WorldWideScience

Sample records for saaremets aka ajukaja

  1. Achieving Better Privacy for the 3GPP AKA Protocol

    Directory of Open Access Journals (Sweden)

    Fouque Pierre-Alain

    2016-10-01

    Full Text Available Proposed by the 3rd Generation Partnership Project (3GPP as a standard for 3G and 4G mobile-network communications, the AKA protocol is meant to provide a mutually-authenticated key-exchange between clients and associated network servers. As a result AKA must guarantee the indistinguishability from random of the session keys (key-indistinguishability, as well as client- and server-impersonation resistance. A paramount requirement is also that of client privacy, which 3GPP defines in terms of: user identity confidentiality, service untraceability, and location untraceability. Moreover, since servers are sometimes untrusted (in the case of roaming, the AKA protocol must also protect clients with respect to these third parties. Following the description of client-tracking attacks e.g. by using error messages or IMSI catchers, van den Broek et al. and respectively Arapinis et al. each proposed a new variant of AKA, addressing such problems. In this paper we use the approach of provable security to show that these variants still fail to guarantee the privacy of mobile clients. We propose an improvement of AKA, which retains most of its structure and respects practical necessities such as key-management, but which provably attains security with respect to servers and Man-in-the- Middle (MiM adversaries. Moreover, it is impossible to link client sessions in the absence of client-corruptions. Finally, we prove that any variant of AKA retaining its mutual authentication specificities cannot achieve client-unlinkability in the presence of corruptions. In this sense, our proposed variant is optimal.

  2. 76 FR 29812 - In the Matter of the Designation of Army of Islam, aka Jaish al-Islam, aka Jaysh al-Islam, as a...

    Science.gov (United States)

    2011-05-23

    ... DEPARTMENT OF STATE [Public Notice 7464] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam, as a Foreign Terrorist Organization Pursuant to Section 219 of the... respect to Army of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam. Therefore, I hereby...

  3. 76 FR 29812 - In the Matter of the Designation of Army of Islam, aka Jaish al-Islam, aka Jaysh al-Islam; as a...

    Science.gov (United States)

    2011-05-23

    ... DEPARTMENT OF STATE [Public Notice 7463] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam; as a Specially Designated Global Terrorist Pursuant to Section 1(b... of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam, has committed, or poses a...

  4. The UMTS-AKA Protocols for Intelligent Transportation Systems

    Directory of Open Access Journals (Sweden)

    Hwang Min-Shiang

    2009-01-01

    Full Text Available The integration of communication protocols into transport systems is a much adored research area today. Much of seminal work has been reported on the topic of intelligent transportation systems (ITS in the recent years. Many advanced techniques have been garnered to improve online communication and to promote the security, comfort, and efficiency of ITS. Of primary importance to the effective application of ITS is the communication protocol used. A fascinating development is that the yesterday's Global System for Mobile Communication protocol is being replaced by the Universal Mobile Telecommunication System protocol, which is the third-generation mobile technology. This article attempts to identify a suitable communication system for ITS applications. It is impracticable to substantially modify the original UMTS-IMS-AKA protocol which is in practice because it can disturb the operation of the current system, and thus we explore other possibilities through this research. We investigate a novel protocol to make the original UMTS-IMS-AKA protocol compliant with ITS as well as adaptable into the current UMTS protocol.

  5. Clinical diagnostic value of combined determination of serum RF, AKA and anti-CCP antibody levels in patients with rheumatoid arthritis

    International Nuclear Information System (INIS)

    Zhao Hongcan; Xiang Guoqian

    2005-01-01

    Objective; To investigate the clinical usefulness of combined determination of serum rheumatic factor (RF), anti-keratin antibody (AKA) and anti-cyclic citrullinated peptide antibody (anti-CCP antibody) levels for early diagnosis in patients with rheumatoid arthritis (RA). Methods: Serum RF ( with rate-nephelometry), AKA (with indirect immuno-fluorescence) and anti-CCP antibody (with ELISA) levels were determined in 40 patients with RA, 30 patients with SLE and 30 controls. Results: For diagnosis of RA; the sensitivity and specificity of RF was 70.0% and 90.0% respectively, the sensitivity and specificity of AKA was 35.0% and 96.7%, the sensitivity and specificity of anti-CCP-antibody was 85% and 93.3% respectively. With combined determination of RF, AKA and anti-CCP antibody, the sensitivity and specificity would be the highest, being 97.07 and 99.8% respectively. Conclusion: RF, AKA and anti-CCP antibody were useful diagnostic serum markers for rheumatoid arthritis and combined determination of these markers would be very useful for early diagnosis. (authors)

  6. Siim Nestor soovitab : Tulebki tagasi...ja veel / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2003-01-01

    Üritusest kohvik-klubis Moskva 1. juunil, esinejateks Louie Vega, Dave Storm ja Raul Saaremets. Üritusest Jazz'N Motion Eesti Näituste Sinises Paviljonis 29. mail, esinejateks The Gotan Projekt ja Kimmo Pohjonen. Üritusest Barclay Dance Blend klubis BonBon 31. mail, esinejateks DJ Marine, Rhytm Doktor ja Saaremets. Üritusest 3. juunil Von Krahlis, külaliseks Electronicat

  7. 75 FR 6397 - AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

    Science.gov (United States)

    2010-02-09

    ... Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine Logistics USA Inc. a/k/a GWL USA, Inc., and Global... Wine Logistics USA Inc. a/k/a GWL USA, Inc. (``GWL USA''); Anita McNeil; International First Service... FEDERAL MARITIME COMMISSION [Docket No. 10-01] AMC USA, Inc. v. International First Service S.A. a...

  8. Adding Four- Dimensional Data Assimilation (a.k.a. grid nudging) to MPAS

    Science.gov (United States)

    Adding four-dimensional data assimilation (a.k.a. grid nudging) to MPAS.The U.S. Environmental Protection Agency is investigating the use of MPAS as the meteorological driver for its next-generation air quality model. To function as such, MPAS needs to operate in a diagnostic mod...

  9. AKA-TPG: a program for kinetic and epidemiological analysis of data from labeled glucose investigations using the two-pool model and database technology

    DEFF Research Database (Denmark)

    Boston, Raymond C; Stefanovski, Darko; Henriksen, Jan E

    2007-01-01

    of technical reasons have deterred researchers from performing TPG analysis. METHODS AND RESULTS: In this paper, we describe AKA-TPG, a new program that combines automatic kinetic analysis of the TPG model data with database technologies. AKA-TPG enables researchers who have no expertise in modeling to quickly...... fit the TPG model to individual FSHGT data sets consisting of plasma concentrations of unlabeled glucose, labeled glucose, and insulin. Most importantly, because the entire process is automated, parameters are almost always identified, and parameter estimates are accurate and reproducible. AKA...

  10. High prevalence of cannabis use among Aka foragers of the Congo Basin and its possible relationship to helminthiasis.

    Science.gov (United States)

    Roulette, Casey J; Kazanji, Mirdad; Breurec, Sébastien; Hagen, Edward H

    2016-01-01

    Little is known about cannabis use in hunter-gatherers. Therefore, we investigated cannabis use in the Aka, a population of foragers of the Congo Basin. Because cannabis contains anthelminthic compounds, and the Aka have a high prevalence of helminthiasis, we also tested the hypothesis that cannabis use might be an unconscious form of self-medication against helminths. We collected self- and peer-reports of cannabis use from all adult Aka in the Lobaye district of the Central African Republic (n = 379). Because female cannabis use was low, we restricted sample collection to men. Using an immunoassay for Δ9-tetrahydrocannabinol-11-oic acid (THCA), a urinary biomarker of recent cannabis consumption, we validated cannabis use in men currently residing in camps near a logging road (n = 62). We also collected stool samples to assay worm burden. A longitudinal reinfection study was conducted among a subsample of the male participants (n = 23) who had been treated with a commercial anthelmintic 1 year ago. The prevalence of self- and peer-reported cannabis use was 70.9% among men and 6.1% among women, for a total prevalence of 38.6%. Using a 50 ng/ml threshold for THCA, 67.7% of men used cannabis. Cannabis users were significantly younger and had less material wealth than the non-cannabis users. There were significant negative associations between THCA levels and worm burden, and reinfection with helminths 1 year after treatment with a commercial anthelmintic. The prevalence of cannabis use among adult Aka men was high when compared to most global populations. THCA levels were negatively correlated with parasite infection and reinfection, supporting the self-medication hypothesis. © 2015 Wiley Periodicals, Inc.

  11. 78 FR 45011 - Designation of Bulut Yayla, AKA: Samet Ince as a Specially Designated Global Terrorist Pursuant...

    Science.gov (United States)

    2013-07-25

    ... DEPARTMENT OF STATE [Public Notice 8390] Designation of Bulut Yayla, AKA: Samet Ince as a... risk of committing, acts of terrorism that threaten the security of U.S. nationals or the national security, foreign policy, or economy of the United States. Consistent with the determination in Section 10...

  12. Examining short-term nutritional status among BaAka foragers in transitional economies.

    Science.gov (United States)

    Remis, Melissa J; Jost Robinson, Carolyn A

    2014-07-01

    Foragers in transitioning economies are at an increased risk of negative health outcomes as they undergo changes in subsistence patterns and diet. Here, we provide anthropometric data and examine the nutrition and health of adult BaAka foragers in relationship to declining wildlife and economic change in the Dzanga Sangha Protected Areas (APDS), Central African Republic. From June to August 2012, we collected biological data and dietary recall surveys from individuals in Mossapoula (MS) and Yandoumbé (YDBE) villages using standard anthropometric techniques and a single capillary blood finger prick. In our analysis, we identified variation in anthropometric measurements and hemoglobin levels by village (MS = 66, YDBE = 75) and gender (64 men, 77 women). Immigration, increased gun hunting and wildlife trades have reduced forager reliance on forest resources. These changes are evidenced in the marginal health of contemporary BaAka foragers of APDS. Although anthropometric measures of nutritional status do not significantly differ between communities, hemoglobin data highlight inequities in access to forest products between villages with different proximity to community hunting zones. Further, poor dietary diversity and low frequency of purchased foods in the diet indicate that the transition to a market economy has not been fully realized and diets are impoverished. Economic changes appear to have had the most impact at MS village, where forest use is most restricted and consumption of meat and forest products was reduced. This work highlights the nutritional and health needs of foragers in rapidly transitioning economies; especially those impacted by conservation management and zoning policies. © 2014 Wiley Periodicals, Inc.

  13. SEX AND SEARCHING FOR CHILDREN AMONG AKA FORAGERS AND NGANDU FARMERS OF CENTRAL AFRICA

    OpenAIRE

    HEWLETT, Barry S.; HEWLETT, Bonnie L.

    2010-01-01

    Few systematic studies exist on the sexual behavior of hunter-gatherers and rural central Africans. This study examines the reasons for having sex, the frequency of sex (coitus) per night, sexual practices during the post-partum sex taboo, and beliefs and practices regarding homosexuality, masturbation, the use of sexual stimulants and a variety of other sexual behaviors. Thirty-fi ve Aka and twenty-one Ngandu adults who were or had been married were interviewed. For adults 18–45 years of age...

  14. Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā.

    OpenAIRE

    Cibule, Rūta

    2016-01-01

    Bakalaura darba tēma ir “Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā”. Darbā ir apskatītas vadīšanas funkcijas – organizēšana, plānošana, motivēšana, koordinēšana un kontrole, fokusējoties uz pirmajām trim minētajām. Bakalaura darba mērķis ir izanalizēt vadīšanas funkciju izpildi Viļakas novada domes administrācijā, pievēršot pastiprinātu uzmanību organizēšanai, motivēšanai un plānošanai. Lai šo mērķi izpildītu, pirmajā daļā autore izpētīja dažādus teorijas avotus, otrajā da...

  15. Autonomy, Equality, and Teaching among Aka Foragers and Ngandu Farmers of the Congo Basin.

    Science.gov (United States)

    Boyette, Adam H; Hewlett, Barry S

    2017-09-01

    The significance of teaching to the evolution of human culture is under debate. We contribute to the discussion by using a quantitative, cross-cultural comparative approach to investigate the role of teaching in the lives of children in two small-scale societies: Aka foragers and Ngandu farmers of the Central African Republic. Focal follows with behavior coding were used to record social learning experiences of children aged 4 to 16 during daily life. "Teaching" was coded based on a functional definition from evolutionary biology. Frequencies, contexts, and subtypes of teaching as well as the identity of teachers were analyzed. Teaching was rare compared to observational learning, although both forms of social learning were negatively correlated with age. Children received teaching from a variety of individuals, and they also engaged in teaching. Several teaching types were observed, including instruction, negative feedback, and commands. Statistical differences in the distribution of teaching types and the identity of teachers corresponded with contrasting forager vs. farmer foundational cultural schema. For example, Aka children received less instruction, which empirically limits autonomous learning, and were as likely to receive instruction and negative feedback from other children as they were from adults. Commands, however, exhibited a different pattern suggesting a more complex role for this teaching type. Although consistent with claims that teaching is relatively rare in small-scale societies, this evidence supports the conclusion that teaching is a universal, early emerging cognitive ability in humans. However, culture (e.g., values for autonomy and egalitarianism) structures the nature of teaching.

  16. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2002-01-01

    Heliplaatidest Starsailor" Love is Here". Chicago Underground Quartet "Chicago Underground Quartet". Mower "Mower". Kim Wilde "The Very Best of". Mull Historical Society "Loss". Jill Scott "Experience: 826+"

  17. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2006-01-01

    Heliplaatidest: Giant Drag "Hearts and Unicorns", Speak Low "I'm Gonna Groove YA!!", Agent M "Šokolaad EP", A.F.I. "Decemberunderground", Angels & Airwaves "We Don't Need To Whisper", Andrew Liles "In My Father's House are Many Mansions"

  18. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2007-01-01

    Heliplaatidest: The Horrors "Strange House", Earlies "The Enemy Chorus", Finish Me Off "Seed", Kasabian "Empire", Norah Jones "Not Too Late", Kaiser Chiefs "Yours Truly Angry Mob", Skinny Puppy "Mythmaker", Patrick Wolf "The Magic Position"

  19. Arvustused / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2000-01-01

    Dj Assault "Belle Isle Tech", Dj Krush "Code 4109", Dream City Film Club "Stranger Blues", Eels "Daisies of the Galaxy", Evergrey "Solitude, Dominance, Tragedy", Ghostface Killah "Supreme" albumite tutvustused

  20. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2002-01-01

    Heliplaatidest Koop. "Waltz For Koop.". Lovage "Music To Make Love To Your Old Lady By". Cabaret Voltaire "The Original Sound Of Sheffield '83-'87 - The Best Of The Virgin/EMI Years". Erinevad esitajad "Lord Of The Rings: The Fellowship Of The Ring". Bugge Wesseltoft "Moving". Flanger "Inner Space/Outer Space". Femi Kuti "Fight To Win".

  1. Muusikalised jutustused

    Index Scriptorium Estoniae

    2008-01-01

    Üritustest kontsertsarja Soul Spectrum raames Kumus: 14. märstsil Ursula Rucker (soojendusesinejad Riho Sibul, Jaak Sooäär ja Raul Saaremets), 15. märtsil folk-jazzlaulja Terry Callier (soojendusesinejad Tõnis Mägi ja Chalice)

  2. 75 FR 28849 - Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign...

    Science.gov (United States)

    2010-05-24

    ... DEPARTMENT OF STATE [Public Notice 7026] Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Records assembled in these...

  3. Siim Nestor soovitab : Sports Cabaret. Ans. Flirt. DJ Krii / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    29. nov. Tartus Club-Tallinnas toimuvast üritusest Sports Cabaret. 4. dets. klubis BonBon projekt-ansambli Flirt (koosseisus Raul Saaremets, Andres Peets, Sten Sheripov, Leslie Laasner) kontserdist. 29. nov. Von Krahlis toimuvast hip-hop peost Check One, Two, kus esinejaks läti diskor Krii

  4. 77 FR 6782 - In the Matter of: Kok Tong Lim, a/k/a Thomas Lim Blk 258A Compassvale Road #07-551 Singapore...

    Science.gov (United States)

    2012-02-09

    ... Thomas Lim Blk 258A Compassvale Road 07-551 Singapore 541258; Order Denying Export Privileges On October...'') of Singapore, pled guilty to one count of violating the International Emergency Economic Powers Act..., a/k/a Thomas Lim, with the last known address at: Blk 258A,Compassvale Road 07-551, Singapore 541258...

  5. Siim Nestor soovitab : Teenage Kicks. Bängin / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    12. aprillil alustatakse Pif-Pafi klubis live-muusikale orienteeritud muusikaõhtute sarjaga Teenage Kicks. Esinevad ansamblid BAP ja Id Rev ( andis 2001. aasta suvel välja albumi "Sina Ei"). Bängin on väike technopidu 13. apr. Wimbledonis, kus valivad technot Erkki Tero, Orav, Ilmar Kerm ja Raul Saaremets

  6. CITRA PEREMPUAN DALAM LIRIK LAGU KIMCIL KEPOLEN KARYA NDX AKA FAMILIA DALAM PERSPEKTIF LINGUISTIK KOGNITIF

    Directory of Open Access Journals (Sweden)

    Ferdi Arifin

    2017-11-01

    Full Text Available Kimcil Kepolen song is a dangdut hiphop and being popular song nowadays. This song is created by NDX a.k.a Familia that inspires people for his long journey as a labor towards a great Indonesian musician that has been loved by widely society. This lyric represents women image from NDX perspective before his successful being a great musician. The study employs qualitative method to look at Kimcil Kepolen lyric as a language fact which is able to be examined by semantic and cognitive linguistics perspective. The results shows us that Kimcil Kepolen lyric represents materialistic women are being hard to get engage and to make a serious relationship for poor men. The facts explain that materialistic women are easily breaking men’s heart and cheating to a man who has a stabble financial support.

  7. Siim Nestor soovitab : Wicked Beat. President of Funk. Muuseumiööl. Springz Bashmendil / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    16. mail toimub Emajõe äärses klubis Atlantis Eesti esimene nu-skool breaks õhtu Wicked Beat, kus peaesinejaks on DJ ja produtsent Databass (plaadifirma Freakaboom "juhatuse esimees" Justin Owen). 18. mail house-muusika pidu Tartus muusikagaleriis Damtan Dance. 17. mai ööl Rotermanni soolalaos triod: 1. Riho Sibul, Jaak Sooäär ja Raul Saaremets ning 2. Tõnis Leemets, Robert Jürjendal ja Aivar Tõnso. 17. mail Von Krahlis Dj Dr. Koit

  8. Dramaturgia wiersza: „wiersz-płacz”. Płakała w nocy, ale nie jej płacz go zbudził

    Directory of Open Access Journals (Sweden)

    Anna Krajewska

    2016-12-01

    Full Text Available The article is an interpretation of the poem “Płakała w nocy, ale nie jej płacz go zbudził” (“She cried at night, but not her cries woke him” written by Stanisław Barańczak. The author focuses on description in this poem – dramatic in shape, philosophical, and according to the narrative of the anthropocentrism crisis. The author considers this poem to be a metaphysical text defining the relationship between the world of human and non-human reality. She compares the poem with those written by Jan Kochanowski (Laments, Cyprian Kamil Norwid (In Verona, Andrew Marvell (Eyes and tears, Szymborska (Apple tree.

  9. Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy Conversion Devices (a.k.a. Understanding Photosystem I as a Biomolecular Reactor for Energy Conversion)

    Science.gov (United States)

    2014-04-01

    Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy Conversion Devices (a.k.a. Understanding Photosystem I as...Laboratory Adelphi, MD 20783-1197 ARL-TR-6904 April 2014 Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy...Final 3. DATES COVERED (From - To) 10/1/2010–10/1/2013 4. TITLE AND SUBTITLE Hydrogen Production from Water by Photosynthesis System I for Use as Fuel

  10. Određivanje daljine cilja pomoću video senzora i analiza uticaja grešaka i šuma merenja / Target range evaluation using video sensor and analysis of the influence of measurement noise and errors

    Directory of Open Access Journals (Sweden)

    Dragoslav Ugarak

    2006-01-01

    Full Text Available U radu je opisan matematički model određivanja daljine cilja obradom video snimaka u toku praćenja. Analizirani su doprinosi parametara koji utiču na veličinu grešaka i određene su vrednosti standardnog odstupanja. / This paper presents mathematical model of determining target range by analyzing video frame during the tracking. The contribution of effective parameters to accuracy are analyzed and values of standard deviation are determined.

  11. 76 FR 20450 - Designation of Nine Individuals Pursuant to Executive Order 13566

    Science.gov (United States)

    2011-04-12

    ..., Safia); DOB 1952; POB Al Bayda, Libya (individual) [LIBYA2] 4. GADDAFI, Hannibal (a.k.a. AL-GADDAFI, Hannibal; a.k.a. AL-QADHAFI, Hannibal; a.k.a. ELKADDAFI, Hannibal; a.k.a. EL-QADDAFI, Hannibal; a.k.a. GADDAFI, Hannibal Muammar; a.k.a. GHADAFFI, Hannibal; a.k.a. GHATHAFI, Hannibal; a.k.a. QADDAFI, Hannibal...

  12. 76 FR 34805 - Designation of Three Entities and One Individual Pursuant to Executive Order 13553

    Science.gov (United States)

    2011-06-14

    ... OF THE GUARDIANS OF THE ISLAMIC REVOLUTION; a.k.a. THE IRANIAN REVOLUTIONARY GUARDS), Tehran, Iran... (individual) [IRAN-HR] Entities ISLAMIC REVOLUTIONARY GUARD CORPS (a.k.a. AGIR; a.k.a. IRANIAN REVOLUTIONARY GUARD CORPS; a.k.a. IRG; a.k.a. IRGC; a.k.a. ISLAMIC REVOLUTIONARY CORPS; a.k.a. PASDARAN; a.k.a...

  13. 76 FR 40772 - Additional Designation of Entities Pursuant to Executive Order 13382

    Science.gov (United States)

    2011-07-11

    ... designees is as follows: Entities: 1. IRAN AIR (a.k.a. AIRLINE OF THE ISLAMIC REPUBLIC OF IRAN (HOMA); a.k.a. HAVAPEYMA MELI IRAN HOMA; a.k.a. HOMA; a.k.a. IRAN AIR CARGO; a.k.a. IRAN AIR P J S C; a.k.a. IRANAIR; a.k.a. IRANAIR CARGO; a.k.a. NATIONAL IRANIAN AIRLINES (HOMA); f.k.a. SHERKAT SAHAMI AAM HAVOPAYMAIE JOMHOURI...

  14. 78 FR 52823 - Designation of 1 Individual and 1 Entity Pursuant to Executive Order 13224 of September 23, 2001...

    Science.gov (United States)

    2013-08-26

    ... (Pakistan); alt. National ID No. 42201-015024707-7 (individual) [SDGT]. Entity 1. JAMIA TALEEM-UL-QURAN-WAL...; a.k.a. MADRASA TALEEMUL QURAN WAL HADITH; a.k.a. MADRASA TALEEMUL QURAN WAL SUNNAH; a.k.a. MAWIYA MADRASSA; a.k.a. MOW-YA MADRASSA; a.k.a. TALALIM QURAN MADRASSA; a.k.a. TALEEM UL-QURAN MADRASSA; a.k.a...

