of unemployment and inflation rate. We demonstrated a detailed use of the 45-degree diagram or the AD-IA model and other economic analysis of the macroeconomic principles that underlie the model and concepts. Finally we will recommend the government with a change in fiscal policy what based on the analysis by considering what might be achieved with a fiscal policy response and the extent to which any impact on the stock of public debt might be a consideration
The Development of Astronomy and Emergence of Astrophysics in Japan
Nakamura, Tsuko
This chapter overviews the emergence and development phases of modern astronomy and astrophysics in Japan, mainly before WWII. In the beginning of the nineteenth century under the samurai regime of the Tokugawa Shogunate, shogunal astronomers started to learn Western astronomy through a Dutch translation of the book Astronomie by J.J. Lalande. After the Meiji Restoration (1868) the new government founded the University of Tokyo (1877), the first modern university in Japan, in which Tokyo Astronomical Observatory (TAO) also started in 1888. Terao Hisashi, who had gone to Paris to study the modern astronomy, became the first Director of TAO in 1888. The astronomy introduced by Terao into Japan was so-called classical astronomy. Two of Terao's early students made Japan's first internationally recognized achievements in astronomy, the discovery of the Z-term in the polar motion of the Earth by Kimura (Astronomische Nachrichten, 158, 234-240, 1902) and the discovery of asteroid families by Hirayama (Astronomical Journal, 31, 185-188, 1918).
Health Survey of U.S. Navy Divers from 1960 to 1990: A First Look
2011-09-01
leisure . On average, nearly 6 hours per day (351 min) was spent sitting. Among Diver Groups . Compared to the other groups, EXP divers...subcontinent including, for example, Cambodia, China, India, Japan, Korea, Malaysia , Pakistan, the Philippine Islands, Thailand, and Vietnam) Section...other walking that you might do solely for recreation, sport, exercise, or leisure . 5.5) During the last 7 days, on how many days did you walk for