  15. 76 FR 25783 - Identification of Thirty Entities as Governemnt of Libya Entities Pursuant to Executive Order 13566

    Science.gov (United States)

    2011-05-05

    ... SOCIAL DEVELOPMENT FUND COMPANY (a.k.a. ECONOMIC SOCIAL AND DEVELOPMENT FUND; a.k.a. SOCIAL AND ECONOMIC...://www.lap.ly [LIBYA2] 7. LIBYAN AFRICAN INVESTMENT COMPANY (a.k.a. LAAICO; a.k.a. LAICO; a.k.a. LIBYAN ARAB AFRICAN INVESTMENT COMPANY; a.k.a. THE LAICO GROUP), Janzoor (neighborhood), Tripoli, Libya; P.O...

  16. 78 FR 31630 - Designation of One (1) Entity Pursuant to Executive Order 13582 of August 17, 2011, “Blocking...

    Science.gov (United States)

    2013-05-24

    ... TELEVISION (a.k.a. ADDOUNIA TV; a.k.a. AL DOUNIA; a.k.a. AL-DONYA TELEVISION CHANNEL; a.k.a. DUNIA LIMITED LIABILITY COMPANY FOR INFORMATION; a.k.a. DUNIA TELEVISION), Information Free Zone, Damascus, Syria [SYRIA...

  17. 77 FR 27280 - Actions Taken Pursuant to Executive Order 13382

    Science.gov (United States)

    2012-05-09

    ..., Shahrake-E-Quds, Tehran, Iran [IRGC] [NPWMD]. 4. IRAN MARINE INDUSTRIAL COMPANY, SADRA (a.k.a. IRAN MARINE INDUSTRIAL COMPANY SSA; a.k.a. IRAN SADRA; a.k.a. IRAN SHIP BUILDING CO.; a.k.a. SADRA; a.k.a. SHERKATE...

  18. 77 FR 70548 - Designation of one (1) individual Pursuant to Executive Order 13224 of September 23, 2001...

    Science.gov (United States)

    2012-11-26

    ... follows: Individual 1. AL-MUSAWI, Ali Mussa Daqduq (a.k.a. 'ABD AL-YUNIS, Hamid Majid; a.k.a. AL-LAMI.... AL-MUSAWI, Hamid Muhammad Jabur; a.k.a. AL-MUSUI, Hamid Muhammad Jabur; a.k.a. DAQDUQ, Ali Mussa; a.k...

  19. Nicholas Chielotam Akas

    African Journals Online (AJOL)

    Ariwaodongo

    Maps. Mapping activities are often used as introductory activities. They allow the community to show and talk about how they see the area where they live, the resources/ ... Brain Storming. Here the member of the community is asked to think of any idea that comes to mind and list all the ideas without evaluation or judgment.

  20. Yeast Interacting Proteins Database: YGL061C, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...6C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...it description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p... Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT

  1. Yeast Interacting Proteins Database: YKR037C, YGL061C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by

  2. Yeast Interacting Proteins Database: YGR113W, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...DR016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced

  3. Yeast Interacting Proteins Database: YGR113W, YKR037C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...KR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...escription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produ

  4. Yeast Interacting Proteins Database: YKR037C, YDR016C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by

  5. Yeast Interacting Proteins Database: YGR113W, YGL061C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...GL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...scription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produc

  6. Yeast Interacting Proteins Database: YKR083C, YDR201W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...1W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force ...on Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by M

  7. Awareness, knowledge, and attitudes with respect to epilepsy: an investigation in relation to health-related quality of life within a Malaysian setting.

    Science.gov (United States)

    Lua, Pei Lin; Neni, Widiasmoro Selamat

    2011-07-01

    The influence of awareness, knowledge, and attitudes (AKA) on the health-related quality of life (HRQoL) of patients with epilepsy has not been widely established. The aims of this preliminary study were to (1) assess general AKA and HRQoL levels, (2) correlate AKA and HRQoL levels, and (3) compare the HRQoL of patients with epilepsy with different AKA levels. A cross-sectional sample of outpatients with epilepsy were recruited from the Neurology Clinic, Hospital Sultanah Nur Zahirah, Kuala Terengganu, Malaysia. Data analysis was carried out using the Statistical Package for Social Sciences Version 15 employing descriptive and nonparametric statistics. On written consent, included patients completed the Malay AKA Epilepsy and the Malay Quality of Life in Epilepsy-30 (MQOLIE-30) instruments. Across all patients, both AKA levels (median: 80.0, range: 0-170) and overall HRQoL (median 51.5; range 15-97) were moderate. Awareness was significantly correlated only with Seizure Worry (r(s)=+0.29, p<0.05), whereas Knowledge was not significantly linked to any domain. However, Attitudes was significantly correlated with all domains (r(s)=+0.35 to +0.47, p<0.01) except Medication Effects and Seizure Worry. Patients with good AKA levels (Total Score ≥ median) experienced significantly better Overall Quality of Life and Cognitive Functioning (p<0.05). Findings showed that AKA may play an important role in influencing patients' HRQoL, suggesting that epilepsy treatment efforts should also focus on enhancing AKA through epilepsy awareness to improve health outcomes. Copyright © 2011 Elsevier Inc. All rights reserved.

  8. Yeast Interacting Proteins Database: YKR083C, YKL052C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...2C ASK1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...e name DAD2 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ey description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p

  9. Terrorism/Criminalogy/Sociology via Magnetism-Hamiltonian ``Models''?!: Black Swans; What Secrets Lie Buried in Magnetism?; ``Magnetism Will Conquer the Universe?''(Charles Middleton, aka ``His Imperial Majesty The Emperior Ming `The Merciless!!!''

    Science.gov (United States)

    Carrott, Anthony; Siegel, Edward Carl-Ludwig; Hoover, John-Edgar; Ness, Elliott

    2013-03-01

    Terrorism/Criminalogy//Sociology : non-Linear applied-mathematician (``nose-to-the grindstone / ``gearheadism'') ''modelers'': Worden,, Short, ...criminologists/counter-terrorists/sociologists confront [SIAM Conf. on Nonlinearity, Seattle(12); Canadian Sociology Conf,. Burnaby(12)]. ``The `Sins' of the Fathers Visited Upon the Sons'': Zeno vs Ising vs Heisenberg vs Stoner vs Hubbard vs Siegel ''SODHM''(But NO Y!!!) vs ...??? Magntism and it turn are themselves confronted BY MAGNETISM,via relatively magnetism/metal-insulator conductivity / percolation-phase-transitions critical-phenomena -illiterate non-linear applied-mathematician (nose-to-the-grindstone/ ``gearheadism'')''modelers''. What Secrets Lie Buried in Magnetism?; ``Magnetism Will Conquer the Universe!!!''[Charles Middleton, aka ``His Imperial Majesty The Emperior Ming `The Merciless!!!']'' magnetism-Hamiltonian phase-transitions percolation-``models''!: Zeno(~2350 BCE) to Peter the Pilgrim(1150) to Gilbert(1600) to Faraday(1815-1820) to Tate (1870-1880) to Ewing(1882) hysteresis to Barkhausen(1885) to Curie(1895)-Weiss(1895) to Ising-Lenz(r-space/Localized-Scalar/ Discrete/1911) to Heisenberg(r-space/localized-vector/discrete/1927) to Priesich(1935) to Stoner (electron/k-space/ itinerant-vector/discrete/39) to Stoner-Wohlfarth (technical-magnetism hysteresis /r-space/ itinerant-vector/ discrete/48) to Hubbard-Longuet-Higgins (k-space versus r-space/

  10. 75 FR 47899 - Designation of Two Entities and Seven Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2010-08-09

    ..., or economy of the United States; (3) persons determined by the Director of OFAC, in consultation with... RECONSTRUCTION IN LEBANON; a.k.a. IRAN'S HEADQUARTERS FOR THE RECONSTRUCTION OF LEBANON), Near Iranian Embassy....k.a. KHOSHNEVIS, Hussam; a.k.a. KHOSHNVIS, Hassan; a.k.a. KHOUCHNOYESS, Hussam); nationality Iran...

  11. 78 FR 59097 - Designation of Two Individuals Pursuant to Executive Order 13224 of September 23, 2001, “Blocking...

    Science.gov (United States)

    2013-09-25

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... MADJID, Afif; a.k.a. BIN ABDUL MAJID, Afif); DOB 01 Jan 1955; POB Pacitan, East Java, Indonesia; nationality Indonesia (individual) [SDGT]. 2. SUNGKAR, Said Ahmad (a.k.a. SUNGKAR, Sahid Ahmad; a.k.a. SUNGKAR...

  12. 77 FR 10807 - Designation of One Entity Pursuant to Executive Order 13553

    Science.gov (United States)

    2012-02-23

    ... International Emergency Economic Powers Act (50 U.S.C. 1701-06) (``IEEPA'') and the Comprehensive Iran Sanctions... INTELLIGENCE AND SECURITY (a.k.a. VEZARAT-E ETTELA'AT VA AMNIAT-E KESHVAR; a.k.a. ``MOIS''; a.k.a. ``VEVAK..., Tehran, Iran; Ministry of Intelligence, Second Negarestan Street, Pasdaran Avenue, Tehran, Iran [SDGT...

  13. 78 FR 41995 - Actions Taken Pursuant to Executive Order 13382

    Science.gov (United States)

    2013-07-12

    ...-hour fax-on-demand service, Tel.: 202/622-0077. Background On June 28, 2005, the President, invoking... Executive Order 13382. The list of additional designees is as follows: 1. DAEDONG CREDIT BANK (a.k.a. DAE-DONG CREDIT BANK; a.k.a. DCB; a.k.a. TAEDONG CREDIT BANK), Suite 401, Potonggang Hotel, Ansan-Dong...

  14. 78 FR 2721 - Designation of Entities Pursuant to Executive Order 13413

    Science.gov (United States)

    2013-01-14

    ... Economic Powers Act (50 U.S.C. 1701 et seq.) (IEEPA) and section 5 of the United Nations Participation Act... listing of the blocked entities appears as follows: 1. FORCES DEMOCRATIQUES DE LIBERATION DU RWANDA (a.k.a. COMBATANT FORCE FOR THE LIBERATION OF RWANDA; a.k.a. DEMOCRATIC FORCES FOR THE LIBERATION OF RWANDA; a.k.a...

  15. Comparison of intra-aortic computed tomography angiography to conventional angiography in the presurgical visualization of the Adamkiewicz artery: first results in patients with thoracoabdominal aortic aneurysms

    International Nuclear Information System (INIS)

    Clarencon, Frederic; Maria, Federico di; Cormier, Evelyne; Sourour, Nader; Gabrieli, Joseph; Iosif, Christina; Chiras, Jacques; Gaudric, Julien; Koskas, Fabien; Jenny, Catherine

    2013-01-01

    The aim of this study was to compare the sensitivity of intra-aortic computed tomography angiography (IA-CTA) to that of regular spinal digital subtraction angiography for the presurgical location of the Adamkiewicz artery (AKA). Thirty patients (21 males, 9 females; mean age 64 years) had an IA-CTA for the location of the AKA before surgery of aneurysm (n = 24) or dissection (n = 6) of the thoracoabdominal aorta. After femoral artery puncture, a pigtail catheter was positioned at the origin of the descending aorta. CT acquisition was performed with an intra-aortic iodinated contrast media injection (15 mL/s, 120 mL). The visualization of the AKA and the location of the feeder(s) to the AKA were independently evaluated by two observers. Interrater agreement was calculated using a kappa test. Spinal angiogram by selective catheterization was systematically performed to confirm the results of the IA-CTA. The AKA was visualized by the IA-CTA in 27/30 cases (90 %); in 26/31 (84 %) cases, the continuity with the aorta was satisfactorily seen. Interrater agreement was good for the visualization of the AKA and its feeder(s): 0.625 and 0.87, respectively. In 75 % of the cases for which the AKA was visualized, the selective catheterization confirmed the results of the IA-CTA. In the remaining 25 % of the cases, the selective catheterization could not be performed due to marked vessels' tortuosity or ostium stenosis. IA-CTA is a feasible technique in a daily practice that presents a good sensitivity for the location of the AKA. (orig.)

  16. 76 FR 35062 - Apparel America, Inc. (n/k/a HSK Industries, Inc.), Decora Industries, Inc., Diversicon Holdings...

    Science.gov (United States)

    2011-06-15

    ... Transportation Network Group, Inc., and Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc... concerning the securities of Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc.) because...

  17. A randomised controlled trial of an SMS-based mobile epilepsy education system.

    Science.gov (United States)

    Lua, Pei Lin; Neni, Widiasmoro Selamat

    2013-01-01

    We evaluated an epilepsy education programme based on text messaging (SMS). Epilepsy outpatients from three hospitals in Malaysia were randomised into two groups: intervention and control. Patients in the control group were supplied with printed epilepsy educational material while those in the intervention group also received text messages from the Mobile Epilepsy Educational System (MEES). A total of 136 patients completed the study (mean age 31 years; 91% Malay; 51% with an illness duration of more than 5 years). A between-group analysis showed that the awareness, knowledge and attitudes (AKA) about epilepsy did not significantly differ between the groups at baseline (P > 0.05). The intervention patients reported better AKA levels during follow-up compared to the control patients (P < 0.05). A within-group analysis showed that in intervention patients, there were significant improvements in all AKA domains with larger effect sizes (P < 0.01) while control patients also exhibited significant improvement in most domains except for Awareness but with smaller effect sizes. After controlling for possible confounding variables (age, gender, educational qualification, monthly income and baseline mean for each domain), the intervention group still reported significantly higher AKA than the control group particularly in Awareness (P < 0.001) and Total AKA (P = 0.003). There was also significantly better medication adherence and clinic attendance in the intervention group (P < 0.05). The results suggest that the addition of the MEES to conventional epilepsy education is effective in improving AKA.

  18. Yeast Interacting Proteins Database: YGL061C, YER016W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin

  19. 77 FR 44715 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2012-07-30

    ..., S.A. DE C.V. (a.k.a. LA TIJERA PARQUE INDUSTRIAL; a.k.a. PROVENZA CENTER), Av. Adolfo Lopez Mateos... (Mexico) [SDNTK]. 8. PETROBARRANCOS, S.A. DE C.V., Av. Benjamin Hill No. 5602, Col. Industrial el Palmito...

  20. 77 FR 2609 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to the Foreign...

    Science.gov (United States)

    2012-01-18

    ..., S.A. DE C.V. (a.k.a. MEDIC EXPRESS, S.A. DE C.V.; a.k.a. GRUPO LOMEDIC), Av. del Parque 489, Col. San Andres, Guadalajara, Jalisco 44810, Mexico; Calle Chicle 234, Colonia El Colli Industrial, Zapopan...

  1. Yeast Interacting Proteins Database: YKR037C, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymeri

  2. Yeast Interacting Proteins Database: YGR113W, YGL079W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ntial subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depol

  3. Computation of Propagation Speed and Reflection of Axially Symmetric Waves in Composite Cylinders, with Application to Impedance Tube and Calibrator.

    Science.gov (United States)

    1982-08-25

    hoth real and complex; and () compute the propagation speed in the acoustic cal Ibr:ator. (continued on reverse) DD IARM3 1473 EDITION OF I NOVSSIS...FORMAT (3F15.0) 0131 GO TO 230 0132 690 CONTINUE 0133 END 50 *> SUBROUTINES SUBROUTINE: DET C C SUBROUTINE DET C DECEMBER, 1980 C EDITED BY TINA RUGGIERO...33 AISA =AKDA/BAMS 0008 02A=AKA**’-AKDA**2 0009 S2A=AKA**2-AKSA**2 0010 IF (RHM) 65P65P40 0011 40 AKFA-AKDA/COCD 0012 OF2A-AKA**2-AKFA**2 0013 IF (OF2A

  4. What Are the Frequency, Associated Factors, and Mortality of Amputation and Arthrodesis After a Failed Infected TKA?

    Science.gov (United States)

    Son, Min-Sun; Lau, Edmund; Parvizi, Javad; Mont, Michael A; Bozic, Kevin J; Kurtz, Steven

    2017-12-01

    For patients with failed surgical treatment of an infected TKA, salvage operations such as arthrodesis or above-knee amputation (AKA) may be considered. Clinical and institutional factors associated with AKA and arthrodesis after a failed TKA have not been investigated in a large-scale population, and the utilization rate and trend of these measures are not well known. (1) How has the frequency of arthrodesis and AKA after infected TKA changed over the last 10 years? (2) What clinical or institutional factors are associated with patients undergoing arthrodesis or AKA? (3) What is the risk of mortality after arthrodesis or AKA? The Medicare 100% National Inpatient Claims Database was used to identify 44,466 patients 65 years of age or older who were diagnosed with an infected TKA and who underwent revision between 2005 and 2014 based on International Classification of Diseases, 9 th Revision, Clinical Modification codes. Overall, 1182 knee arthrodeses and 1864 AKAs were identified among the study population. One year of data before the index infection-related knee revision were used to examine patient demographic, institutional, and clinical factors, including comorbidities, hospital volumes, and surgeon volumes. We developed Cox regression models to investigate the risk of arthrodesis, AKA, and death as outcomes. In addition, the year of the index revision was included as a covariate to determine if the risk of subsequent surgical interventions was changing over time. The risk of mortality was also assessed as the event of interest using a similar multivariate Cox model for each patient group (arthrodesis, AKA) in addition to those who underwent additional revisions but who did not undergo either of the salvage procedures. The number of arthrodesis (hazard ratio [HR], 0.90, p death increased with amputation after adjusting for age, comorbidities, and other factors (HR, 1.28 [1.20-1.37], p < 0.001), but patients who received arthrodesis did not show a change in

  5. 78 FR 60844 - Wooden Bedroom Furniture From the People's Republic of China: Partial Rescission of Antidumping...

    Science.gov (United States)

    2013-10-02

    ... Furniture Co., Ltd. Dorbest Ltd., Rui Feng Woodwork Co., Ltd. Aka Rui Feng Woodwork (Dongguan) Co., Ltd., Rui Feng Lumber Development Co., Ltd. Aka Rui Feng Lumber Development (Shenzhen) Co., Ltd., Fine... Fung Wooden Factory, Sun Fung Co., Shin Feng Furniture Co., Ltd., Stupendous International Co., Ltd...

  6. Yeast Interacting Proteins Database: YGR113W, YLR424W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...13W Bait gene name DAM1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force

  7. 76 FR 40773 - Additional Designation of Entities Pursuant to Executive Order 13382 and Information Regarding...

    Science.gov (United States)

    2011-07-11

    ... INVESTMENT COMPANY; a.k.a. MEHR IRANIAN ECONOMY COMPANY; a.k.a. MEHR IRANIAN ECONOMY INVESTMENTS; f.k.a... Square, Tehran, Iran; No. 48, 14th Alley, Ahmad Qassir Street, Argentina Square, Tehran, Iran; Business Registration Document 103222 (Iran); Web site http://www.mebank.ir ; Telephone: 982188526300; Alt. Telephone...

  8. 76 FR 38279 - Designation of One Individual and One Entity Pursuant to Executive Order 13224

    Science.gov (United States)

    2011-06-29

    ... policy, or economy of the United States; (3) persons determined by the Director of OFAC, in consultation.... SHAHRIYARI, Behnam (a.k.a. SHAHRIARI, Behnam; a.k.a. SHAHRYARI, Behnam); DOB 1968; nationality Iran..., Tehran, Iran [SDGT]. Dated: June 23, 2011. Adam J. Szubin, Director, Office of Foreign Assets Control...

  9. 76 FR 72502 - Removal From the List of Specially Designated Nationals and Blocked Persons of Certain Entities...

    Science.gov (United States)

    2011-11-23

    .... Box 15715, Az Zawiyah, Libya [LIBYA2] 7. BREGA PETROLEUM MARKETING COMPANY (a.k.a. BPMC; a.k.a. BREGA... Montplaisir (Bourjel), 1002, Tunis, Tunisia; Avenue Kheireddine Pacha, Cite Ennasim Montplaisir, 1002, Tunis, Tunisia; P.O. Box 485, 1080, Tunis Cedex, Tunisia; Bizerte Centre, 7000, Bizerte, Tunisia; Ennasim Mont...

  10. 75 FR 9645 - Additional Designations of Individuals and Entities Pursuant to Section 804(b) of the Foreign...

    Science.gov (United States)

    2010-03-03

    ... worldwide basis. It provides a statutory framework for the President to impose sanctions against significant... identified by the President. In addition, the Secretary of the Treasury consults with the Attorney General...; a.k.a. MENDEZ VARGAS, Jesus; a.k.a. MENDEZ, Jesus), Tazumbos, Jalisco, Mexico; Calle Dr. Lose Luis...

  11. 76 FR 50407 - Addition of Persons Acting Contrary to the National Security or Foreign Policy Interests of the...

    Science.gov (United States)

    2011-08-15

    ... Physics and Chemistry (a.k.a., China Academy of Engineering Physics (CAEP)'s 902 Institute); --Southwest... as one of nineteen individual aliases for the listed person the ``Chinese Academy of Engineering... described above, to read as follows: China (1) Chinese Academy of Engineering Physics, a.k.a., the following...

  12. Assessment of Secondary School Students' Awareness, Knowledge and Attitudes to Environmental Pollution Issues in the Mining Regions of South Africa: Implications for Instruction and Learning

    Science.gov (United States)

    Olufemi, Adejoke Christianah; Mji, Andile; Mukhola, Murembiwa S.

    2016-01-01

    In this paper, we compared the levels of awareness, knowledge and attitudes (AKA) about environmental pollution of secondary school students from two South African provinces. The purpose was to determine the levels of AKA between students living under different environmental conditions. These two groups were students from a coal-mining province…

  13. 76 FR 71867 - Addition of Certain Persons to the Entity List; and Implementation of Entity List Annual Review...

    Science.gov (United States)

    2011-11-21

    ... Kabul, Afghanistan, and A2 Ground Floor, City Computer Plaza, Shar-e-Naw, Kabul, Afghanistan; (3) Fazal..., Peshawar, Pakistan; (3) Fazal Rahim Farid, a.k.a., the following three aliases: --Fazel Rahim Farid... Afghanistan EAR). Fazal Rahim Farid, a.k.a., the For all items Presumption of denial........ 76 FR [INSERT FR...

  14. Self-employment and quasi self-employment: a challenge for labour law

    NARCIS (Netherlands)

    Westerveld, M.; Zaal, I.

    2015-01-01

    Over the years the (Dutch) labour market has witnessed a growing number of workers outside the realm of the employment contract. At the end of the past century the number of (in Dutch) ‘self-employed without personnel’ (a.k.a. independent contractor, a.k.a. sole trader) was around one in seventeen

  15. 2311-IJBCS-Article-Aka Marcel Kouassi

    African Journals Online (AJOL)

    hp

    Chem. Sci. 9(2): 1120-1129, April 2015. ISSN 1997-342X (Online), ISSN ... clear dominance of high molecular weight (HMW) PAHs (pyrene, Benzo (k) ... the organic matter accumulated in deep ... hydrophobic nature, PAHs are mostly.

  16. Stratigraphy and geologic age of the Neogene Shimajiri Group in Kumejima Island, Ryukyu Islands, southwestern Japan

    International Nuclear Information System (INIS)

    Nakamura, Yodai; Asahara, Yoshihiro; Ozawa, Tomowo; Kameo, Koji

    1999-01-01

    The Neogene Shimajiri Group is distributed sporadically in the Ryukyu islands. This study focuses on the Shimajiri Group in Kumejima Island, central Ryukyu, and clarifies its stratigraphy and geologic age on the basis of 1) lithostratigraphy, 2) calcareous nannofossil biostratigraphy, and 3) strontium isotope stratigraphy. The Shimajiri Group in Kumejima Island unconformably overlies the middle Miocene Aradake Formation, and is overlain by the Pleistocene Ryukyu Group. The group is divided into three formations, namely the Maja, the Aka and the Uegusukudake Formations in ascending order, and the first two are redefined in this paper based on the new geologic evidence. The Maja Formation consists mainly of fine-grained sandstone, sandy siltstone and alternating beds of them. The Aka Formation is mainly composed of cross-stratified sandstone, pumiceous sandstone and tuffaceous siltstone, and unconformably overlies the Maja Formation. The Uegusukudake Formation, conformably overlying the Aka Formation, consists of basaltic lava, tuff breccia and andesite. On the basis of calcareous nannofossil biostratigraphy, the Maja and Aka Formations can be assigned to Zone CN9 and Zone CN12b of Okada and Bukry (1980) respectively. Strontium isotope ages of the molluscan fossil specimens obtained from the Maja and Aka Formations revealed that the Maja Formation is assigned to the late Miocene (ca. 7.8-7.2 Ma) and the Aka Formation is assigned to the late Pliocene (ca. 3.2-3.1 Ma). These ages are concordant with the nannofossil biostratigraphy. The upper Miocene Maja Formation yields many molluscan fossils in which the characteristic species of the Kakegawa Fauna, such as Amussiopecten praesignis and Mimachlamys satoi are contained. The molluscan fauna of the Maja Formation is significant in understanding the origin of the Kakegawa Fauna, as the characteristic species of the Plio-Pleistocene Kakegawa Fauna already appeared in the Ryukyu Islands in the late Miocene. (author)

  17. 75 FR 36516 - Addition and Removal of Certain Persons on the Entity List: Addition of Persons Acting Contrary...

    Science.gov (United States)

    2010-06-28

    ... reasons. OnTime Electronics Technology Company and Tam Wai Tak, a.k.a., Thomsom Tam, are being added due... June 5, 2008, OnTime Electronics Technology Company and Tam Wai Tak were indicted in the Southern... Commercial Center, 28 Ferry Street, Jordon, Kowloon, Hong Kong; and (2) Tam Wai Tak, a.k.a., Thomsom Tam...

  18. 77 FR 22756 - Modification of Temporary Denial Order Making Temporary Denial of Export Privileges Applicable to...

    Science.gov (United States)

    2012-04-17

    ... Gatewick Freight & Cargo Services, a/k/a/ Gatewick Aviation Services, G 22 Dubai Airport Free Zone, P.O... Airport Free Zone, P.O. Box 393754, Dubai, United Arab Emirates; and P.O. Box 52404, Dubai, United Arab.... Kerman Aviation, a/k/a GIE Kerman Aviation, 42 Avenue Montaigne 75008, Paris, France. Sirjanco Trading, P...

  19. 76 FR 70544 - OFAC Implementation of Certain Sanctions Imposed on Seven Persons by the Secretary of State...

    Science.gov (United States)

    2011-11-14

    ... LTD; a.k.a. PETROCHEMICAL TRADING COMPANY LIMITED; a.k.a. ``PCCI''), P.O. Box 261539, Jebel Ali, Dubai... Group, ROG Corporate Office, Royal Oyster General Trading LLC, P.O. Box 34299, Dubai, United Arab..., Building W5B, Dubai Airport Free Zone, P.O. Box 54916, Dubai, United Arab Emirates: The Director of OFAC...

  20. Yeast Interacting Proteins Database: YDR034C, YGR113W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin...Rows with this bait as prey (0) YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), coupl...es kinetochores to the force produced by MT depolymerization thereby aiding in ch

  1. Klasični (ekstenzivni) voćnjaci u Hrvatskoj

    OpenAIRE

    Čmelik, Zlatko

    2011-01-01

    Hrvatska ima vrlo povoljne pomoekološke uvjete za uzgoj voćaka. Tradicija uzgoja voćaka duga je više stoljeća, a voćke su se uzgajale na gotovo svim seoskim gospodarstvima, te dijelom i u urbanim sredinama. Intenzivan uzgoj voćaka počeo se značajnije širiti polovinom prošlog stoljeća. Intenzivan uzgoj je u određenoj mjeri potisnuo interes za klasičnim, ali se postojeći voćnjaci visokostablašica uglavnom nisu krčili već su u većoj mjeri bili zapušteni. U novije vrijeme klasični voćnjaci pon...

  2. 31 CFR Appendix A to Part 560 - Persons Determined to be the Government of Iran, as defined in § 560.304 of This Part

    Science.gov (United States)

    2010-07-01

    ...; all offices worldwide [IRAN] BANK REFAH KARGARAN (a.k.a. BANK REFAH; a.k.a. WORKERS' WELFARE BANK (OF...., Vanak Sq., Tehran, Iran; 99-A, Maker Tower F, 9th Floor, Cuffe Parade, Colabe, Mumbai 400 005, India; No... Arab Emirates; Office No. 99-A, Maker Tower “F” 9th Floor Cutte Pavade, Colabe, Bumbai 700005, India...

  3. Chapter Twelve

    African Journals Online (AJOL)

    User

    okada na obere jenareto ai passi mai nebo·. 17 ... Oluchukwu Micro-Finance Bank gbasara aka inyere ndi 10. Mmadu aka n'uzo di .... Nigeria· This in no small measure has been helping unemployed people, graduates ... Even in the transport sector people have been empowered to be self reliant· This could be seen in the ...

  4. Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups

    DEFF Research Database (Denmark)

    Schierup, M.H.; Mailund, T.; Li, H.

    2009-01-01

    Background: A small region of about 70 kb on human chromosome 19q13.3 encompasses 4 genes of which 3, ERCC1, ERCC2, and PPP1R13L (aka RAI) are related to DNA repair and cell survival, and one, CD3EAP, aka ASE1, may be related to cell proliferation. The whole region seems related to the cellular...

  5. Architectural, Mechanical, Electrical, Plumbing, and Site Documents Associated with Sustainability Base, N232

    Science.gov (United States)

    Grymes, Rosalind A.; Martin, Rodney Alexander; Dianati, Soheila

    2016-01-01

    These files contain more precise and accurate representations of the architectural, mechanical, electrical, plumbing, and site information pertaining to Sustainability Base, aka Collaborative Support Facility, aka N232. These supersede the 'bid' drawings released in STI 8112 previously. They are useful for NASA researchers and collaborators in modeling the performance characteristics of the facility. Otherwise, they do not contain new data.

  6. Experiment list: SRX188969 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available lastoma (aka D721), surgical resection from a patient with medulloblastoma as descr...ion=fseq v 1.84 || cell=Medullo || cell organism=human || cell description=medulloblastoma (aka D721), surgi...cal resection from a patient with medulloblastoma as described by Darrell Bigner ...SRX188969 hg19 Input control Input control Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medullob

  7. Ayurvĕda gleaned through Buddhism.

    Science.gov (United States)

    Narayana, Ala; Lavekar, G S

    2005-01-01

    The Păli canon consists of three Pitakas (baskets), which replete the Buddhism and is known as Tripiţaka, viz, Vinaya, Sutta and Abhidhamma Piţakas. The original phase of Tripiţaka (Buddhisim started in 544 B.C. and lastly systematized up to 29 B.C. The Buddhist literature also possesses the esoteric material of Medical Science, which is practiced and conserved in India since centuries. It refers to the fundamentals of medicine, rules of good living, which lay considerable emphasis on the hygiene of body, mind. Internal Medicine, curative medicine including symptoms, methods of diagnosis, theories of causation, materia-medica, therapeutics and treatment and skills of Jivaka. Some famous and popular prescriptions are also dealt with.

  8. Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups

    DEFF Research Database (Denmark)

    Schierup, M.H.; Mailund, T.; Li, H.

    2009-01-01

    Background: A small region of about 70 kb on human chromosome 19q13.3 encompasses 4 genes of which 3, ERCC1, ERCC2, and PPP1R13L (aka RAI) are related to DNA repair and cell survival, and one, CD3EAP, aka ASE1, may be related to cell proliferation. The whole region seems related to the cellular r...

  9. Patterns of Global Terrorism 2002

    Science.gov (United States)

    2003-04-01

    Lebanon. On 25 July, SEPRINTE raided the Ciudad del Este office and apartment of alleged money launderer Fajkumar Naraindas Sabnani, who is allegedly...Saint-Jean-De- Luz , unidentified persons threw gasoline bombs at a police headquarters, causing material damage to police barracks and three parked...sustaining. 121 Revolutionary Organization 17 November a.k.a. 17 November Revolutionary People’s Liberation Party/Front (DHKP/C) a.k.a. Devrimci Sol

  10. Awareness, knowledge and attitudes towards epilepsy among rural populations in East Coast Peninsular Malaysia: a preliminary exploration.

    Science.gov (United States)

    Neni, Selamat Widiasmoro; Latif, Ahmad Zubaidi Abdul; Wong, Sok Yee; Lua, Pei Lin

    2010-06-01

    This study was carried out to gauge the preliminary insight regarding epilepsy among the rural society. The purposes of this study were: (1) to determine general level of awareness, knowledge and attitudes (AKA) towards epilepsy among rural communities, (2) to compare the AKA level based on socio-demographic characteristics and (3) to investigate rural cohort's perception of the best epilepsy treatment, preference for epilepsy information delivery and preference for mode of transportation to seek medical treatment. This prospective, cross sectional study included a sample of 615 rural residents enrolled via cluster sampling in East Coast region of Peninsular Malaysia (mean age=41.6+/-18.02, female=56.6%, married=65.5%, Malay=94.0%, monthly income 0.05). However, respondents with higher education significantly possessed better attitudes and higher Total AKA level compared to those with lower education level (p<0.001). Employed respondents reported significantly more favourable attitudes than unemployed respondents (p=0.011). Additionally, higher income rural cohorts possessed both significantly better attitudes and better AKA. These rural communities perceived modern medicine as the best epilepsy treatment (56.60%), preferred to obtain direct epilepsy-related information from health personnel (60.4%) and chose to use their own car to seek medical treatment in hospital (76.30%). The outcomes of this preliminary study signified the need to devise a dedicated epilepsy education program for implementation among rural residents. Increased AKA level in the society could enhance the people's acceptance, reduce stigmatisation and improve health-related quality of life (HRQoL) for epilepsy patients and their family. Copyright 2010 British Epilepsy Association. Published by Elsevier Ltd. All rights reserved.

  11. Tüüakas briti intellektuaal / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2007-01-01

    Suurbritannia praegusest rahandusministrist Gordon Brownist võib saada Tony Blairi järel järgmine peaminister. CV: Gordon Brown. Vt. samas: Kuningas Midase maagia hajub: Browni puudutus ei muuda kullaks

  12. Experiment list: SRX100894 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX100894 hg19 DNase-seq DNase-Seq Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medulloblastoma... (aka D721), surgical resection from a patient with medulloblastoma as described by ...seSeq || datatype description=DNaseI HS Sequencing || cell description=medulloblastoma (aka D721), surgical ...resection from a patient with medulloblastoma as described by Darrell Bigner (1997) || controlid=generic_fem...section from a patient with medulloblastoma as described by Darrell Bigner (1997) || cell karyotype=cancer |

  13. Secondary Knee Osteoarthritis due to Neurofibromatosis Type 1 Treated with above the Knee Amputation: A Case Report

    Directory of Open Access Journals (Sweden)

    Jay Patel

    2013-01-01

    Full Text Available Background. Neurofibromatosis Type 1 (NF-1 has a variety of associated orthopaedic manifestations that have been previously reported. We report a case of severe, grade 4 knee osteoarthritis (OA with recurrent subluxation and joint laxity due to multiple extra-articular neurofibromas ultimately treated with Above the Knee Amputation (AKA. Case Description. A 39-year-old man presented with multiple neurofibromas and lymphedema leading to degenerative changes of the knee. Conservative treatment failed due to the severity of the knee degeneration and patient discomfort. Likewise, arthroplasty was not possible due to poor bone quality and joint instability. Therefore, AKA was selected to relieve symptoms and provide functional improvement. six months after the procedure the patient has increased functional capacity for ambulation and activities of daily living, as well as significant decrease in pain and discomfort. Clinical Relevance. Extra-articular neurofibromas causing severe secondary OA in relatively young patients can be functionally improved with AKA and prosthetic device use.

  14. Sea King SHOL Support for Post-HCM/FELEX HALIFAX Class Ships

    Science.gov (United States)

    2014-05-01

    modernisation de mi-durée. Les modifica- tions techniques apportées aux navires pendant le radoub ont entraïné des changements im- portants à la...classe Halifax connaissent une modernisation (MCH) de mi-durée. Les modifications techniques apportées aux navires pendant le radoub ont entraïné des...ship DAQ components were distributed about the ship at the bow, mast, port bridge wing, port breezeway, howdah (a.k.a. LSO compartment), Flyco (a.k.a

  15. Neil Young - også kendt som Bernard Shakey

    DEFF Research Database (Denmark)

    Pedersen, Peter Ole

    2016-01-01

    A chronological analysis of the films made by the musician Neil Young. The article takes a closer look at the criticism of society and the portrayal of America and it's music culture in the works of Bernard Shakey a.k.a. Neil Young......A chronological analysis of the films made by the musician Neil Young. The article takes a closer look at the criticism of society and the portrayal of America and it's music culture in the works of Bernard Shakey a.k.a. Neil Young...

  16. Finite element approximations of the stokes flow problem based upon various variational principles

    International Nuclear Information System (INIS)

    Franca, L.P.; Hughers, T.J.R.; Stenberg, R.

    1989-05-01

    Finite element methods are constructed by adding to the usual Galerkin method terms that are mesh-dependent least-squares forms of the Euler-Lagrange equations. The methods are consistent and possess additional stability compared to the Galerkin method. Finite element interpolations, which are unstable in the Galerkin approach, are now convergent. The methodology is applied to the velocity-pressure formulation, a.k.a., Herrmann's formulation, to the stress-velocity formulation, a.k.a., Hellinger-Reissner's formulation and to a new formulation based on augmented stress, pressure and velocity [pt

  17. Diagnostic and prognostic values of antikeratin antibodies (AKA ...

    African Journals Online (AJOL)

    Egyptian Journal of Pediatric Allergy and Immunology (The). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 1 (2003) >. Log in or Register to get access to full text downloads.

  18. Dance: A Psychosocial Tool for Child's Development | Akas ...

    African Journals Online (AJOL)

    Creative Artist: A Journal of Theatre and Media Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 4, No 1 (2010) >. Log in or Register to get access to full text downloads.

  19. HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...

    African Journals Online (AJOL)

    Annals of African Medicine. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 7, No 4 (2008) >. Log in or Register to get access to full text downloads.

  20. HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...

    African Journals Online (AJOL)

    An up-to-date review on human paragonimiasis in Africa was carried out to determine the current geographical distribution of human cases and analyze the animal reservoir, snails and crustaceans which intervene in the local life cycle of Paragonimus species. Two countries, i.e., Cameroon and Nigeria, were mainly ...

  1. An Energy Efficient Mutual Authentication and Key Agreement Scheme Preserving Anonymity for Wireless Sensor Networks

    Science.gov (United States)

    Lu, Yanrong; Li, Lixiang; Peng, Haipeng; Yang, Yixian

    2016-01-01

    WSNs (Wireless sensor networks) are nowadays viewed as a vital portion of the IoTs (Internet of Things). Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement) enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas’s currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham) logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications) to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs. PMID:27338382

  2. An Energy Efficient Mutual Authentication and Key Agreement Scheme Preserving Anonymity for Wireless Sensor Networks.

    Science.gov (United States)

    Lu, Yanrong; Li, Lixiang; Peng, Haipeng; Yang, Yixian

    2016-06-08

    WSNs (Wireless sensor networks) are nowadays viewed as a vital portion of the IoTs (Internet of Things). Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement) enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas's currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham) logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications) to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs.

  3. An Energy Efficient Mutual Authentication and Key Agreement Scheme Preserving Anonymity for Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Yanrong Lu

    2016-06-01

    Full Text Available WSNs (Wireless sensor networks are nowadays viewed as a vital portion of the IoTs (Internet of Things. Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas’s currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs.

  4. 76 FR 60452 - In the Matter of: Bahram Maghazehe, a.k.a. Benjamin Maghazehe, a.k.a. Ben Maghazehe, 154 Sequoia...

    Science.gov (United States)

    2011-09-29

    ...-installation and removal of the equipment from the U.S. hospital and the export of the equipment from the...). Maghazehe had knowledge that a U.S. hospital was discarding the oncology system and that a company in Iran... States. For purposes of this paragraph, servicing means installation, maintenance, repair, modification...

  5. 75 FR 73156 - The Amended Designation of Lashkar-e-Tayyiba (LT, LeT), aka Lashkar-e-Toiba, aka Lashkar-i-Taiba...

    Science.gov (United States)

    2010-11-29

    ..., Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare Foundation...-i-Insaniyat, Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare...

  6. Miners' dictionary: English/Fanakalo

    CSIR Research Space (South Africa)

    Chamber of Mines, South Africa

    1978-01-01

    Full Text Available -beh-Iow Sunday Sonta Sawn-tah week wik week this week: lo wik law week next weelk lo wik yena fika law week yhe-nah fee-kah last week: lo wik yena dlulile; law week yhe-nah dIoo- lo wik yena pelile lee-Ieh; law week yhe-nah peh-Iee-Ieh month nyanga... adapta adaptor ah-dahp-tah Agas August Ah-gahs aka erect v. ah-kah aka build v. ah-kah hlanganisa gather (bring together) shlahng-gah-nee-sah Alimak AIimak Ah-lee-maIk ampur almost ahm-pur aptitude test mlabalab mlah-bah-Iab aseyi otis assay...

  7. Kontrola kvalitete DOF 2

    OpenAIRE

    Kozić, Ružica; Meštrić, Lucija

    2013-01-01

    Projekt studentske radionice bio je kontrola DOF-a u mjerilu 1:2000 na području općine Đurđevac. Proveden je terenski dio kontrole točnosti DMR-a, DOF-a, izvedene signalizacije te načina signalizacije. Mjerenja su obavljena 19.travnja 2013. godine. Obavljena je ponovna izmjera GPS točaka homogenog polja Đurđevac RTK metodom u sustavu CROPOS s ciljem kontrole tih točaka, čije su koordinate već određene u sklopu izrade DOF2. Uz trajno stabilizirane točke homogenog polja, RTK metodom snimane su ...

  8. [Midterm results of thoracic aortic dissection endovascular repair in conjunctions with the location of Adamkiewicz artery].

    Science.gov (United States)

    Jia, Ying-bin; Li, Jian; Su, Yong-hui; Ma, Jie-fei; Guan, Xiao-dong; Zhang, Bai-meng

    2012-10-23

    To evaluate the effects of using longer xenografts in conjunctions with the location of Adamkiewicz artery (AKA) on midterm outcomes of endovascular treatment for thoracic aortic dissection. From March 2005 to September 2011, 217 patients with type B dissection were recruited. There were 143 males and 74 females with a mean age of 65 ± 11 years. Among them, 43 patients were from Fifth Affiliated Hospital of Sun Yat-Sen University while another 174 patients from Affiliated Zhongshan Hospital of Fudan University. They were divided into 2 groups according to whether AKA was identified or not pre-operatively. Endovascular repairs were performed for all patients. Distal landing levels of xenografts were recorded. The thrombosis of false lumen and the complications of spinal cord injury and endoleak were analyzed. AKA was detected in 121 (55.8%) patients (group A) but not in 96 (44.2%) patients (group B). According to the levels of AKA, the patients of group A obtained the stabilization of affected thoracic aorta over a longer distance. And the ratio of patients with distal landing levels at T8-T10 was significantly higher than in group B (59.5% vs 12.5%, χ² = 49.85, P < 0.01). Also, during the follow-up period of 7.3 months, the ratio of patients with total thrombosis of false lumen in group A was significantly higher than that in group B (32.1% vs 19.1%, χ² = 4.34, P < 0.05). During the endovascular repair of thoracic aortic dissection, selecting a longer device may provide a better structural stability of affected aorta and promote false lumen thrombosis.

  9. Longitudinalna analiza razvoja eugnatija i disgnatija od mliječne do trajne denticije

    OpenAIRE

    Legović, Mario; Cehić, Aldo

    1986-01-01

    Autori su kod 366 ispitanika (190 dječaka i 176 djevojčica) sa teritorija općine Poreč promatrali razvoj eugnatija i disgnatija od perioda mliječne do perioda trajne denticije. Djeca su prvi put pregledana u godini 4,5 — do 5,5 godina, a drugi put kod 12,5 — 13,5 godina. U navedenom intervalu kod ispitanika nisu vršeni nikakvi ortodontski zahvati. U mliječnoj denticijii ortodontske anomalije pronađene su kod 43,7% ispitanika (39,5% kod dječaka i 48,3% kod djevojčica), a u trajnoj denticiji ko...

  10. Red Plague Control Plan (RPCP)

    Science.gov (United States)

    Cooke, Robert W.

    2010-01-01

    SCOPE: Prescribes the minimum requirements for the control of cuprous / cupric oxide corrosion (a.k.a. Red Plague) of silver-coated copper wire, cable, and harness assemblies. PURPOSE: Targeted for applications where exposure to assembly processes, environmental conditions, and contamination may promote the development of cuprous / cupric oxide corrosion (a.k.a. Red Plague) in silver-coated copper wire, cable, and harness assemblies. Does not exclude any alternate or contractor-proprietary documents or processes that meet or exceed the baseline of requirements established by this document. Use of alternate or contractor-proprietary documents or processes shall require review and prior approval of the procuring NASA activity.

  11. FY-2001 Accomplishments in Off-gas Treatment Technology Development

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, Douglas William

    2001-09-01

    This report summarizes the efforts funded by the Tank Focus Area to investigate nitrogen oxide (NOx) destruction (a.k.a. deNOx) technologies and off-gas scrubber system designs. The primary deNOx technologies that were considered are staged combustion (a.k.a. NOx reburning), selective catalytic reduction, selective non-catalytic reduction, and steam reformation. After engineering studies and a team evaluation were completed, selective catalytic reduction and staged combustion were considered the most likely candidate technologies to be deployed in a sodium-bearing waste vitrification facility. The outcome of the team evaluation factored heavily in the establishing a baseline configuration for off-gas and secondary waste treatment systems.

  12. Desenvolvimento de modelo clínico para predição da possibilidade de identificação da artéria de Adamkiewicz por angiotomografia

    Science.gov (United States)

    Amato, Alexandre Campos Moraes; Parga, José Rodrigues; Stolf, Noedir Antônio Groppo

    2018-01-01

    Resumo Contexto Diferenças morfológicas da artéria de Adamkiewicz (AKA) entre a população portadora e não portadora de doença aórtica têm importância clínica, influenciando as complicações neuroisquêmicas da medula espinhal em procedimentos operatórios. Ainda não é conhecida a correlação entre parâmetros clínicos e a previsibilidade da identificação dessa artéria pela angiotomografia. Objetivo Desenvolver um modelo matemático que, através de parâmetros clínicos correlacionados com aterosclerose, possa prever a probabilidade de identificação da AKA em pacientes submetidos a angiotomografias. Método Estudo observacional transversal utilizando banco de imagens e dados de pacientes. Foi feita análise estatística multivariada e criado modelo matemático logit de predição para identificação da AKA. Variáveis significativas foram utilizadas na montagem da fórmula para cálculo da probabilidade de identificação. O modelo foi calibrado, e a discriminação foi avaliada pela curva receiver operating characteristic (ROC). A seleção das variáveis explanatórias foi guiada pela maior área na curva ROC (p = 0,041) e pela significância combinada das variáveis. Resultados Foram avaliados 110 casos (54,5% do sexo masculino, com idade média de 60,97 anos e etnia com coeficiente B -2,471, M -1,297, N -0,971), com AKA identificada em 60,9%. Índice de massa corporal: 27,06 ± 0,98 (coef. -0,101); fumantes: 55,5% (coef. -1,614/-1,439); diabéticos: 13,6%; hipertensos: 65,5% (coef. -1,469); dislipidêmicos: 58,2%; aneurisma aórtico: 38,2%; dissecção aórtica: 12,7%; e trombo mural: 24,5%. Constante de 6,262. Fórmula para cálculo da probabilidade de detecção: (e−(Coef. Etnia+(Coef. IMC×IMC)+Coef.fumante+Coef.HAS+Coef.dislip+Constante)+1)−1 . O modelo de predição foi criado e disponibilizado no link https://vascular.pro/aka-model . Conclusão Com as covariáveis etnia, índice de massa corporal, tabagismo, hipertens

  13. First report of important causal relationship between the Adamkiewicz artery vasospasm and dorsal root ganglion cell degeneration in spinal subarachnoid hemorrhage: An experimental study using a rabbit model.

    Science.gov (United States)

    Turkmenoglu, Osman N; Kanat, Ayhan; Yolas, Coskun; Aydin, Mehmet Dumlu; Ezirmik, Naci; Gundogdu, Cemal

    2017-01-01

    The blood supply of the lower spinal cord is heavily dependent on the artery of Adamkiewicz. The goal of this study was to elucidate the effects of lumbar subarachnoid hemorrhage (SAH) on the lumbar 4 dorsal root ganglion (L4DRG) cells secondary to Adamkiewicz artery (AKA) vasospasm. This study was conducted on 20 rabbits, which were randomly divided into three groups: Spinal SAH ( n = 8), serum saline (SS) (SS; n = 6) and control ( n = 6) groups. Experimental spinal SAH was performed. After 20 days, volume values of AKA and neuron density of L4DRG were analyzed. The mean alive neuron density of the L4DRG was 15420 ± 1240/mm 3 and degenerated neuron density was 1045 ± 260/mm 3 in the control group. Whereas, the density of living and degenerated neurons density were 12930 ± 1060/mm 3 and 1365 ± 480/mm 3 in serum saline (SS), 9845 ± 1028/mm 3 and 4560 ± 1340/mm 3 in the SAH group. The mean volume of imaginary AKAs was estimated as 1,250 ± 0,310 mm 3 in the control group and 1,030 ± 0,240 mm 3 in the SF group and 0,910 ± 0,170 mm 3 in SAH group. Volume reduction of the AKAs and neuron density L4DRG were significantly different between the SAH and other two groups ( P < 0.05). Decreased volume of the lumen of the artery of Adamkiewicz was observed in animals with SAH compared with controls. Increased degeneration the L4 dorsal root ganglion in animals with SAH was also noted. Our findings will aid in the planning of future experimental studies and determining the clinical relevance on such studies.

  14. Scieszka's Subversive Little Red Hen: AKA "One Annoying Chicken"

    Science.gov (United States)

    Pantaleo, Sylvia

    2007-01-01

    During the past three years, the author has been exploring Grade 5 students' processes of reading and understanding contemporary picturebooks with Radical Change characteristics and metafictive devices, and examining how students use their knowledge of these characteristics and devices to create their own texts. "The Stinky Cheese Man and Other…

  15. PEMBACAAN ANGKA TAHUN PRASASTI SIRAH KẼTING DAN KAITANNYA DENGAN TOKOH ŚRĪ JAYAWARSA DIGWIJAYA ŚASTRAPRABHU

    Directory of Open Access Journals (Sweden)

    Churmatin Nasoichah

    2017-06-01

    Full Text Available The purpose of this paper is to know the exact age for Sirah Kĕting Inscription and its relation with Śrī Jayawarsa Digwijaya Śastraprabhu. The assessment was done by using inductive-deductive reasoning which moves from the facts on the field and then ends with a conclusion. In reading the Sirah Kĕting Inscription were found in the Ponorogo area, East Java, there are two different opinions in chanting year number. According to J.L.A. Brandes and W.F. Stutterheim readings, Sirah Kĕting Inscription was built on 1026 Śaka, while according to the Louis-Charles Damais readings, Sirah Kĕting Inscription was built on 1126 Śaka. From some of the results of the comparison can be concluded that the date Sirah Kĕting Inscription was built in 1126 Saka (1204 AD, the reading means agree with Louis-Charles Damais. Related to the Śrī Jayawarsa Digwijaya Śastraprabhu figure, is a king who has an autonomous kingdom (power located in the region of Madiun and Ponorogo, East Java and is the grandson of Dharmmawangsa Tguh. Keywords: Sirah Kĕting Inscription, date built, Śrī Jayawarsa Digwijaya Śastraprabhu, Mṛwak Inscription  Tujuan penulisan makalah ini adalah untuk mengetahui secara pasti angka tahun Prasasti Sirah Kĕting dan kaitannya dengan tokoh Śrī Jayawarsa Digwijaya Śastraprabhu. Pengkajian dilakukan dengan menggunakan penalaran induktif-deduktif yang bergerak dari fakta-fakta di lapangan yang kemudian diakhiri dengan sebuah simpulan. Dalam pembacaan Prasasti Sirah Kĕting yang ditemukan di daerah Ponorogo, Jawa Timur terdapat dua pendapat yang berbeda dalam penyebutan angka tahunnya. Menurut pembacaan  J.L.A. Brandes dan W.F. Stutterheim, Prasasti Sirah Kĕting berangka tahun 1026 Śaka, sedangkan menurut hasil pembacaan Louis-Charles Damais, Prasasti Sirah Kĕting berangka tahun 1126 Śaka. Berdasarkan beberapa hasil perbandingan dapat ditarik simpulan bahwa angka tahun pada Prasasti Sirah Kĕting adalah 1126 Śaka (1204 Masehi

  16. 76 FR 554 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2011-01-05

    ... Western Way, Torrance, CA 90501. Officer: Hseanru aka Stephen H. Lin, President/VP/Secretary/CFO... Street, Lyndhurst, NJ 07071. Officers: Jerry Wang, Vice President (Qualifying Individual), Loong H. Chang...

  17. Solar Secure Schools: Strategies and Guidelines; October 2004--April 2005

    Energy Technology Data Exchange (ETDEWEB)

    Braun, G. W.; Varadi, P. F.

    2006-01-01

    This report explores the technical and economic aspects of installing solar power (photovoltaic aka PV) systems on schools to improve the schools' energy security and provide power during disasters.

  18. 75 FR 60076 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Requests for...

    Science.gov (United States)

    2010-09-29

    ... as Anvifish JSC) Anvifish Co., Ltd Asia Commerce Fisheries Joint Stock Company (aka as Acomfish JSC... Trading Company Limited Qingdao Tiger Hardware Factory Co., Ltd Qingyuan County Hongyi Hardware Products...

  19. Data Element Registry Services

    Data.gov (United States)

    U.S. Environmental Protection Agency — Data Element Registry Services (DERS) is a resource for information about value lists (aka code sets / pick lists), data dictionaries, data elements, and EPA data...

  20. 77 FR 61051 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2012-10-05

    ..., Distrito Federal Codigo Postal 03020, Mexico; Calle Sor Juana Ines de la Cruz No. 144, Departamento 124... (Mexico) (individual) [SDNTK]. 2. FELIX FELIX, Victor Manuel (a.k.a. CASTRO RODRIGUEZ, Raul), Callejon...

  1. TCTE Level 3 Total Solar Irradiance Daily Means V002

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSID contains daily averaged total solar irradiance (a.k.a solar constant) data...

  2. 75 FR 48991 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2010-08-12

    ...; Kingston Technology Far East (Malaysia) Sdn Bhd, Bayan Legas, Malaysia; MiTAC Digital Corporation (aka... to the orders are used in the United States; (ii) Identify any public health, safety, or welfare...

  3. 76 FR 61776 - Designation of Five Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2011-10-05

    ... (Pakistan) issued 8 Sep 2008 expires 7 Sep 2013 (individual) [SDGT] 4. ABBASIN, Abdul Aziz (a.k.a. MAHSUD, Abdul Aziz); DOB 1969; POB Sheykhan Village, Pirkowti Area, Orgun District, Paktika Province...

  4. 77 FR 68207 - Designations of 4 Individuals Pursuant to Executive Order 13224 of September 23, 2001, “Blocking...

    Science.gov (United States)

    2012-11-15

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined..., Mohammad (a.k.a. MINAEE, Muhamed); DOB 1964; POB Iran; citizen Iran (individual) [SDGT] [IRGC] [IFSR...

  5. GPM, DPR Level 2A Ka Precipitation V03

    Data.gov (United States)

    National Aeronautics and Space Administration — The 2AKa algorithm provides precipitation estimates from the Ka radar of the Dual-Frequency Precipitation Radar on the core GPM spacecraft. The product contains two...

  6. Yeast Interacting Proteins Database: YLR423C, YKR083C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available of the Dam1 complex (aka DASH complex), couples kinetochores to the force produce...lex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segrega

  7. Experiment list: SRX188970 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX188970 hg19 TFs and others CTCF Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medulloblastoma... (aka D721), surgical resection from a patient with medulloblastoma as described by

  8. TCTE Level 3 Total Solar Irradiance 6-Hour Means V002 (TCTE3TSI6) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSI6 contains 6-hour averaged total solar irradiance (a.k.a solar constant)...

  9. CRED Towed-Diver Fish Biomass Survey at Asuncion, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  10. 75 FR 74769 - Designation of Three Individuals Pursuant to Executive Order 13224

    Science.gov (United States)

    2010-12-01

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... passport; Holder of a Bangladesh passport (individual) [SDGT] 3. RAUF, Hafiz Abdur (a.k.a. RAOUF, Hafiz...

  11. SAFARI 2000 PAI Estimates from Hemispherical Photography, Kalahari Transect

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set was collected during February-March 2000 wet season and September 2000 dry season field campaigns of SAFARI 2000. Mongu in Zambia and Pandematenga (aka...

  12. CRED Towed-Diver Fish Biomass Survey at Swains, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  13. CRED Towed-Diver Fish Biomass Survey at Lanai, Main Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  14. CRED Towed-Diver Fish Biomass Survey at Tau, American Samoa in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  15. CRED Towed-Diver Fish Biomass Survey at South Bank, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  16. CRED Towed-Diver Fish Biomass Survey at Asuncion, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  17. CRED Towed-Diver Fish Biomass Survey at Kingman, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  18. CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  19. CRED Towed-Diver Fish Biomass Survey at Guam, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  20. CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  1. CRED Towed-Diver Fish Biomass Survey at Sarigan, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  2. CRED Towed-Diver Fish Biomass Survey at Jarvis, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  3. CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  4. CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  5. CRED Towed-Diver Fish Biomass Survey at Guam, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  6. CRED Towed-Diver Fish Biomass Survey at Maui, Main Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  7. CRED Towed-Diver Fish Biomass Survey at Rose, American Samoa in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  8. CRED Towed-Diver Fish Biomass Survey at Pagan, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  9. CRED Towed-Diver Fish Biomass Survey at Palmyra, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  10. CRED Towed-Diver Fish Biomass Survey at Sarigan, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  11. CRED Towed-Diver Fish Biomass Survey at Alamagan, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  12. CRED Towed-Diver Fish Biomass Survey at Tinian, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  13. CRED Towed-Diver Fish Biomass Survey at Oahu, Main Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  14. CRED Towed-Diver Fish Biomass Survey at Howland, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  15. 77 FR 20124 - Designation of 4 Individuals and 2 Entities Pursuant to Executive Order 13224 of September 23...

    Science.gov (United States)

    2012-04-03

    ... Zone 1, Abuja, Nigeria; DOB 1965; nationality Nigeria (individual) [SDGT] Entities 1. YAS AIR (a.k.a..., Tehran, Iran [SDGT] 2. BEHINEH TRADING, Tehran, Iran [SDGT] Dated: March 27, 2012. Adam J. Szubin...

  16. Virtual Combat Convoy Trainer: Successful Rapid Prototyping

    National Research Council Canada - National Science Library

    Delk-Tierney, Sara

    2004-01-01

    .... The LM-FATS VCCT solution (aka VCCT-L) provides basic to advanced convoy skills training and mission rehearsal, incorporating precision weapons engagement training, realistic weapons, a full-scale HMMWV mockup, high-fidelity mobility...

  17. CRED Towed-Diver Fish Biomass Survey at Aguijan, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  18. CRED Towed-Diver Fish Biomass Survey at Rota, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  19. CRED Towed-Diver Fish Biomass Survey at Ofu & Olosega, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  20. CRED Towed-Diver Fish Biomass Survey at Tinian, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  1. CRED Towed-Diver Fish Biomass Survey at Agrihan, Marianas in 2011

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  2. CRED Towed-Diver Fish Biomass Survey at Johnston, Pacific Remote Island Areas in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  3. CRED Towed-Diver Fish Biomass Survey at Lehua, Main Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  4. CRED Towed-Diver Fish Biomass Survey at Ofu & Olosega, American Samoa in 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  5. CRED Towed-Diver Fish Biomass Survey at Tutuila, American Samoa in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  6. CRED Towed-Diver Fish Biomass Survey at French Frigate, Northwestern Hawaiian Islands in 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  7. CRED Towed-Diver Fish Biomass Survey at Maug, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  8. CRED Towed-Diver Fish Biomass Survey at Guguan, Mariana Archipelago in 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...

  9. AUTOANTIBODIES TO CIRTULLINATED ANTIGENS FOR DIAGNOSIS AND PREDICTION OF CLINICAL COURSE IN EARLY RHEUMATOID ARTHRITIS

    Directory of Open Access Journals (Sweden)

    I. B. Belyaeva

    2007-01-01

    Full Text Available Abstract. To study the value of antibodies to cirtullinated antigens in diagnosis and their significance in prediction of erosion formation of rheumatoid arthritis (RA, we examined serological status in 129 patients with early RA (ERA and 55 cases of undifferentiated arthritis, lasting less than 12 months. Another group consisted of 39 patients with long-standing rheumatoid arthritis, in whom the disease persisted for > 2 years. Control group included 39 patients with osteoarthrosis and 29 patients with reactive arthritis. The titers of rheumatoid factor (RF, antikeratin antibodies (AKA, antiperinuclear factor (APF and antibodies to cyclic citrullinated peptide (anti-CCP were studied during initial examination and 12 months later. Serial cryosections of rat esophagus and normal human buccal epithelial cells served as substrates for AKA and APF detection. AntiCCPs were revealed by means of DIASTAT technique (Axis Shield, UK.Upon initial observation of the patients with ERA, sensitivity and specificity of anti-CCP was, resp., 63.5% and 97,8%, thus exceeding both parameters for RF (48,8% и 86,7%. Sensitivity of AKA and APF for the same group was 17% and 24 %, with specificity of 97.7%. In RF-seronegative cases of early RA, anti-CCP were detected in 37% with ERA and 42% long-standing RA. In patients with non-differentiated arthritis who developed RA within one year, RF and anti-CCP were found in 12,2% and 45,5%. Following a one-year observation, a statistically significant increase was found in incidence of RF and anti-CCP in ERA patients.Positivity for anti-citrulline antibodies (AKA, APF and anti-CCP in ERA patients were associated with higher levels of CRP, increased HAQ, DAS4, Sharp scores, as compared to the patients who were seronegative. In ERA patients positive for anti-citrulline antibodies, higher frequencies of synovitis and erosive arthritis were detected by means of ultrasound and magnetic resonance imaging. In the patients with ERA

  10. CRED Towed-Diver Fish Biomass Surveys at Molokai Island, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  11. SORCE Level 3 Total Solar Irradiance Daily Average V016

    Data.gov (United States)

    National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) data set SOR3TSID contains the total solar irradiance (a.k.a solar constant) data collected by the Total Irradiance Monitor (TIM)...

  12. CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Necker Island, NW Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Surveys at Raita Bank, NW Hawaiian Islands in 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Midway Atoll, NW Hawaiian Islands in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Surveys at Guam Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. CRED Towed-Diver Fish Biomass Surveys at Asuncion Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Sarigan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Pearl And Hermes Atoll, NW Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Surveys at Jarvis Island, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  4. CRED Towed-Diver Fish Biomass Surveys at Johnston Atoll, Pacific Remote Island Areas in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  7. CRED Towed-Diver Fish Biomass Surveys at Nihoa Island, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Surveys at Lanai Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  9. CRED Towed-Diver Fish Biomass Surveys at Tau Island, American Samoa in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  10. CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  11. CRED Towed-Diver Fish Biomass Surveys at Alamagan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  12. CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. Tartu ehk unbewusste Ängste / Rauno Thomas Moss ; interv. Harry Liivrand

    Index Scriptorium Estoniae

    Moss, Rauno Thomas, 1977-

    2008-01-01

    Rauno Thomas Mossi (1977) näitus "Silent Tartu aka Clinical" Vaal galeriis. Kunstniku eluloolisi andmeid, loomingust, alasti mehekeha kujutamisest. Töötab Tartu Ülikoolis joonistamise ja plastilise anatoomia õppejõuna. Tema lemmikkunstnikud

  19. CRED Towed-Diver Fish Biomass Surveys at Kaula Rock, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. CRED Towed-Diver Fish Biomass Surveys at Arakane Bank, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Farallon De Pajaros Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  4. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  7. CRED Towed-Diver Fish Biomass Surveys at Sarigan Island, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Surveys at Tinian Island, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  9. CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  10. CRED Towed-Diver Fish Biomass Surveys at Asuncion Island, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  11. CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  12. CRED Towed-Diver Fish Biomass Surveys at Rota Island, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Tinian Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Rota Island, Marianas Archipelago in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Palmyra Atoll, Pacific Remote Island Areas in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Surveys at Guguan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Palmyra Atoll, Pacific Remote Island Areas in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Surveys at Maui Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  4. CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available mal protein L18 [Kineococcus radiotolerans SRS30216] ... Length = 94 ... Query: 29 ... TELRPRLVVTRSARHVFVQVVDDAQGRTLASASTM...EADLRGFDGDKTAKARKVGELVAER 88 ... T +RPRLVVTRS RHVFVQV+DDA G TLASASTMEADLR ... DK+AKA+ V...G LV ER Sbjct: 1 ... TAVRPRLVVTRSTRHVFVQVIDDAAGHTLASASTMEADLRASGDDKSAKAKAVGVLVGER 60 ...

  6. Ecosystem Monitoring (HB1502, EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...

  7. CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  9. Ecosystem Monitoring (AL9804, EK500)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...

  10. Development of a "Digital Bridge" Thermal Anemometer for Turbulence Measurements, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Thermal anemometry (a.k.a. hot-wire anemometry) has been a key experimental technique in fluid mechanics for many decades. Due to the small physical size and high...

  11. Development of a "Digital Bridge" Thermal Anemometer for Turbulence Measurements, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Thermal anemometry (a.k.a. hot-wire anemometry) has been a key experimental technique in fluid mechanics for many decades. Due to the small physical size and high...

  12. CRED Towed-Diver Fish Biomass Surveys at Lehua Rock, Main Hawaiian Islands in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. 77 FR 14852 - Advanced Growing Systems, Inc., Advantage Capital Development Corp., Amazon Biotech, Inc...

    Science.gov (United States)

    2012-03-13

    ... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Advanced Growing Systems, Inc., Advantage Capital Development Corp., Amazon Biotech, Inc., Andover Holdings, Inc. a/k/a Andover Energy Holdings, Inc... securities of Amazon [[Page 14853

  14. 78 FR 62947 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to the Foreign...

    Science.gov (United States)

    2013-10-22

    ...., Bogota, Colombia; c/o FERTILIZANTES LIQUIDOS DE LA SABANA LTDA., Bogota, Colombia; Calle 109 No. 21-41... 800099351-8 (Colombia) [SDNTK]. 3. FERTILIZANTES LIQUIDOS DE LA SABANA LTDA. (a.k.a. FERTILISA LTDA.), Calle...

  15. CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Ofu And Olosega Islands, American Samoa in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Hawaii Island, Main Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Surveys at Midway Atoll, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. CRED Towed-Diver Fish Biomass Surveys at Johnston Atoll, Pacific Remote Island Areas in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Ofu And Olosega Islands, American Samoa in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  3. CRED Towed-Diver Fish Biomass Surveys at Pearl And Hermes Atoll, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  4. CRED Towed-Diver Fish Biomass Surveys at Molokini Crater, Main Hawaiian Islands in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. CRED Towed-Diver Fish Biomass Surveys at Aguijan Island, Marianas Archipelago in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  6. CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  7. CRED Towed-Diver Fish Biomass Surveys at Farallon De Pajaros Island, Marianas Archipelago in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  8. CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  9. CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  10. CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  11. CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  12. CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  13. CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  14. CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  15. CRED Towed-Diver Fish Biomass Surveys at Necker Island, NW Hawaiian Islands in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  16. CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  17. CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  18. CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  19. CRED Towed-Diver Fish Biomass Surveys at Maui Island, Main Hawaiian Islands in 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  20. CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  1. CRED Towed-Diver Fish Biomass Surveys at Guguan Island, Marianas Archipelago in 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  2. Salinity and physical data from TS probe and thermometer in the Southeast Pacific Ocean from 04 December 1956 to 01 May 1989 (NODC Accession 0000329)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Salinity, temperature, and physical data were collected from the AKADEMIK FEDOROV (AKA AKADEMIK FYODOROV), LENA, and OB from December 4, 1956 to May 1, 1989. These...

  3. OIL SOLUTIONS POWDER

    Science.gov (United States)

    Technical product bulletin: aka OIL SOLUTIONS POWDER, SPILL GREEN LS, this miscellaneous oil spill control agent used in cleanups initially behaves like a synthetic sorbent, then as a solidifier as the molecular microencapsulating process occurs.

  4. 77 FR 60022 - Supplemental Identification Information for One (1) Individual Designated Pursuant to Executive...

    Science.gov (United States)

    2012-10-01

    ... security, foreign policy, or economy of the United States; (3) persons determined by the Director of OFAC.... JUMALE, Ahmed Nur; a.k.a. JUMALI, Ahmed Ali), P.O. Box 3312, Dubai, United Arab Emirates; Mogadishu...

  5. SeaWiFS_L3b_8D_POC

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  6. SeaWiFS_L3b_SNSP_RRS

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  7. SeaWiFS_L3b_CU_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  8. SeaWiFS_L3b_SNWI_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  9. Honey Do Franchising Group, Inc. Information Sheet

    Science.gov (United States)

    Honey Do Franchising Group, Inc., a/k/a The Honey Do Service, Inc. (the Company) is located in Bristol, Virginia. The settlement involves renovation activities conducted at properties constructed prior to 1978, located in Bristol, Virginia.

  10. SeaWiFS_L3m_MO_CHL_chlor_a_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  11. CopperCore 2.2.1

    NARCIS (Netherlands)

    Vogten, Hubert; Martens, Harrie; Koper, Rob

    2005-01-01

    Changes in this release: This version contains: added support for Apache Derby database (aka IBM Cloudscape), moved JBoss specific code from general code base to own package, improved TimerSchedule setup, fixed a number of bugs.

  12. Insights into the Transcriptional Architecture of Behavioral Plasticity in the Honey Bee Apis mellifera

    KAUST Repository

    Khamis, Abdullah M.; Hamilton, Adam R.; Medvedeva, Yulia A.; Alam, Tanvir; Alam, Intikhab; Essack, Magbubah; Umylny, Boris; Jankovic, Boris R.; Naeger, Nicholas L.; Suzuki, Makoto; Harbers, Matthias; Robinson, Gene E.; Bajic, Vladimir B.

    2015-01-01

    (brood care (aka “nursing”) and foraging) and identified transcription factors (TFs) that may govern their expression. More than half of the differentially expressed TFs were associated with motifs enriched in the promoter regions of differentially

  13. SeaWiFS_L3m_R32_PIC_9km

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...

  14. ENGLISH-IGBO GLOSSARY CREATION OF PALM OIL ...

    African Journals Online (AJOL)

    Dean SPGS NAU

    Abstract. The Igbo speaking people are well known for palm oil production ... ventures among other trades or occupations for which the Igbo are known. .... Q na-eme aka ntxtx vii. ..... Professionals – teachers, lawyers, writers, journalists and.

  15. DISPERSIT SPC 1000™

    Science.gov (United States)

    Technical product bulletin: aka SEACARE, ECOSPERSE, this water based dispersant may be applied in oil spill cleanups by aerial or boat spraying. Concentration/application rates depend on type of oil, degree of weathering, temperature, extent of slick.

  16. NATURE'S WAY HS

    Science.gov (United States)

    Technical product bulletin: aka MICRO CLEAN or POWERCLEAN, this surface washing agent used in oil spill cleanups should be applied full strength to surfaces such as shorelines and beaches, pressure sprayed into cracks/crevices, and scrubbed well.

  17. 75 FR 79440 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2010-12-20

    ..., Colombia; c/o FERTILIZANTES LIQUIDOS DE LA SABANA LTDA., Bogota, Colombia; Calle 109 No. 21-41 Apto. 403...) [SDNTK] 13. FERTILIZANTES LIQUIDOS DE LA SABANA LTDA. (a.k.a. FERTILISA LTDA.), Calle 98 Bis No. 57-66...

  18. 75 FR 3523 - Additional Designation of Entities and Individuals Pursuant to Executive Order 12978

    Science.gov (United States)

    2010-01-21

    ... VELEZ, Jorge Enrique (a.k.a. ``El Onli''); c/o ERA DE LUZ LTDA. LIBRERIA CAFE, Cali, Colombia; DOB 09... 805028212-7 (Colombia); (ENTITY) [SDNT]. 6. ERA DE LUZ LTDA. LIBRERIA CAFE, Calle 16 No. 100-98, Cali...

  19. Kepler Planet Detection Metrics: Statistical Bootstrap Test

    Science.gov (United States)

    Jenkins, Jon M.; Burke, Christopher J.

    2016-01-01

    This document describes the data produced by the Statistical Bootstrap Test over the final three Threshold Crossing Event (TCE) deliveries to NExScI: SOC 9.1 (Q1Q16)1 (Tenenbaum et al. 2014), SOC 9.2 (Q1Q17) aka DR242 (Seader et al. 2015), and SOC 9.3 (Q1Q17) aka DR253 (Twicken et al. 2016). The last few years have seen significant improvements in the SOC science data processing pipeline, leading to higher quality light curves and more sensitive transit searches. The statistical bootstrap analysis results presented here and the numerical results archived at NASAs Exoplanet Science Institute (NExScI) bear witness to these software improvements. This document attempts to introduce and describe the main features and differences between these three data sets as a consequence of the software changes.

  20. 15 CFR Supplement No. 4 to Part 744 - Entity List

    Science.gov (United States)

    2010-01-01

    .../22/08. Ali Akbar Yahya, 505 Siraj Building 17B Street, Mankhool, Dubai, U.A.E For all items subject... EAR) Presumption of denial 73 FR 54503, 9/22/08. Farrokh Nia Yaghmaei, a.k.a. Farrokh Nia Yaghmayi...

  1. G-CLEAN OSC-1809

    Science.gov (United States)

    Technical product bulletin: aka OIL SPILL CLEANUP, this surface washing agent may be applied liberally to heavily weathered oil on rocks or beaches/sand, vegetation, or at full strength on tar balls. Best results if allowed to soak, agitated, or reapplied.

  2. 77 FR 44718 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to Executive Order 12978

    Science.gov (United States)

    2012-07-30

    ..., Jorge Enrique (a.k.a. ``EL ONLI''), c/o ERA DE LUZ LTDA. LIBRERIA CAFE, Cali, Colombia; DOB 09 Aug 1968..., Venezuela; RIF J-30460672-9 (Venezuela) [SDNT] 3. ERA DE LUZ LTDA. LIBRERIA CAFE, Calle 16 No. 100-98, Cali...

  3. Mohawk Tannery Hazardous Waste Site in New Hampshire included on EPA List of Targeted for Immediate Attention

    Science.gov (United States)

    Today, the U.S. Environmental Protection Agency released the list of Superfund sites that Administrator Pruitt has targeted for immediate and intense attention. The former Mohawk Tannery facility (a.k.a. Granite State Leathers) is one of the 21 sites on th

  4. Nigerian Veterinary Journal - Vol 32, No 3 (2011)

    African Journals Online (AJOL)

    Management of Unilateral Suppurative Mastitis in A Four-year-old Red · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NN Pilau, AA Abubakar, U Adamu, B Saidu, CE Okoli, LO Aka, AA Adeyeye ...

  5. High-speed web attack detection through extracting exemplars from HTTP traffic

    KAUST Repository

    Wang, Wei; Zhang, Xiangliang

    2011-01-01

    Vector Machine (SVM) are used for anomaly detection. To facilitate comparison, we also employ information gain to select key attributes (a.k.a. features) from the HTTP traffic for web attack detection. Two large real HTTP traffic are used to validate our

  6. 76 FR 5858 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2011-02-02

    ... ORGANIZATION/DRUG TRAFFICKING ORGANIZATION (a.k.a. ``JOUMAA MLO/DTO''); Beirut, Lebanon; Maicao, Colombia... Investigation, the Administrator of the Drug Enforcement Administration, the Secretary of Defense, the Secretary... support of, the international narcotics trafficking activities of a person designated pursuant to the...

  7. 76 FR 6843 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2011-02-08

    ..., Jaslico, Mexico; Vereda Del Canario 1, Guadalajara, Jalisco, Mexico; Puerto de Hierro, Zapopan, Jalisco..., Jalisco, Mexico; Puerto de Hierro, Zapopan, Jalisco, Mexico; Mexico City, Distrito Federal, Mexico.... RODRIGUEZ OLIVERA, Daniel (a.k.a. RODRIGUEZ MORFIN, Daniel), Puerto de Hierro, Zapopan, Jalisco, Mexico...

  8. Formulation de microparticules et de gelules a base de Sida acuta ...

    African Journals Online (AJOL)

    Formulation de microparticules et de gelules a base de Sida acuta (Malvaceae) par spray drying. A N'guessan, A.A. Koffi, L.I. Dally, K Issoufou, S Any-Grah-Aka, J.A. Lia, A Kouassi-Tuo, K.C. N'guessan-Gnaman ...

  9. Suppression of GHS-R in AgRP neurons mitigates diet-induced obesity by activating thermogenesis

    Science.gov (United States)

    Ghrelin, an orexigenic hormone released primarily from the gut, signals the hypothalamus to stimulate growth hormone release, enhance appetite and promote weight gain. The ghrelin receptor, aka Growth Hormone Secretagogue Receptor (GHS-R), is highly expressed in the brain, with highest expression in...

  10. A Biocultural Investigation of Gender Differences in Tobacco Use in an Egalitarian Hunter-Gatherer Population.

    Science.gov (United States)

    Roulette, Casey J; Hagen, Edward; Hewlett, Barry S

    2016-06-01

    In the developing world, the dramatic male bias in tobacco use is usually ascribed to pronounced gender disparities in social, political, or economic power. This bias might also reflect under-reporting by woman and/or over-reporting by men. To test the role of gender inequality on gender differences in tobacco use we investigated tobacco use among the Aka, a Congo Basin foraging population noted for its exceptionally high degree of gender equality. We also tested a sexual selection hypothesis-that Aka men's tobacco use is related to risk taking. Tobacco use, income, tobacco purchases, tobacco sharing, reasons for using tobacco, risk taking, and other variables were measured using structured surveys and peer reports. Tobacco use was verified by testing for salivary cotinine, a nicotine metabolite. Contrary to expectations, we found a very large male bias in tobacco use. Low levels of use among females appeared to be explained by aversions to tobacco, concerns over its negative effects on fetal health, and a desire to attract husbands, who prefer nonsmoking wives. High male use appeared to be related to a desire to enhance hunting abilities and attract and/or retain wives, who prefer husbands that smoke. We conclude that low levels of smoking by Aka women are better explained by the hypothesis that women evolved to avoid plant toxins to protect their fetuses and nursing infants. High male use might be better explained by sexual selection. We also highlight the important role that recreational drugs appear to play in hunter-gatherer sharing relationships.

  11. Technical intelligence and culture: Nut cracking in humans and chimpanzees.

    Science.gov (United States)

    Boesch, Christophe; Bombjaková, Daša; Boyette, Adam; Meier, Amelia

    2017-06-01

    According to the technical intelligence hypothesis, humans are superior to all other animal species in understanding and using tools. However, the vast majority of comparative studies between humans and chimpanzees, both proficient tool users, have not controlled for the effects of age, prior knowledge, past experience, rearing conditions, or differences in experimental procedures. We tested whether humans are superior to chimpanzees in selecting better tools, using them more dexteriously, achieving higher performance and gaining access to more resource as predicted under the technical intelligence hypothesis. Aka and Mbendjele hunter-gatherers in the rainforest of Central African Republic and the Republic of Congo, respectively, and Taï chimpanzees in the rainforest of Côte d'Ivoire were observed cracking hard Panda oleosa nuts with different tools, as well as the soft Coula edulis and Elaeis guinensis nuts. The nut-cracking techniques, hammer material selection and two efficiency measures were compared. As predicted, the Aka and the Mbendjele were able to exploit more species of hard nuts in the forest than chimpanzees. However, the chimpanzees were sometimes more efficient than the humans. Social roles differed between the two species, with the Aka and especially the Mbendjele exhibiting cooperation between nut-crackers whereas the chimpanzees were mainly individualistic. Observations of nut-cracking by humans and chimpanzees only partially supported the technical intelligence hypothesis as higher degrees of flexibility in tool selection seen in chimpanzees compensated for use of less efficient tool material than in humans. Nut cracking was a stronger social undertaking in humans than in chimpanzees. © 2017 Wiley Periodicals, Inc.

  12. 76 FR 55872 - Certain Frozen Fish Fillets From the Socialist Republic of Vietnam: Preliminary Results and...

    Science.gov (United States)

    2011-09-09

    ... concludes that there is a significant potential for the manipulation of price or production. For further... 29, 2010) (``Initiation''). \\6\\ This includes: (1) An Giang Fisheries Import and Export Joint Stock...) Anvifish Joint Stock Company (aka Anvifish JSC); (4) Asia Commerce Fisheries Joint Stock Company...

  13. Realization of an optical interferometer based on holographic optics ...

    Indian Academy of Sciences (India)

    E-mail: aka1945@rediffmail.com ... Eq; 42.79.e; 42.40.My; 42.87.-d. 1. .... by inserting a hot soldering gun with a vertical metallic sheet in the test arm. .... The authors wish to thank the Department of Science and Technology, Government.

  14. Modulation of Invading and Resident Inflammatory Cell Activation as a Novel Way to Mitigate Spinal Cord Injury-Associated Neuropathic Pain

    Science.gov (United States)

    2017-09-01

    7-9]. Several of the chemical constituents of Cannabis sativa (aka marijuana ) have been shown to possess potent anti-inflammatory and...its synthetic analogues: effect on vanilloid VR1 receptors and on the cellular uptake and enzymatic hydrolysis of anandamide. Br J Pharmacol, 2001

  15. 75 FR 81565 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Request for...

    Science.gov (United States)

    2010-12-28

    ... Jiangsu Inter-China Group Corporation (previously operated as Zhenjiang Inter-China Import & Export Co...., Ltd aka Wanli Tools Group Zhenjiang Inter-China Import & Export Co., Ltd.. THE PEOPLE'S REPUBLIC OF...., Ltd Xinjiang Top Agricultural Products Co., Ltd..... XuZhou Simple Garlic Industry Co., Ltd Yantai...

  16. Adoption and validation of Ribonucleotide Reductase (RNR)-based real-time assays for detection of HLB ‘Candidatus Liberibacter asiaticus’ (CLas)

    Science.gov (United States)

    Huanglongbing (HLB), aka Citrus Greening, is a well-known destructive disease that threatens the multi-billion dollar citrus industry in the United States and citrus production in other countries around the world. The presumptive causal agent of HLB, ‘Candidatus Liberibacter asiaticus' (CLas), is of...

  17. Multiplicative calculus in biomedical image analysis

    NARCIS (Netherlands)

    Florack, L.M.J.; Assen, van H.C.

    2011-01-01

    We advocate the use of an alternative calculus in biomedical image analysis, known as multiplicative (a.k.a. non-Newtonian) calculus. It provides a natural framework in problems in which positive images or positive definite matrix fields and positivity preserving operators are of interest. Indeed,

  18. uAdventure: The eAdventure reboot

    NARCIS (Netherlands)

    Perez-Colado, Ivan; Perez Colado, Victor; Martinez-Ortiz, Ivan; Freire, Manuel; Fernandez-Manjon, Baltasar

    2017-01-01

    Educational games (aka serious games, SG) are powerful educational contents. However, they are costly to develop, and once developed, SGs become dependent on software and hardware combinations that may become obsolete, such as Adobe Flash or Java Applets. Addressing these problems would allow a

  19. Effectiveness of a sprayable male annihilation treatment with a biopesticide against fruit flies (Diptera:Tephritidae) attacking tropical fruits

    Science.gov (United States)

    SPLAT-MAT Spinosad ME(aka STATIC Spinosad ME),an "attract and kill" sprayable biopesticide, was evaluated as an area wide suppression treatment against Bactrocera carambolae(Drew & Hancock),carambola fruit fly, in Brazil and Bactrocera dorsalis(Hendel),oriental fruit fly, in Hawaii. In Brazil, a sin...

  20. Status and Future of the Naval R&D Establishment

    Science.gov (United States)

    2010-09-01

    Entrepreneurs who have successfully bridged the technological “valley of death”, • Executives who have deep experience in technology investment in...Meteorology and Oceanography Center Gen-Y Generation "Y" (aka Millennial Generation) GDP Gross Domestic Product HE/AT High End Asymmetric Threat HR

  1. 76 FR 12325 - Small Diameter Graphite Electrodes From the People's Republic of China: Preliminary Results of...

    Science.gov (United States)

    2011-03-07

    ... & Export Corp. (aka Fangda Lanzhou Carbon Joint Stock Company Co. Ltd.; Lanzhou Hailong Technology; Lanzhou... Carbon Co., Ltd., Lianxing Carbon Qinghai Co., Ltd., and Lianxing Carbon Science Institute). Intent To... Department has identified India, Indonesia, the Philippines, Ukraine, Thailand, and Peru as a non- exhaustive...

  2. Baywatch: two approaches to measure the effects of blocking access to The Pirate Bay

    NARCIS (Netherlands)

    Poort, J.; Leenheer, J.; van der Ham, J.; Dumitru, C.

    2013-01-01

    In the fight against the unauthorised sharing of copyright protected material, aka piracy, Dutch Internet Service Providers have been summoned by courts to block their subscribers’ access to The Pirate Bay (TPB) and related sites. This paper studies the effectiveness of this approach towards online

  3. Virumaal elab hiphopkultuur rampidel ja tänavatel / Britta aka BB

    Index Scriptorium Estoniae

    Britta aka BB

    2008-01-01

    Rakvere JJ-Street on esimene ametlik tänavatantsukool Eestis. 26.-28. septembril toimub Tallinnas Salme kultuurikeskuses tänavatantsufestival JJ-Street Baltic Session, festivali korraldaja on Joel Juht

  4. Ballywood ehk Balti Küpsis = Ballywood aka Baltic Cookie / Kalle Komissarov

    Index Scriptorium Estoniae

    Komissarov, Kalle, 1976-

    2010-01-01

    Žürii liige Tallinna Ülikooli Loomemaja ja ülikoolilinnaku sisehoovi kavandamiseks korraldatud avalikust arhitektuurivõistlusest, võidutööst. 1. auhinna sai võistlustöö "Küpsis", mille autoriteks on Maarja Kask, Karli Luik ja Ralf Lõoke (Salto). 2. auhind läks võistlustööle "Camera Obscura" (Luhse ja Tuhal), 3. auhind võistlustööle "2. oktoober" (Arhitektuuriagentuur)

  5. Exploring query execution strategies for JIT vectorization and SIMD

    NARCIS (Netherlands)

    T.K. Gubner (Tim); P.A. Boncz (Peter)

    2017-01-01

    textabstractThis paper partially explores the design space for efficient query processors on future hardware that is rich in SIMD capabilities. It departs from two well-known approaches: (1) interpreted block-at-a-time execution (a.k.a. "vectorization") and (2) "data-centric" JIT compilation, as in

  6. Qualitative Assessment: Evaluating the Impacts of Climate Change on Endangered Species Act Recovery Actions for the South Fork Nooksack River, WA

    Science.gov (United States)

    The South Fork Nooksack River (South Fork) is located in northwest Washington State and is home to nine species of Pacific salmon, including Nooksack early Chinook (aka, spring Chinook salmon), an iconic species for the Nooksack Indian Tribe. The quantity of salmon in the South F...

  7. 75 FR 2929 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-01-19

    ... soliciting comments concerning an information collection titled ``Bank Secrecy Act/Money Laundering Risk Assessment'' (a.k.a. Money Laundering Risk (MLR) System). The OCC also gives notice that it has sent the... approval for the following information collection: Title: Bank Secrecy Act/Anti-Money Laundering Risk...

  8. African Journal of Neurological Sciences - Vol 23, No 2 (2004)

    African Journals Online (AJOL)

    EPIDEMIOLOGY OF HOSPITALIZED PATIENTS IN NEUROLOGY: EXPERIENCE OF COCODY TEACHING HOSPITAL AT ABIDJAN (CÔTE-D\\'IVOIRE). Pascale Cowppli-Bony, Thérèse Sounan-Douayoua, François Akani, Ange-Michel Datie, Berthe Assi, Evelyne Aka-Diarra, Félix Boa Yapo, Ernest Beugré Kouassi.

  9. 31 CFR Appendix A to Chapter V - Alphabetical Listing of Blocked Persons, Blocked Vessels, Specially Designated Nationals...

    Science.gov (United States)

    2010-07-01

    ....V., Blvd. Agua Caliente 1381, Colonia Revolucion, Tijuana, Baja California, Mexico [SDNTK..., Argentina; Avenida Portugal No. 20, Of. 27-Comuna Santiago Centro, Santiago, Chile; Av. Rufino Torrico 981..., Sudan [SUDAN] AGBAS CONSULTORES, S.A. DE C.V. (a.k.a. AGBA CONSULTORES CASA DE CAMBIO), Blv Agua...

  10. 76 FR 64183 - Designation of Five Individuals Pursuant to Executive Order 13224 of September 23, 2001...

    Science.gov (United States)

    2011-10-17

    .... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... Iran; Passport D9004878 (individual) [SDGT] [IRGC]. ARBABSIAR, Manssor (a.k.a. ARBABSIAR, Mansour), 805...; alt. DOB 6 Mar 1955; POB Iran; citizen United States; Driver's License No. 07442833 (United States...

  11. 78 FR 86 - In the Matter of:

    Science.gov (United States)

    2013-01-02

    ..., Hillsborough Village, Muntin Lupa City, Philippines, 1780, Respondent; Celltron Marketing Company, a.k.a. Celltron Mktg. Co., 47A G. Araneta Ave, Quezon City, MM Philippines, 1105, Related Person; Order Denying... vehicle, which was designated as a defense article on the United States Munitions List, without having...

  12. 78 FR 59766 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2013-09-27

    ... Esteban, Olancho, Honduras; Numero de Identidad 1517-1950-00095 (Honduras) (individual) [SDNTK]. 3. RIVERA... Identidad 0209-1949-00019 (Honduras) (individual) [SDNTK]. 4. RIVERA MARADIAGA, Javier Eriberto (a.k.a..., Casa 234, Tocoa, Colon, Honduras; DOB 20 Apr 1972; POB Tocoa, Colon, Honduras; Numero de Identidad 0209...

  13. A Relationship Study of Student Satisfaction with Learning Online and Cognitive Load: Initial Results

    Science.gov (United States)

    Bradford, George R.

    2011-01-01

    This study sought to explore if a relationship exists between cognitive load and student satisfaction with learning online. The study separates academic performance (a.k.a., "learning") from cognitive load and satisfaction to better distinguish influences on cognition (from cognitive load) and motivation (from satisfaction). Considerations that…

  14. Browse Title Index

    African Journals Online (AJOL)

    Diarra Evelyne Aka-Anghui, Mamadou Zakaria, Christian Tanoh, Yapo Felix Boa, Ange-Eric Kouame-Assouan, Berthe Assi. Vol 23, No 1 (2004), DIFFERENT KINDS OF MEDICAL PAPERS LES DIFFERENTS TYPES DE TEXTES MEDICAUX (Francais), Abstract. Moustafa Mijiyawa. Vol 22, No 1 (2003), Difficultes de la Prise ...

  15. 75 FR 41882 - Notice of Intent to Repatriate Cultural Items: U.S. Department of the Interior, Bureau of Indian...

    Science.gov (United States)

    2010-07-19

    ... Society, Museum Division, Madison, WI AGENCY: National Park Service, Interior. ACTION: Notice. Notice is... Society, (aka State Historical Society of Wisconsin), Museum Division, Madison, WI, that meet the definition of unassociated funerary object under 25 U.S.C. 3001. This notice is published as part of the...

  16. 75 FR 58424 - Notice of Intent to Repatriate Cultural Items: Northwest Museum of Arts & Culture, Spokane, WA

    Science.gov (United States)

    2010-09-24

    ... Museum of Arts & Culture, aka Eastern Washington State Historical Society, Spokane, WA, that meet the definition of unassociated funerary objects under 25 U.S.C. 3001. This notice is published as part of the... Eastern Washington State Historical Society (now Northwest Museum of Arts & Culture), University of...

  17. Behavioral plasticity in feeding by Diaphorina citri (Hemiptera, Liviidae): ingestion from phloem versus xylem is influenced by leaf age and surface

    Science.gov (United States)

    Diaphorina citri is a major pest of citrus because it transmits the bacterium that causes Huanglongbing (HLB) (a.k.a. citrus greening). One approach to disease management is vector management using insecticides. However, knowledge of vector mortality alone is not sufficient if the vector has had tim...

  18. Planetary gear dynamic response to mesh parametric excitation

    Directory of Open Access Journals (Sweden)

    Vojislav Jovan Batinić

    2013-02-01

    Full Text Available Normal 0 MicrosoftInternetExplorer4 Unutrašnje dinamičke sile i pomeranja po predviđenim stepenima slobode u planetarnim prenosnicima posledica su, prvenstveno, promen-ljivih elastičnih deformacija zubaca u sprezi, vibracija delova prenosnika i odstupanja geometrije ozubljenja usled habanja zubaca i grešaka izrade. U radu se razmatra uticaj vremenski promenljive sprežne krutosti na moguća pomeranja i sile u kontaktima zubaca. Ove funkcije su korišćene kao nelinearni koeficijenti krutosti u sistemu jednačina za ekvivalentni zupčani prenosnik pri utvrđivanju prirode pomeranja i unutrašnjih dinamičkih sila. Rezultati numeričke analize sistema jednačina kojima je opisano dinamičko ponašanje su vremenski - promenljive funkcije pomeranja tačaka sistema i dinamičkih sila u spregama zubaca centralni zupčanik/satelit i satelit/venčanik.

  19. Accurate DNA assembly and genome engineering with optimized uracil excision cloning

    DEFF Research Database (Denmark)

    Cavaleiro, Mafalda; Kim, Se Hyeuk; Seppala, Susanna

    2015-01-01

    Simple and reliable DNA editing by uracil excision (a.k.a. USER cloning) has been described by several research groups, but the optimal design of cohesive DNA ends for multigene assembly remains elusive. Here, we use two model constructs based on expression of gfp and a four-gene pathway that pro......Simple and reliable DNA editing by uracil excision (a.k.a. USER cloning) has been described by several research groups, but the optimal design of cohesive DNA ends for multigene assembly remains elusive. Here, we use two model constructs based on expression of gfp and a four-gene pathway...... that produces β-carotene to optimize assembly junctions and the uracil excision protocol. By combining uracil excision cloning with a genomic integration technology, we demonstrate that up to six DNA fragments can be assembled in a one-tube reaction for direct genome integration with high accuracy, greatly...... facilitating the advanced engineering of robust cell factories....

  20. Children's Play and Culture Learning in an Egalitarian Foraging Society.

    Science.gov (United States)

    Boyette, Adam H

    2016-05-01

    Few systematic studies of play in foragers exist despite their significance for understanding the breadth of contexts for human development and the ontogeny of cultural learning. Forager societies lack complex social hierarchies, avenues for prestige or wealth accumulation, and formal educational institutions, and thereby represent a contrast to the contexts of most play research. Analysis of systematic observations of children's play among Aka forest foragers (n = 50, ages 4-16, M = 9.5) and Ngandu subsistence farmers (n = 48, ages 4-16, M = 9.1) collected in 2010 illustrates that while play and work trade off during development in both groups, and consistent patterns in sex-role development are evident, Aka children engage in significantly less rough-and-tumble play and competitive games than children among their socially stratified farming neighbors. © 2016 The Authors. Child Development © 2016 Society for Research in Child Development, Inc.

  1. 78 FR 28701 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to Executive Order 12978

    Science.gov (United States)

    2013-05-15

    ... property and interests in property were blocked pursuant to the Order: 1. ARBOLEDA ARROYAVE, Pedro Nicholas (a.k.a. ARBOLEDA ARROYAVE, Pedro Nicolas), c/o DEPOSITO POPULAR DE DROGAS S.A., Cali, Colombia; c/ o...., Bogota, Colombia; Cedula No. 11352426 (Colombia) (individual) [SDNT]. 4. DUQUE MARTINEZ, Diego Fernando...

  2. Evaluation of the microbiological quality of Tchapalo process ...

    African Journals Online (AJOL)

    S Aka-Gbezo, J.S. Lathro, D Dolourou, Y.Z. Nanga, Y.G. Loukou, B Bonfoh, K.M. Dje. Abstract. No Abstract. Keywords: Tchapalo process, traditional beverages, microbiological quality, safety, fermentations. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  3. Link-layer Jamming Attacks on S-MAC

    NARCIS (Netherlands)

    Law, Y.W.; Hartel, Pieter H.; den Hartog, Jeremy; Havinga, Paul J.M.

    2004-01-01

    We argue that among denial-of-service (DoS) attacks, link-layer jamming is a more attractive option to attackers than radio jamming is. By exploiting the semantics of the link-layer protocol (aka MAC protocol), an attacker can achieve better efficiency than blindly jamming the radio signals alone.

  4. Link-layer jamming attacks on S-MAC

    NARCIS (Netherlands)

    Law, Y.W.; Hartel, Pieter H.; den Hartog, Jeremy; Havinga, Paul J.M.

    We argue that among denial-of-service (DoS) attacks, link-layer jamming is a more attractive option to attackers than radio jamming is. By exploiting the semantics of the link-layer protocol (aka MAC protocol), an attacker can achieve better efficiency than blindly jamming the radio signals alone.

  5. 77 FR 61249 - Addition of Certain Persons to the Entity List

    Science.gov (United States)

    2012-10-09

    .... Petersburg, Russia 197376; and 30 16th Parkovaya St, Office 319, Moscow, Russia 105484; (3) Abris-Technology...; and 26 Generala Belova Street, Office 19, Moscow, Russia 115583; (43) ECO-MED-SM Ltd, Petrovsko... Raketnyy Bul'var, Moscow, Russia 129164; (73) Nova Technologies, a.k.a., the following five aliases...

  6. 77 FR 43429 - Unblocking of 1 Individual and 2 Entities Designated Pursuant to Executive Order 13315

    Science.gov (United States)

    2012-07-24

    ... COMPANY LIMITED FOR INTERNATIONAL TRADING AND MARKETING, P.O. Box 212953, Amman 11121, Jordan; c/o ALFA COMPANY LIMITED FOR INTERNATIONAL TRADING AND MARKETING, P.O. Box 910606, Amman 11191, Jordan; c/o TRADING... LIMITED FOR INTERNATIONAL TRADING AND MARKETING (a.k.a. ALFA INVESTMENT AND INTERNATIONAL TRADING COMPANY...

  7. Killing by Autonomous Vehicles and the Legal Doctrine of Necessity

    NARCIS (Netherlands)

    Santoni De Sio, F.

    2017-01-01

    How should autonomous vehicles (aka self-driving cars) be programmed to behave in the event of an unavoidable accident in which the only choice open is one between causing different damages or losses to different objects or persons? This paper addresses this ethical question starting from the

  8. Interferometric key readable security holograms with secrete-codes

    Indian Academy of Sciences (India)

    2Department of Applied Physics, Guru Jambheshwar University of Science & Technology,. Hisar 125 001, India. *E-mail: aka1945@rediffmail.com. MS received 21 ... A new method is described to create secrete-codes in the security holograms for enhancing ... ing, or falsification of the valuable products and documents.

  9. Childhood Diabesity: International Applications for Health Education and Health Policy

    Science.gov (United States)

    Pinzon-Perez, Helda; Kotkin-Jaszi, Suzanne; Perez, Miguel A.

    2010-01-01

    Health policy has a direct impact on health education initiatives, health care delivery, resource allocation, and quality of life. Increasing rates in the epidemics of obesity and obesity-dependent diabetes mellitus (aka diabesity) suggest that health policy changes should be included in health education and disease prevention strategies. Health…

  10. Contactin-5 expression during development and wiring of the thalamocortical system

    NARCIS (Netherlands)

    Kleijer, K T E; Zuko, A; Shimoda, Y; Watanabe, K; Burbach, J P H

    2015-01-01

    The gene encoding the neural cell adhesion molecule Cntn5 (a.k.a. NB-2) has been put forward as a candidate in neurodevelopmental disorders, like autism spectrum disorder (ASD), by recent genetic findings. Little is known about the expression pattern and function of the gene, and its functional

  11. How Effective Are Severe Disciplinary Policies? School Policies and Offending from Adolescence into Young Adulthood

    Science.gov (United States)

    Matjasko, Jennifer L.

    2011-01-01

    Based on the stage environment and the person environment fit perspectives, the current study examined the relation between school disciplinary policies and offending from adolescence into young adulthood. Using Waves I and III of the National Longitudinal Study of Adolescent Health (a.k.a., Add Health), hierarchical multinomial logistic…

  12. 78 FR 19075 - Identification of One Individual, Fourteen Entities, and Eight Vessels Pursuant to the Iranian...

    Science.gov (United States)

    2013-03-28

    ... Emirates [IRAN]. 15. SYNERGY GENERAL TRADING FZE, Sharjah--Saif Zone, Sharjah Airport International Free..., Xanthou Street, Glyfada, Athens 16674, Greece [IRAN]. 12. SIMA GENERAL TRADING CO FZE (a.k.a. SIMA GENERAL TRADING & INDUSTRIALS FOR BUILDING MATERIAL CO FZE), Office No. 703 Office Tower, Twin Tower, Baniyas Rd...

  13. Some Daytime Activities in Solar Astronomy

    Science.gov (United States)

    Burin, Michael J.

    2016-01-01

    This century's transits of Venus (2004, 2012) captured significant public attention, reminding us that the wonders of astronomy need not be confined to the night. And while nighttime telescope viewing gatherings (a.k.a. "star parties") are perennially popular, astronomy classes are typically held in the daytime. The logistics of…

  14. Patient-generated subjective global assessment : innovation from paper to digital app

    NARCIS (Netherlands)

    Ottery, Faith D.; Isenring, Elizabeth; Kasenic, Suzanne; DeBolt, Susan P.; Sealy, Martine; Jager-Wittenaar, Harriët

    2015-01-01

    Purpose: The Patient-Generated Subjective Global Assessment (PG-SGA), including the PG-SGA Short Form (SF, aka ‘abridged’), was originally developed in the mid 1990’s as a scored, patient self-report, paperbased instrument and has been widely validated. The PG-SGA (SF) has been used for screening,

  15. 76 FR 10668 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2011-02-25

    ... Administration, the Secretary of Defense, the Secretary of State, and the Secretary of Homeland Security when... are found to be: (1) Materially assisting in, or providing financial or technological support for or....k.a. AZIMI, Haji Muhammad Rafi; a.k.a. RAFI, Abdul); DOB 15 Feb 1972; POB Afghanistan; citizen...

  16. 75 FR 36474 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2010-06-25

    ... Administration, the Secretary of Defense, the Secretary of State, and the Secretary of Homeland Security when... are found to be: (1) Materially assisting in, or providing financial or technological support for or...: Individuals: 1. SOLARTE CERON, Olidem Romel (a.k.a. SOLARTE CERON, Oliver); Colombia; DOB 05 Feb 1971; Citizen...

  17. Patient-generated subjective global assessment : Innovation from paper to digital app

    NARCIS (Netherlands)

    Faith D. Ottery; Suzanne Kasenic; Martine J. Sealy; Susan P. DeBolt; Elizabeth Isenring; Dr. Harriët Jager-Wittenaar

    2015-01-01

    Purpose: The Patient-Generated Subjective Global Assessment (PG-SGA), including the PG-SGA Short Form (SF, aka ‘abridged’), was originally developed in the mid 1990’s as a scored, patient self-report, paperbased instrument and has been widely validated. The PG-SGA (SF) has been used for screening,

  18. A Network Design Approach to Countering Terrorism

    Science.gov (United States)

    2015-09-01

    2003). More and more scale-free networks have been discovered. How can such diverse systems have the same architecture and properties? Part of the...Rabei Ousmane Sayed Ahmed (a.k.a. the Egyptian ) convinced the group to pursuit jihad at home, where they had the material resources to act (Atran, 2010

  19. Maximizing Consensus in Portfolio Selection in Multicriteria Group Decision Making

    NARCIS (Netherlands)

    Michael, Emmerich T. M.; Deutz, A.H.; Li, L.; Asep, Maulana A.; Yevseyeva, I.

    2016-01-01

    This paper deals with a scenario of decision making where a moderator selects a (sub)set (aka portfolio) of decision alternatives from a larger set. The larger the number of decision makers who agree on a solution in the portfolio the more successful the moderator is. We assume that decision makers

  20. When Policy Is Practice: SDE Effort to Help/Transform/Label Low-Performing Schools

    Science.gov (United States)

    Phillips, April J.

    2017-01-01

    Policymakers have long been infatuated with education reform (Berliner & Biddle, 1995; Stein, 2004), including at the state level (Lusi, 1997). Consistent with this longer tradition, the Nebraska State Legislature (a.k.a. the "Unicameral') passed Legislative Bill 438 (LB 438) in 2014, providing a statutory outline for a new education…

  1. 75 FR 54697 - Unblocking of Thirteen Specially Designated Nationals Pursuant to Executive Order 13224

    Science.gov (United States)

    2010-09-08

    ... (individual) [SDGT]. PARKA TRADING COMPANY, P.O. Box 3313, Deira, Dubai, United Arab Emirates [SDGT]. SOMALI..., Minneapolis, MN 55408 [SDGT]. AL-NUR HONEY PRESS SHOPS (a.k.a. AL-NUR HONEY CENTER), Sanaa, Yemen [SDGT]. AL...]. BARAKAAT CONSTRUCTION COMPANY, P.O. Box 3313, Dubai, United Arab Emirates [SDGT]. BARAKAAT INTERNATIONAL...

  2. Lag space estimation in time series modelling

    DEFF Research Database (Denmark)

    Goutte, Cyril

    1997-01-01

    The purpose of this article is to investigate some techniques for finding the relevant lag-space, i.e. input information, for time series modelling. This is an important aspect of time series modelling, as it conditions the design of the model through the regressor vector a.k.a. the input layer...

  3. Shifting with the Paradigm: LJ's Picks & Pans for ALA in Disneyland

    Science.gov (United States)

    Berry, John N., III

    2008-01-01

    The feelings of librarians planning for the American Library Association (ALA) conference at Disneyland (aka Anaheim, California, June 26-July 2) range from moderate pleasure to dread. Some remember the joys and difficulties of Orlando, especially the exorbitant cab fares and mediocre restaurants. Others quail at screaming kids and tourists in…

  4. 77 FR 76109 - IAS Energy, Inc., IB3 Networks, Inc., IBroadband, Inc., ICP Solar Technologies, Inc., IdentiPHI...

    Science.gov (United States)

    2012-12-26

    ...., IBroadband, Inc., ICP Solar Technologies, Inc., IdentiPHI, Inc., iDNA, Inc., Immune Network Ltd., Inca Designs, Inc., Indico Technologies, Inc. (n/k/a Indico Resources Ltd.), Infopage, Inc. (a/k/a Tamija Gold... securities of ICP Solar Technologies, Inc. because it has not filed any periodic reports since the period...

  5. African Journal of Neurological Sciences - 2009 Vol. 28 No 1

    African Journals Online (AJOL)

    devrait amener à élargir la recherche étiologique et partant à améliorer la prise en charge. 41 .... Selon AKA et collaborateurs, il y a eu une réintroduction des PVS1 et PVS3 en Côte d'Ivoire ... Disponible sur internet: www.cdc.gov/vaccines.

  6. Rearing Fopius arisanus (Sonan) (Hymenoptera:Braconidae) on Mediterranean fruit fly and its introduction into Senegal against Oriental fruit fly (Diptera: Tephritidae)

    Science.gov (United States)

    Oriental fruit fly, Bactrocera dorsalis(Hendel)(aka B.invadens Drew, Tsuruta, and White) was first reported in Africa in 2003 and has since spread to over 27 countries. It has become a serious tree fruit pest, particularly in mango (Mangifera indica L.). Because of uncertainty as to the exact status...

  7. A Summary and Perspective of Recent IRIS Assessments and Impact on Planning Environmental Investigations

    Science.gov (United States)

    2011-03-30

    or remediation  Used with regulatory values to determine cleanup levels  Risk-based screening levels (aka PRGs, RBCs, RSLs) ►Screen sites early in...Final IRIS Values for Hydrogen Cyanide and Cyanide Salts (September 2010)  New Oral noncancer RfD = 0.0006 mg/kg- day; male reproduction effects

  8. Teachers' Beliefs About Using Technology to Enhance the Learning Process of At-Risk-Students

    NARCIS (Netherlands)

    Moekotte, Paulo; Brand-Gruwel, Saskia; Ritzen, Henk

    2018-01-01

    Abstract: In this case study, we explore the beliefs of teachers (AKA teachers) who work with at-risk students and consider using social media in their learning environment. We interviewed and observed a group of teachers who, as a project team, explored social media use in order to develop their

  9. 78 FR 16531 - Certain Electronic Devices for Capturing and Transmitting Images, and Components Thereof...

    Science.gov (United States)

    2013-03-15

    ... section 337. The Notice of Institution named as respondents Apple Inc. of Cupertino, California; High Tech Computer Corp. a/k/a HTC Corp. of Taoyuan, Taiwan; HTC America, Inc. of Bellevue, Washington; and Exedea, Inc. of Houston, Texas. On February 12, 2013, the ALJ issued the subject ID, terminating the...

  10. 76 FR 21628 - Implementation of Additional Changes From the Annual Review of the Entity List; Removal of Person...

    Science.gov (United States)

    2011-04-18

    ... listed entities located in Canada, Egypt, Germany, Hong Kong, Israel, Kuwait, Lebanon, Malaysia, South... Technology General Trading Company, a.k.a, Advanced Technologies Emirates FZ-LLC, Office 124 1st Floor.... Notwithstanding any other provision of law, no person is required to respond to nor be subject to a penalty for...

  11. Dermal uptake of benzophenone-3 from clothing

    DEFF Research Database (Denmark)

    Morrison, Glenn; Bekö, Gabriel; Weschler, Charles J.

    2017-01-01

    Benzophenone-3 (aka BP-3, oxybenzone) is added to sunscreens, plastics and some coatings to filter UV radiation. A suspected endocrine disruptor, BP-3 has been widely detected and ot only in summertime, where a more intended use of sunscreen might be expected in the urine of Danish children (Fred...

  12. The Case of the Druid Dracula: A Directed "Clicker" Case Study on DNA Fingerprinting

    Science.gov (United States)

    Brickman, Peggy

    2006-01-01

    This article describes how case studies have been successfully implemented in an introductory biology course of 300+ students using available technologies ranging from WebCT, used to assign students to permanent small groups (as well as assign groups to regions of a large lecture hall), to hand-held response systems (aka "clickers"), which…

  13. Using Priors to Compensate Geometrical Problems in Head-Mounted Eye Trackers

    DEFF Research Database (Denmark)

    Batista Narcizo, Fabricio; Ahmed, Zaheer; Hansen, Dan Witzner

    The use of additional information (a.k.a. priors) to help the eye tracking process is presented as an alternative to compensate classical geometrical problems in head-mounted eye trackers. Priors can be obtained from several distinct sources, such as: sensors to collect information related...... estimation specially for uncalibrated head-mounted setups....

  14. Case report

    African Journals Online (AJOL)

    ebutamanya

    2 oct. 2015 ... Retrospective analysis of basal cell carcinoma. Indian J. Dermatol Venereol Leprol. 2011;77(2):251. PubMed | Google. Scholar. 2. Gbery I, Djeha D, Yobouet P, Aka B, Kanga JM. Carcinome basocellulaire bilatéral de la face chez l'albinos africain de race noire. Les Nouvelles Dermatologiques. 1996 ...

  15. Exploring folate diversity in wild and primitive potatoes for modern crop improvement

    Science.gov (United States)

    Malnutrition is one of the world’s largest health concerns. Folate (a.k.a. vitamin B9) is essential in the human diet and without adequate folate intake several serious health concerns such as congenital birth defects and an increased risk of stroke and heart disease can occur. Most people’s folate ...

  16. A simple proof of the exactness of expanding maps of the interval with an indifferent fixed point

    International Nuclear Information System (INIS)

    Lenci, Marco

    2016-01-01

    Expanding maps with indifferent fixed points, a.k.a. intermittent maps, are popular models in nonlinear dynamics and infinite ergodic theory. We present a simple proof of the exactness of a wide class of expanding maps of [0, 1], with countably many surjective branches and a strongly neutral fixed point in 0.

  17. Regeneration in bottomland forest canopy gaps 6 years after variable retention harvests to enhance wildlife habitat

    Science.gov (United States)

    Daniel J. Twedt; Scott G. Somershoe

    2013-01-01

    To promote desired forest conditions that enhance wildlife habitat in bottomland forests, managers prescribed and implemented variable-retention harvest, a.k.a. wildlife forestry, in four stands on Tensas River National Wildlife Refuge, LA. These treatments created canopy openings (gaps) within which managers sought to regenerate shade-intolerant trees. Six years after...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 127 of 127 ... Vol 29, No 1 (2014), Short Term Comparative Analysis of Serum Electrolytes and Performance Characteristics of Castrated and Intact Red Sokoto Bucks, Abstract. MO Mamman, LO Aka, ... OB Balemba, LSB Mellau, RJ Assey, A Hay-Schmidt, WD Semuguruka, V Danyzer. Vol 25, No 2 (2008), The ...

  19. Assessing the Impact of Testing Aids on Post-Secondary Student Performance: A Meta-Analytic Investigation

    Science.gov (United States)

    Larwin, Karen H.; Gorman, Jennifer; Larwin, David A.

    2013-01-01

    Testing aids, including student-prepared testing aids (a.k.a., cheat sheets or crib notes) and open-textbook exams, are common practice in post-secondary assessment. There is a considerable amount of published research that discusses and investigates the impact of these testing aids. However, the findings of this research are contradictory and…

  20. 78 FR 78956 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2013-12-27

    ... & OFF), 1515 Kona Drive, Compton, CA 90220, Officers: Won Rok (aka Steve) Choi, CFO (QI), Myeong H. Kim..., El Monte, CA 91731, Officers: Lynn H. Tran, Secretary (QI), Zheng Feng, CFO, Application Type: New.... 25th Street, Suite 107D, Miami, FL 33182, Officers: Sergio I. Lotero, President (QI), Stephen A. Blass...

  1. 76 FR 10925 - Bio-Life Labs, Inc., BSI2000, Inc., Calais Resources, Inc., EGX Funds Transfer, Inc., Great...

    Science.gov (United States)

    2011-02-28

    ... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Bio-Life Labs, Inc., BSI2000, Inc., Calais Resources, Inc., EGX Funds Transfer, Inc., Great Western Land Recreation, Inc. (a/k/a Great Western Land and... securities of Bio-Life Labs, Inc. because it has not filed any periodic reports since the period ended March...

  2. 78 FR 58519 - Denial of Export Privileges; Sixing Liu

    Science.gov (United States)

    2013-09-24

    ... Powers Act (50 U.S.C. 1701, et seq. (2006 & Supp. IV 2010)). I have received notice of Liu's conviction... DEPARTMENT OF COMMERCE Bureau of Industry and Security Denial of Export Privileges; Sixing Liu In the Matter of: Sixing Liu, a/k/a Steve Liu, Inmate 43102-424, FCI Oxford, Federal Correctional...

  3. Risk Factors and Indications for Readmission Following Lower Extremity Amputation in the ACS-NSQIP

    Science.gov (United States)

    Curran, Thomas; Zhang, Jennifer Q.; Lo, Ruby C.; Fokkema, Margriet; McCallum, John C.; Buck, Dominique; Darling, Jeremy; Schermerhorn, Marc L.

    2014-01-01

    BACKGROUND Postoperative readmission, recently identified as a marker of hospital quality in the Affordable Care Act, is associated with increased morbidity, mortality and healthcare costs, yet data on readmission following lower extremity amputation is limited. We evaluated risk factors for readmission and post-discharge adverse events following lower extremity amputation in the ACS-NSQIP. STUDY DESIGN All patients undergoing transmetatarsal (TMA), below-knee (BKA) or above-knee amputation (AKA) in the 2011 – 2012 NSQIP were identified. Independent pre-discharge predictors of 30-day readmission were determined using multivariable logistic regression. Readmission indication and re-interventions, available in the 2012 NSQIP only, were also evaluated. RESULTS We identified 5,732 patients undergoing amputation (TMA: 12%; BKA: 51%; AKA: 37%). Readmission rate was 18%. Post-discharge mortality rate was 5% (TMA: 2%; BKA: 3%; AKA: 8%; preadmission included chronic nursing home residence (OR: 1.3; 95% CI: 1.0–1.7), non-elective surgery (OR: 1.4; 95% CI: 1.1–1.7), prior revascularization/amputation (OR: 1.4; 95% CI: 1.1–1.7), preoperative congestive heart failure (OR: 1.7; 95% CI: 1.2–2.4), and preoperative dialysis (OR: 1.5; 95% CI: 1.2–1.9). Guillotine amputation (OR: .6; 95%CI: .4–.9) and non-home discharge (OR: .7; 95%CI: .6–1.0) were protective of readmission. Wound related complications accounted for 49% of readmissions. CONCLUSIONS Post discharge morbidity, mortality and readmission are common following lower extremity amputation. Closer follow up of high risk patients, optimization of medical comorbidities and aggressive management of wound infection may play a role in decreasing readmission and post discharge adverse events. PMID:24985536

  4. A Survey of Public Key Infrastructure-Based Security for Mobile Communication Systems

    Directory of Open Access Journals (Sweden)

    Mohammed Ramadan

    2016-08-01

    Full Text Available Mobile communication security techniques are employed to guard the communication between the network entities. Mobile communication cellular systems have become one of the most important communication systems in recent times and are used by millions of people around the world. Since the 1990s, considerable efforts have been taken to improve both the communication and security features of the mobile communications systems. However, these improvements divide the mobile communications field into different generations according to the communication and security techniques such as A3, A5 and A8 algorithms for 2G-GSM cellular system, 3G-authentication and key agreement (AKA, evolved packet system-authentication and key agreement (EPS-AKA, and long term evolution-authentication and key agreement (LTE-AKA algorithms for 3rd generation partnership project (3GPP systems. Furthermore, these generations have many vulnerabilities, and huge security work is involved to solve such problems. Some of them are in the field of the public key cryptography (PKC which requires a high computational cost and more network flexibility to be achieved. As such, the public key infrastructure (PKI is more compatible with the modern generations due to the superior communications features. This paper surveys the latest proposed works on the security of GSM, CDMA, and LTE cellular systems using PKI. Firstly, we present the security issues for each generation of mobile communication systems, then we study and analyze the latest proposed schemes and give some comparisons. Finally, we introduce some new directions for the future scope. This paper classifies the mobile communication security schemes according to the techniques used for each cellular system and covers some of the PKI-based security techniques such as authentication, key agreement, and privacy preserving.

  5. Healthcare.gov: Opportunity out of Disaster. Teaching Case

    Science.gov (United States)

    Cundiff, Jacob; McCallum, Taylor; Rich, Andrew; Truax, Michael; Ward, Tamara; Havelka, Douglas

    2015-01-01

    The launch of HealthCare.gov, the website of the Affordable Care Act (AKA Obamacare), was a major public relations disaster for the Obama administration. This case examines some of the factors that contributed to the failure of the launch and then details how Optum, an information technology service provider, considered the opportunity provided by…

  6. Grand-Bassam

    African Journals Online (AJOL)

    Geo

    l'estuaire du fleuve Comoé (Grand-Bassam, Côte d'Ivoire). Kouassi Laurent ADOPO1*, Apie Colette AKOBE1, Etche Mireille AMANI2,. Sylvain MONDE3 et Kouamé AKA3. (1)Laboratoire de Géologie Marine, Sédimentologie et Environnement, Centre de Recherche en Ecologie,. Université Felix Houphouet Boigny Abidjan, ...

  7. Laurel wilt, caused by Raffaelea lauricola , is detected for the first time outside the southeastern United States

    Science.gov (United States)

    R. C. Ploetz; Y. Y. Thant; M. A. Hughes; T. J. Dreaden; J. L. Konkol; A. T. Kyaw; J. A. Smith; C. L. Harmon

    2016-01-01

    In October 2014, a survey for diseases and pests of an emerging fruit crop, avocado (Persea americana) (FAO 2000), was conducted in Southern Shan State of Myanmar (aka Burma). In the Tuanggyi District (1,400 m elevation, 20.5°N 97°E), monocultures of up to 20 ha were observed, whereas...

  8. The VLT-FLAMES Tarantula Survey. IX. The interstellar medium seen through diffuse interstellar bands and neutral sodium

    NARCIS (Netherlands)

    van Loon, J.Th.; Bailey, M.; Tatton, B.L.; Maíz Apellániz, J.; Crowther, P.A.; de Koter, A.; Evans, C.J.; Hénault-Brunet, V.; Howarth, I.D.; Richter, P.; Sana, H.; Simón-Díaz, S.; Taylor, W.; Walborn, N.R.

    2013-01-01

    Context. The Tarantula Nebula (a.k.a. 30 Dor) is a spectacular star-forming region in the Large Magellanic Cloud (LMC), seen through gas in the Galactic disc and halo. Diffuse interstellar bands (DIBs) offer a unique probe of the diffuse, cool-warm gas in these regions. Aims. The aim is to use DIBs

  9. 77 FR 31483 - Airworthiness Directives; Gulfstream Aerospace Corporation Airplanes

    Science.gov (United States)

    2012-05-29

    ... Service Change (ASC) 229 and G-1159 (aka G-II) ASC 426 installs a new three-piece box fitting on the left... result of an improper structural modification. This records search also revealed that six other Model G... similar nonconforming condition was found on a total of six airplanes. Of those, one airplane does not...

  10. 78 FR 1248 - Certain Computing Devices With Associated Instruction Sets and Software; Notice of Commission...

    Science.gov (United States)

    2013-01-08

    ..., 24 and 28-30 of U.S. Patent No. 7,155,598. The notice of institution named as respondent Apple Inc., a/k/a Apple Computer, Inc. of Cupertino, California (``Apple''). On November 19, 2012, VIA and Apple... on behalf of VIA Technologies, Inc. of New Taipei City, Taiwan; IP-First, LLC of Fremont, California...

  11. Alois Philipp Maria. Maksuparadiisi söakas troonipärija / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    Liechtensteini prints Alois Philipp Maria andis vastulöögi Saksamaa süüdistusele. Väideti, et Liechtensteinis ei peeta läbipaistvusest ja seadusega kooskõlas olemisest lugu. Prints Alois Philipp Maria. Kaart: Maksuparadiisid

  12. Science in a Team Environment (AKA, How to Play Nicely with Others)

    Science.gov (United States)

    Platts, S. H.; Primeaux, L.; Swarmer, T.; Yarbough, P. O

    2017-01-01

    So you want to do NASA funded research in a spaceflight analog? There are several things about participating in an HRP managed analog that may be different from the way you normally do work in your laboratory. The purpose of this presentation is to highlight those differences and explain some of the unique aspects of doing this research. Participation in an HRP funded analog study complement, even if initially selected for funding, is not automatic and involves numerous actions from ISSMP, HRP, and the PI. There are steps that have to be taken and processes to follow before approval and ISSMP-FA integration. After the proposal and acceptance process the Investigator works closely with the Flight Analog team to ensure full integration of their study requirements into a compliment. A complement is comprised of a group of studies requiring a common platform and/or scenario that are able to be integrated on a non-interference basis for implementation. Full integration into the analog platform can be broken down into three phases: integration, preparation, and implementation. These phases occur in order with some overlap in the integration and preparation phase. The ISSMP-FA team integrates, plans and implements analog study complements. Properly defining your research requirements and getting them documented is one of the most critical components to ensure successful integration and implementation of your study, but is also one of the most likely to be neglected by PIs. Requirements that are not documented, or that are documented poorly are unlikely to get done, no matter how much you push. The process to document requirements is two-fold, consisting of an initial individual requirements integration and then a compliment requirements integration. Understanding the requirements in detail and early ensures that the science is not compromised by outside influences. This step is vital to the integration, preparation, and implementation phases. The individual requirements integration is the first step in ensuring that the research fits into an available analog platform or allows for the Flight Analog team to provide information on structural study changes for participation in the analog. At this early point investigators need to understand exactly what their requirements are to produce relevant data and convey their must have needs to the Flight Analog team. The fluid nature of analog platforms allow for minor alterations to the operational structure. Participation in analog research requires flexibility from the investigator to ensure implementation of their research into a flight like analog platform. The compliment integration requires plasticity; investigators are asked to work closely with one another and the Flight Analog team to combine research studies into a single study plan. This study plan's ultimate goal is to facilitate multiple study participation with minimal scientific impact to each individual study. The Flight Analogs team works to find the best compromise for all parties while protecting the flight like atmosphere of a particular analog. Additional restrictions, limitations and constraints may be required by the analog in order to make all of the science work. Many studies need to be combined into each complement and there are a limited number of hours available for data collection. Through data/sample sharing, we can reduce the burden on the test subject, while usually avoiding significant science impacts. Restrictions on food, exercise, medications and sleep cycle are important to consider for your research.

  13. A Peculiar Subclass of Type Ia Supernovae a.k.a. Type Iax

    Science.gov (United States)

    Singh, Mridweeka; Misra, Kuntal; Sahu, Devendra Kumar; Dastidar, Raya; Gangopadhyay, Anjasha; Bose, Subhash; Srivastav, Shubham; Anapuma, Gadiyara Chakrapani; Chakradhari, Nand Kumar; Kumar, Brajesh; Kumar, Brijesh; Pandey, Shashi Bhushan

    2018-04-01

    We present optical photometric (upto ˜ 410 days since Bmax) and spectroscopic (upto ˜ 235 days since Bmax) observations of a type Iax supernova SN 2014dt located in M61. The broad band light curves follow a linear decline up to ˜ 100 days after which a significant flattening is seen in the late-time (beyond 150 days) light curves of SN 2014dt. SN 2014dt best matches the light curve evolution of SN 2005hk and reaches a peak magnitude of MB˜ -18.12±0.04 with ?m15˜ 1.35±0.06 mag. The earliest spectrum at ˜ 23 days is dominated by FeII and CoII lines with the absence of the Si II 6150 Å line. Using the peak bolometric luminosity we estimate a 56Ni mass of 0.14 M⊙ in the case of SN 2005hk and the striking similarity between SN 2014dt and SN 2005hk implies that a comparable amount of 56Ni would have been synthesized in the explosion of SN 2014dt. There are several explosion scenarios proposed for these peculiar events. Being one of the brightest and closest SN! , SN 2014dt is an ideal candidate for long term monitoring. Late phase observations are very essential to understand the progenitor system and the actual explosion scenario for these events.

  14. Age-dependent transition from cell-level to population-level control in murine intestinal homeostasis revealed by coalescence analysis.

    Directory of Open Access Journals (Sweden)

    Zheng Hu

    Full Text Available In multi-cellular organisms, tissue homeostasis is maintained by an exquisite balance between stem cell proliferation and differentiation. This equilibrium can be achieved either at the single cell level (a.k.a. cell asymmetry, where stem cells follow strict asymmetric divisions, or the population level (a.k.a. population asymmetry, where gains and losses in individual stem cell lineages are randomly distributed, but the net effect is homeostasis. In the mature mouse intestinal crypt, previous evidence has revealed a pattern of population asymmetry through predominantly symmetric divisions of stem cells. In this work, using population genetic theory together with previously published crypt single-cell data obtained at different mouse life stages, we reveal a strikingly dynamic pattern of stem cell homeostatic control. We find that single-cell asymmetric divisions are gradually replaced by stochastic population-level asymmetry as the mouse matures to adulthood. This lifelong process has important developmental and evolutionary implications in understanding how adult tissues maintain their homeostasis integrating the trade-off between intrinsic and extrinsic regulations.

  15. Reusing Information Management Services for Recommended Decadal Study Missions to Facilitate Aerosol and Cloud Studies

    Science.gov (United States)

    Kempler, Steve; Alcott, Gary; Lynnes, Chris; Leptoukh, Greg; Vollmer, Bruce; Berrick, Steve

    2008-01-01

    NASA Earth Sciences Division (ESD) has made great investments in the development and maintenance of data management systems and information technologies, to maximize the use of NASA generated Earth science data. With information management system infrastructure in place, mature and operational, very small delta costs are required to fully support data archival, processing, and data support services required by the recommended Decadal Study missions. This presentation describes the services and capabilities of the Goddard Space Flight Center (GSFC) Earth Sciences Data and Information Services Center (GES DISC) and the reusability for these future missions. The GES DISC has developed a series of modular, reusable data management components currently in use. They include data archive and distribution (Simple, Scalable, Script-based, Science [S4] Product Archive aka S4PA), data processing (S4 Processor for Measurements aka S4PM), data search (Mirador), data browse, visualization, and analysis (Giovanni), and data mining services. Information management system components are based on atmospheric scientist inputs. Large development and maintenance cost savings can be realized through their reuse in future missions.

  16. 377 Konan et al., Afr J Tradit Complement Altern Med. (2011) 8(4 ...

    African Journals Online (AJOL)

    AJTCAM

    aurantifolia (Rutaceae) sur le muscle lisse, Taenia coli de cobaye. Rev. Med. Pharm. Afr. 16: 103-112. 35. Souza, A., Aka, K.J., Abo, K.J.C., Datté, Y.J., Traoré, F. and M'Batchi, B. (2007). Myostimulating effect of the aqueous extract of Khaya senegalensis (Desr) A. Juss (Meliaceae) in isolated Taenia caeci contractile activity.

  17. Pop nädal : popuudised. Värsket filmimuusikat. MTV Euroopa TOP 20 8. aprill 2002 edetabel / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Pet Shop Boysi uuest singlist "Home and Dry" albumilt "Release". 3. aprillil suri elektroonilise muusika pioneer Frank Tovey aka Fad Gadget. Industriali lipulaev KMFDM on tühistanud oma peatselt algama pidanud Euroopa turnee. Alison Moyet' uuest albumist "Hometime". Shockrockar Marilyn Manson osaleb filmis Party Monster.Filmimuusika heliplaatidest "Treeningpäev/ Training Day" ja "Long Time Dead"

  18. Theoretical Studies of Small-System Thermodynamics in Energetic Materials

    Science.gov (United States)

    2016-01-06

    SECURITY CLASSIFICATION OF: This is a comprehensive theoretical research program to investigate the fundamental principles of small-system thermodynamics ...a.k.a. nanothermodynamics). The proposed work is motivated by our desire to better understand the fundamental dynamics and thermodynamics of...for Public Release; Distribution Unlimited Final Report: Theoretical Studies of Small-System Thermodynamics in Energetic Materials The views, opinions

  19. Bringing Exoplanet Habitability Investigations to High School

    Science.gov (United States)

    Woody, Mary Anne; Sohl, Linda

    2016-01-01

    Habitability, a.k.a. habitat suitability, is a topic typically discussed in Biology class. We present here a curriculum unit that introduces the topic of global-scale planetary habitability in a Physics classroom, allowing students to emulate the process of doing cutting-edge science and re-framing an otherwise "typical" physics unit in a more engaging and interactive way.

  20. Sports Drove Silva to Teach Wellness

    Science.gov (United States)

    Deschenie, Tina

    2008-01-01

    This article profiles teacher Leroy Silva (Laguna), 27, a.k.a. "Buster". Silva describes himself as an active guy who stays busy working out, playing basketball, softball, and more recently golf, soccer, and lacrosse. He teaches personal wellness and sports (not physical education), a job he began in 2006. Before that he was a trainer at…

  1. 75 FR 34630 - Iranian Transactions Regulations

    Science.gov (United States)

    2010-06-18

    ...] KALA LIMITED (a.k.a. KALA NAFT LONDON LTD), NIOC House, 4 Victoria Street, Westminster, London SW1H 0NE... TRUST LIMITED, C/O Kala Limited, N.I.O.C. House, 4 Victoria Street, London SW1H 0NE, United Kingdom; UK..., Switzerland; all offices worldwide [IRAN] NAFTIRAN TRADING SERVICES CO. (NTS) LIMITED, 47 Queen Anne Street...

  2. Analyzing and Specifying Reusable Security Requirements

    Science.gov (United States)

    2003-09-01

    avionics applications and ecommerce applications need to specify levels of identification, authentication, authorization, integrity, privacy , etc. At...sections specifying functional requirements. Thus, the functional requirements for an embedded avionics application and an ecommerce website may have... Privacy (a.k.a., confidentiality), which is the degree to which sensitive data and communications are kept private from unauthorized individuals and

  3. Author Details

    African Journals Online (AJOL)

    Any-Grah-Aka, S. Vol 18, No 4 (2016): Series B, D, E - Articles Faisabilite de comprimes effervescents a base d'amidon natif d'igname et d'acide acetylsalicylique. Abstract · Vol 19, No 1 (2017) - Articles Formulation de microparticules et de gelules a base de Sida acuta (Malvaceae) par spray drying. Abstract. ISSN: 2413- ...

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 283 ... Vol 4, No 2 (2004), Rare Gases in mantle-derived rocks from Annobon Island: Preliminary step-heating helium results, Abstract PDF. FT Aka, M Kusakabe, K Nagao, G Tanyileke, J Nnange, N Nfomou. Vol 4, No 2 (2004), Rétention de Escherichia coli d'un eau d'infiltration en sol équatorial au ...

  5. Author Details

    African Journals Online (AJOL)

    Aka, FT. Vol 4, No 2 (2004) - Articles Rare Gases in mantle-derived rocks from Annobon Island: Preliminary step-heating helium results. Abstract PDF · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...

  6. I'm a Map, I'm a Green Tree

    Science.gov (United States)

    Anderson, Daniel

    2010-01-01

    I'm talking about the ways we represent ourselves and our world. I've put some thoughts on the topic together here--a gathering that enacts new media creating and takes up conceptual layers like metaphors, models, and composing. The primary sources are videos from the Get a Mac campaign, aka I'm a Mac; I'm a PC ads. Posthuman concepts blending…

  7. CapDEM Exercise Gamma: Results and Discussion

    Science.gov (United States)

    2011-06-01

    d’ingénierie global pourrait donc être touché lui aussi, soit positivement , soit négativement. Intégrer l’expertise sur l’EnvIC dans l’EIC. La présence...deliverables to have had more substance to them (i.e., quantitative results, aka “meat”). 4.2.2.5 Knowledge Issues in terms of knowledge within

  8. African Journal of Neurological Sciences - Vol 26, No 2 (2007)

    African Journals Online (AJOL)

    Interêt de l\\'electroencephalogramme(EEG) dans le diagnostic de la Maladie de Creutzfeldt-Jakob (MCJ) en Afrique. Description de trois cas en Côte D\\'Ivoire. E Aka-Diarre, T Sonan-Douayoua, B Assi, A-E Kouame-Assouan, M Doumbia, A-M Datie, F Boa Yapo, EB Kouassi. http://dx.doi.org/10.4314/ajns.v26i2.7600 ...

  9. 75 FR 7358 - Addition of Certain Persons to the Entity List: Addition of Persons Acting Contrary to the...

    Science.gov (United States)

    2010-02-19

    ... Company Ltd., 13/F, Number 181, Sec 1, Datong Rd., Sijhih City, Taipei, Taiwan; and (4) Yi-Lan Chen, a.k.a., Kevin Chen, 13/F, Number 181, Sec 1, Datong Rd., Sijhih City, Taipei, Taiwan, and 7th Floor, Number 17... the requirements of the Paperwork Reduction Act of 1995 (44 U.S.C. 3501 et seq.) (PRA), unless that...

  10. Deleting Both PHLPP1 and CANP1 Rescues Impairments in Long-Term Potentiation and Learning in Both Single Knockout Mice

    Science.gov (United States)

    Liu, Yan; Sun, Jiandong; Wang, Yubin; Lopez, Dulce; Tran, Jennifer; Bi, Xiaoning; Baudry, Michel

    2016-01-01

    Calpain-1 (CANP1) has been shown to play a critical role in synaptic plasticity and learning and memory, as its deletion in mice results in impairment in theta-burst stimulation (TBS)-induced LTP and various forms of learning and memory. Likewise, PHLPP1 (aka SCOP) has also been found to participate in learning and memory, as PHLPP1 overexpression…

  11. Analiza tačnosti visina bosanskohercegovačke trigonometrijske mreže pomoću GPS/EGM podataka : Accuracy analyses of B&H trigonometric network heights by GPS/EGM data

    Directory of Open Access Journals (Sweden)

    Medžida Mulić

    2012-06-01

    Full Text Available Dostupnost savremenih globalnih geoidnih modela kao i 3D koordinata u globalnom koordinatnom referentnom sistemu omogućava anlazu tačnosti ortometrijskih visina trionometrijske mreže. Rad pokazuje preliminarne rezultate analize tačnosti visina trigonometrijske mreže u Bosni i Hercegovini, a na osnovu usporedbe visina izračunatih korištenjem GPS visina i EGM geoidnih modela. Preliminarni rezultati ukazuju na postojanje grubih pogrešaka u visinama trigonometrijskih tačaka BiH trigonometrijske mreže. : Analysis of the accuracy of the orthometric heights of the old trigonometric points are posible since the global accurate models of geoid as well as 3D coordinates in the global coordinate system became available. Preliminary results of the heights accuracy analyze in the old trigonometric network in the in Bosnia and Herzegovina are shown in this paper. The analyze has done by comparing the orthometric heights calculated using by GPS height and the modern global geoid models EGM, with the old official heights of trigonometric points. The results indicate the existence of blunders among the heights in the old trigonometric network of Bosnia and Herzegovina.

  12. I Am Science - and So Can You!

    Energy Technology Data Exchange (ETDEWEB)

    DiChristina, Mariette [Scientific American

    2013-05-08

    Science is humanity’s best invention for getting at the truth about how things work (a.k.a. “basic research”) and solving problems (“applied”). I can even make a claim that most people are interested in science topics—they just don’t think of them as “science.” Consider how many of today’s top headlines have a critical science underpinning: energy supply, social change from digital innovations, efforts to treat cancer and other diseases, emerging infectious agents like bird flu, climate change, and so on. Clearly, a basic understanding about science is more vital than ever. At the same time, we see two trends: the collapse of traditional science journalism jobs as newspapers have cut thousands of positions and a greater access to—and a larger readership for—science-related materials than the world has ever known. Put another way, just when the public needs the Fourth Estate most, it’s instead drowning in a sea of 24/7 misinformation (a.k.a. “the Internet”). What’s a busy scientist to do to help engage the lay public? Glad you asked.

  13. High efficiency environmental sampling with UV-cured peelable coatings (aka NuGoo project)

    Energy Technology Data Exchange (ETDEWEB)

    Henzl, Vladimir [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Junghans, Sylvia Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lakis, Rollin Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-11-21

    This report presents slides on CA Related Project (FY13-17); Environmental sampling by IAEA (not only) during CA; Decontamination gels; Cotton swipes vs. decon gel (FY15); Contamination removal study; The origins of the NuGoo; NuGoo – proof of concept; NuGoo – FY17 project ($250K); LED lamp – which one works and why; Selecting photoinitiator; Monomers and oligomers; Results.

  14. Switch-attention (aka switch-reference in South-American temporal clauses: facilitating oral transmission

    Directory of Open Access Journals (Sweden)

    Rik van Gijn

    2012-01-01

    Full Text Available Cultures without a written tradition depend entirely on the oral channel to transmit sometimes highly complex information. It is therefore not surprising that in the languages of such cultures linguistic devices evolve that enhance textual coherence, and thus comprehension. These devices should ideally also be economical in terms of morphosyntactic complexity in order to facilitate both production and comprehension. In this paper, I will argue that switch-attention (a term preferred over the traditional switch-reference systems in temporal clauses fulfill these requirements of cohesion and complexity reduction, making them particularly apt for orally transmitting texts. Moreover, switch-reference systems seem to diffuse relatively easily. These features taken together are suggested to be (partly responsible for the widely attested phenomenon in areas without a lengthy written tradition.

  15. Rectifiable PT -symmetric Quantum Toboggans with Two Branch Points

    Directory of Open Access Journals (Sweden)

    M. Znojil

    2010-01-01

    Full Text Available Certain complex-contour (a.k.a. quantum-toboggan generalizations of Schroedinger’s bound-state problem are reviewed and studied in detail. Our key message is that the practical numerical solution of these atypical eigenvalue problems may perceivably be facilitated via an appropriate complex change of variables which maps their multi-sheeted complex domain of definition to a suitable single-sheeted complex plane.

  16. Multi-Element Free-Space Optical (FSO) Modules for Mobile-Opportunistic Networking

    Science.gov (United States)

    2016-11-14

    due to license-free spectrum, containment of beams, inherent security, energy efficient communications, and high transmission rates. We leveraged the... wireless spectrum bands in both military and civilian settings. Recent research has shown that free- space-optical (FSO), a.k.a. optical wireless ...communications is a promising complementary approach to address the exploding mobile wireless traffic demand. The major impediment for using FSO in a

  17. The use of high technology in STEM education

    Science.gov (United States)

    Lakshminarayanan, Vasudevan; McBride, Annette C.

    2015-10-01

    There has been a huge increase in the use of high technology in education. In this paper we discuss some aspects of technology that have major applications in STEM education, namely, (a) virtual reality systems, (b) personal electronic response systems aka "clickers", (c) flipped classrooms, (d) mobile learning "m-Learning", (e) massive open online courses "MOOCS", (f) internet-of-things and (g) cloud computing.

  18. Signal Processing, Pattern Formation and Adaptation in Neural Oscillators

    Science.gov (United States)

    2016-11-29

    rhythmic patterns. As such, our models are appropriate for describing various phenomena in the auditory system, including critical nonlinear...several distinct intrinsic behaviors available near a Hopf bifurcation or a Bautin (a.k.a. double limit cycle) bifurcation. Stability analysis shows...example the perception of pitch at event timescales (Meddis & O’Mard, 2006) and the perception of pulse and meter at rhythmic timescales (Large

  19. Untitled

    Indian Academy of Sciences (India)

    ****88 . . . . .2%-4s & six-as '... aka-sang-wo. a. s. X is cyl-...4. w- was relaxa. Ratio Alcohol- Alcohol- Alcohol-. Substratic Substrate: DMSO DMF Alcohol Aceto-. Base nitrile sportswww.x. 2,4-Dinitro-l-chloro benzene : 3 23.86 1748 1448 903. 2,4-Dinitro-1-bromo benzene : 3 32. 3 25. 47 24.69 4.72. 2,4-Dinitro-li-iodo benzene ...

  20. Gingival and Periodontal Diseases in Children and Adolescents

    OpenAIRE

    Vivek Singh Chauhan; Rashmi Singh Chauhan; Nihal Devkar; Akshay Vibhute; Shobha More

    2012-01-01

    Periodontal diseases are among the most frequent diseases affecting children and adolescents. These include gingivitis, localized or generalized aggressive periodontitis (a.k.a., early onset periodontitis) and periodontal diseases associated with systemic disorders. The effects of periodontal diseases observed in adults have earlier inception in life period. Gingival diseases in a child may progress to jeopardize the periodontium in adulthood. Therefore, periodontal diseases must be prevented...

  1. 77 FR 71097 - Addition of Certain Persons to the Entity List

    Science.gov (United States)

    2012-11-29

    ... Trading FZE, P.O Box 10559, Ras Al Khaimah, U.A.E.; and Ras Al Khaimah Free Trade Zone (RAKFTZ), U.A.E..., the Emirati entity, Infotec, a.k.a., Info Tech, Ras Al Khaimah Free Trade Zone (RAKFTZ), U.A.E. The... EAR. (See Sec. 77 FR [INSERT FR --I. Tec Trading FZE, 744.11 of the PAGE NUMBER] P.O. Box 10559, Ras...

  2. Analysis and Verification of a Key Agreement Protocol over Cloud Computing Using Scyther Tool

    OpenAIRE

    Hazem A Elbaz

    2015-01-01

    The mostly cloud computing authentication mechanisms use public key infrastructure (PKI). Hierarchical Identity Based Cryptography (HIBC) has several advantages that sound well align with the demands of cloud computing. The main objectives of cloud computing authentication protocols are security and efficiency. In this paper, we clarify Hierarchical Identity Based Authentication Key Agreement (HIB-AKA) protocol, providing lightweight key management approach for cloud computing users. Then, we...

  3. Digital Rights Management Sebagai Solusi Keamanan Dokumen Elektronik

    OpenAIRE

    Kurniawan, Agus

    2008-01-01

    Perkembangan dokumen elektronik yang pesat dan mudah diakses berdampak semakin sulitnya dalam membatasi informasi ketika ingin membatasi akses terhadap informasi pada dokumen elektronik. Oleh karena itu, diperlukan mekanisme untuk menjaga informasi pada dokumen elektronik hanya dapat diakses oleh yang berhak dan tersimpan dengan aman. Pendekatan solusi dapat menerapkan Digital Rights Management pada dokumen elektronik sehingga pemilik dokumen elektronik aka lebih aman menyimpannya ataupun mel...

  4. INTEGRAL detects an X-ray burst from SAX J1747.0-2853 with no detectable persistent emission

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Brandt, Søren Kristian; Kuulkers, Erik

    2009-01-01

    A new season of observations for the INTEGRAL Galactic Bulge monitoring (see ATel #438) has started on 2009 Feb. 21st. During the latest observation between 2009 Feb 25 13:21 and 17:02 (UT) a type I X-ray burst from SAX J1747.0-2853 (1A 1743-288, aka GX .2-0.2) was detected by JEM-X at UT 14:50:5...

  5. DIAGNOSTIC VALUE OF SEROLOGICAL MARKERS OF RHEUMATOID ARTHRITIS

    Directory of Open Access Journals (Sweden)

    Aleksei Leonidovich Maslaynski

    2012-01-01

    Full Text Available Rheumatoid arthritis (RA is a classic autoimmune disease associated with the production of wide range of autoantibodies, and their detection has diagnostic and prognostic implication. The objective of this study was to estimate the diagnostic value of antibodies against modified citrullinated vimentin (AMCV and nuclear antigen RA33 of the IgA rheumatoid factor (RF versus the value of routinely used profile of autoantibodies in diagnostic work-up of RA. Material and methods. 253 patients with RA prehistory of varying duration were included into the study group. The control group was comprised of 92 patients, including patients with seronegative spondyloarthropathies and diffuse connective tissue diseases, as well as sex and age matched healthy controls. Serum levels of IgM and IgA RF, antibodies against cyclic citrullinated peptide (ACCP, ACMV, anti-keratin antibodies (AKA, antibodies against RA33 antigen (ARA33 and antinuclear factor (ANF were measured in all patients and controls. Results and discussion. Diagnostic sensitivity of AMCV equaled 78%, ACCP — 77%, IgM RF — 71%, IgA RF — 43%, AKA — 43%, ARA33 — 31% and ANF — 31%. All anti-citrullinic antibodies (AKA, ACCP, ACMV were significantly more commonly associated with IgM RF. Among RF and ACCP seronegative patients ACMV were found in 24% cases with 20 IU/Ml detection threshold, and in 21% — with 30 IU/Ml, allowing to increase diagnostic specificity of the test up to 91% with the increment of diagnostic threshold. Incidence of ARA33 was not significantly different among the RF and ACCP positive or negative subgroups, thus making ARA33 an independent RA marker. Specificity of this marker was 87,9%, thus making it inferior to RF and ACCP by a composite of diagnostic characteristics. Conclusions. Integrated measurement of ACMV and ARA33 is a rational approach at the second stage of serologic testing work-up in suspected cases of RA onset, when initial RF and ACCP tests were negative.

  6. Opioid-Induced Hyperalgesia - Worsening Pain in Opioid-Dependent Patients

    Science.gov (United States)

    2013-02-01

    NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) United States Army Institute ofSurgical Research, JBSA Fort Sam Houston...distress and manifested no yawning, sweating, lacrimation , rhinorrhea, mydriasis, or piloerection. His abdomen was soft, nontender, and had a... functioning left lower quadrant colostomy with no signs of infection. He had bilateral AKAs without signs of infection. The remainder of the examination was

  7. Long-term training modifies the modular structure and organization of walking balance control

    OpenAIRE

    Sawers, Andrew; Allen, Jessica L.; Ting, Lena H.

    2015-01-01

    How does long-term training affect the neural control of movements? Here we tested the hypothesis that long-term training leading to skilled motor performance alters muscle coordination during challenging, as well as nominal everyday motor behaviors. Using motor module (a.k.a., muscle synergy) analyses, we identified differences in muscle coordination patterns between professionally trained ballet dancers (experts) and untrained novices that accompanied differences in walking balance proficie...

  8. Ratna propaganda

    OpenAIRE

    Šiber, Ivan

    1992-01-01

    U ovome radu izlažu se pojam i vrste ratne propagande, njeni ciljevi i osnovni principi. Na osnovi literature, sustavno se iznose temeljne postavke tzv. nacističke propagande, kako uoči rata (propagandna aktivnost prema AAD) tako i za vrijeme rata, uz prikaz Gobbelsovih propagandnih "zabilježaka s radnog stola", te se ukazuje i na aktualnost i primjenjivost nekih od tih propagandnih postavki i u suvremenim uvjetima.

  9. Ultra-High Efficiency / Low Hydrogen Embrittlement Nanostructured Zn-Based Electrodeposits as Environmentally Benign Cd-Replacement Coatings for High Strength Steel Fasteners

    Science.gov (United States)

    2011-04-01

    sample production for the testing of hydrogen re-embrittlement ( HRE ) (a.k.a. in-service embrittlement); (4) further optimization of plating conditions...Ni range. This could help explain the HRE performance as a nickel concentration of 15wt.% had an OCP close to that of Cd and steel, which would...ZnNi plating, including superior corrosion protection and improved HRE performance as a result of the dense fine grained microstructure. Furthermore

  10. La dimora di Ahreman. La guerra e le origini del dualismo iranico

    Directory of Open Access Journals (Sweden)

    Ezio Albrile

    2005-01-01

    Full Text Available In the article the development of Iranian dualistic tradition is analyzed, with special regard to the Zurvanite problem and the beginning of “Iranian Gnosis” a.k.a. Manichaeism. Precedings of these Gnostic speculations may also be found in notables of ancient Greek dualistic myth and thought as Aristeas of Proconnesus and his tales about the struggle of Arimaspoi against the Gryphons.

  11. Transformation and Self-Similarity Properties of Gamma and Weibull Fragment Size Distributions

    Science.gov (United States)

    2015-12-01

    the spatial dimension ( 31 m ). For classic aerosols with nearly-spherical droplets, 3m and 6/s . Alternatively, Wittel et. al. (2006...which come from the definitions of )(DFM , )(MFM , )(DF , and )(MF . The fourth transformation equation is as follows: )(~)( DfDDf mM... dimension defined by Equation (2), )(x is the gamma function, and ),( xs is the upper incomplete gamma function. Table 1a. Rosin-Rammler (a.k.a

  12. A Lightweight AV System for Providing a Faithful and Spatially Manipulable Visual Hand Representation

    OpenAIRE

    Pusch , Andreas; Martin , Olivier; Coquillart , Sabine

    2011-01-01

    Session: Developing new tools and technologies - Abstracts to be published in a regular issue of the journal Cyberpsychology, Behavior and Social Networking (indexed in MedLine and PsychInfo): http://online.liebertpub.com/loi/CYBER; International audience; This paper introduces the technical foundations of a system designed to embed a lightweight, faithful and spatially manipulable representation of the user's hand into an otherwise virtual world (aka Augmented Virtuality, AV). A highly intui...

  13. Congenital Primary Pachydermoperiostosis and Striate Palmoplantar Keratoderma - a Case Report

    OpenAIRE

    Stojanović Slobodan; Vučković Nada; Jovanović Marina; Petrović Kosta

    2014-01-01

    Uvod. Pahidermoperiostoza (PDP) predstavlja heterogeni sindrom za koji su karakteristične hipertrofi čne promene prvenstveno kože i kostiju ekstremiteta: pahidermija, klabing (clubbing) prstiju šaka i stopala i hipertrofi čna osteoartropatija. Primarna pahidermoperiostoza − sinonim Turen−Solent−Goleov sindrom (Touraine-Solente-Golé) (PPDP), ili primarna hipertrofi čna osteoartropatija (PHO), redak je nasledni poremećaj i predstavlja jedan od dva tipa hipertrofi čne osteoartropatije....

  14. Congenital Primary Pachydermoperiostosis and Striate Palmoplantar Keratoderma - a Case Report

    Directory of Open Access Journals (Sweden)

    Stojanović Slobodan

    2014-06-01

    Full Text Available Uvod. Pahidermoperiostoza (PDP predstavlja heterogeni sindrom za koji su karakteristične hipertrofi čne promene prvenstveno kože i kostiju ekstremiteta: pahidermija, klabing (clubbing prstiju šaka i stopala i hipertrofi čna osteoartropatija. Primarna pahidermoperiostoza − sinonim Turen−Solent−Goleov sindrom (Touraine-Solente-Golé (PPDP, ili primarna hipertrofi čna osteoartropatija (PHO, redak je nasledni poremećaj i predstavlja jedan od dva tipa hipertrofi čne osteoartropatije.

  15. Bayesian Networks for Modeling Dredging Decisions

    Science.gov (United States)

    2011-10-01

    years, that algorithms have been developed to solve these problems efficiently. Most modern Bayesian network software uses junction tree (a.k.a. join... software was used to develop the network . This is by no means an exhaustive list of Bayesian network applications, but it is representative of recent...characteristic node (SCN), state- defining node ( SDN ), effect node (EFN), or value node. The five types of nodes can be described as follows: ERDC/EL TR-11

  16. Blockchain for good? Digital ledger technology and sustainable development goals

    OpenAIRE

    Adams, R.; Kewell, B.; Parry, G.

    2017-01-01

    Blockchain technology (aka Distributed Ledger Technology or DLT) is a novel configuration of Peer-to-Peer, cryptographic and distributed computing technologies that have the potential to shift the internet from an internet of information to an internet of value network, with significant disruptive potential. To date, the cryptocurrency ‘bitcoin’ is the application of DLT that has attracted most attention, not all of it favourable. However, DLTs are about much more than cryptocurrencies and, a...

  17. Optimizing engineering tools using modern ground architectures

    OpenAIRE

    McArdle, Ryan P.

    2017-01-01

    Approved for public release; distribution is unlimited Over the past decade, a deluge of large and complex datasets (aka big data) has overwhelmed the scientific community. Traditional computing architectures were not capable of processing the data efficiently, or in some cases, could not process the data at all. Industry was forced to reexamine the existing data processing paradigm and develop innovative solutions to address the challenges. This thesis investigates how these modern comput...

  18. Measuring, Characterizing, and Detecting Facebook Like Farms

    OpenAIRE

    Ikram, Muhammad; Onwuzurike, Lucky; Farooqi, Shehroze; De Cristofaro, Emiliano; Friedman, Arik; Jourjon, Guillaume; Kaafar, Dali; Shafiq, M. Zubair

    2017-01-01

    Social networks offer convenient ways to seamlessly reach out to large audiences. In particular, Facebook pages are increasingly used by businesses, brands, and organizations to connect with multitudes of users worldwide. As the number of likes of a page has become a de-facto measure of its popularity and profitability, an underground market of services artificially inflating page likes, aka like farms, has emerged alongside Facebook's official targeted advertising platform. Nonetheless, ther...

  19. Leveraging spatial abstraction in traffic analysis and forecasting with visual analytics

    OpenAIRE

    Andrienko, N.; Andrienko, G.; Rinzivillo, S.

    2016-01-01

    A spatially abstracted transportation network is a graph where nodes are territory compartments (areas in geographic space) and edges, or links, are abstract constructs, each link representing all possible paths between two neighboring areas. By applying visual analytics techniques to vehicle traffic data from different territories, we discovered that the traffic intensity (a.k.a. traffic flow or traffic flux) and the mean velocity are interrelated in a spatially abstracted transportation net...

  20. Fake News

    OpenAIRE

    Grunewald, Andreas; Kräkel, Matthias

    2017-01-01

    In the last decade, social media and the Internet have amplified the possibility to spread false information, a.k.a. fake news, which has become a serious threat to the credibility of politicians, organizations, and other decision makers. This paper proposes a framework for investigating the incentives to strategically spread fake news under different institutional configurations and payoff structures. In particular, we show under what conditions institutions that foster transparency in the m...

  1. Beyond the God particle

    CERN Document Server

    Lederman, Leon M

    2013-01-01

    On July 4, 2012, the long-sought Higgs Boson--aka "the God Particle"--was discovered at the world's largest particle accelerator, the LHC, in Geneva, Switzerland. On March 14, 2013, physicists at CERN confirmed it. This elusive subatomic particle forms a field that permeates the entire universe, creating the masses of the elementary particles that are the basic building blocks of everything in the known world--from viruses to elephants, from atoms to quasars.

  2. ISIS Child Soldiers in Syria: The Structural and Predatory Recruitment, Enlistment, Pre-Training Indoctrination, Training, and Deployment

    OpenAIRE

    Asaad Almohammad

    2018-01-01

    Research on the engagement of children with the so-called Islamic State (a.k.a. ISIS) relies heavily on the analysis of obtained ISIS documents and ISIS-disseminated propaganda, leaving major elements of the recruitment and deployment process uncovered. Such ambiguities hinder future efforts aimed at dealing with ISIS’ child soldiers. As such, an intensive effort to compile data using interviews and naturalistic observations across ISIS-held territories in Syria was made to exhaustively explo...

  3. Propellant Handler’s Ensemble, aka Self-Contained Atmospheric Protective Ensemble (SCAPE), Ventilator Improvement Study

    Data.gov (United States)

    National Aeronautics and Space Administration — Life Support Services provides personal protective equipment services to the Space Shuttle, Delta and Atlas launch vehicles and their payloads, and other tenant...

  4. Nox regulation of smooth muscle contraction

    OpenAIRE

    Ritsick, Darren R.; Edens, William A.; Finnerty, Victoria; Lambeth, J. David

    2007-01-01

    The catalytic subunit, gp91phox (a.k.a., Nox2) of the NADPH-oxidase of mammalian phagocytes is activated by microbes and immune mediators to produce large amounts of reactive oxygen species (ROS) which participate in microbial killing. Homologs of gp91phox, the Nox and Duox enzymes, were recently described in a range of organisms, including plants, vertebrates, and invertebrates such as Drosophila melanogaster. While their enzymology and cell biology is being extensively studied in many labor...

  5. An online learning approach to dynamic pricing for demand response

    OpenAIRE

    Jia, Liyan; Tong, Lang; Zhao, Qing

    2014-01-01

    In this paper, the problem of optimal dynamic pricing for retail electricity with an unknown demand model is considered. Under the day-ahead dynamic pricing (a.k.a. real time pricing) mechanism, a retailer obtains electricity in a twosettlement wholesale market and serves its customers in real time. Without knowledge on the aggregated demand function of its customers, the retailer aims to maximize its retail surplus by sequentially adjusting its price based on the behavior of its customers in...

  6. Unification of field theory and maximum entropy methods for learning probability densities

    OpenAIRE

    Kinney, Justin B.

    2014-01-01

    The need to estimate smooth probability distributions (a.k.a. probability densities) from finite sampled data is ubiquitous in science. Many approaches to this problem have been described, but none is yet regarded as providing a definitive solution. Maximum entropy estimation and Bayesian field theory are two such approaches. Both have origins in statistical physics, but the relationship between them has remained unclear. Here I unify these two methods by showing that every maximum entropy de...

  7. Welding Emissions in Shipbuilding and Repair (Briefing Charts)

    Science.gov (United States)

    2009-09-03

    gas – GTAW –uses shield gas, but low emissions –aka TIG – SAW – lowest rate, solid wire weld covered with flux material 7 Naval Facilities...Reduced fume generation rate •Measurement of Cr(VI) –SMAW over operating range of consumable –GTAW or other processes of interest to DoD • Welding ...Engineering Service Center Welding Emissions in Shipbuilding and Repair Kathleen M Paulson, PE Port Hueneme, CA 3 September 2009 Report

  8. CHIPS. Volume 29, Issue 2, April - June 2011

    Science.gov (United States)

    2011-06-01

    Integrated Targeting and Fire Control • Electromagnetic Warfare • Spectrum Usage CHIPS April – June 2011 9 plans. Think of them as vectors for their...Wireless Broadband Revolution.” Now, more than ever before, the use of electromagnetic spectrum, aka radio frequencies, is recognized as having...Receives Limited Production 2 Approval Terminals slated for Navy’s F/A-18E/F Super Hornet, Air Force’s EC-130H Compass Call and RC-135 Rivet Joint

  9. Patient-generated subjective global assessment: Innovation from paper to digital app

    OpenAIRE

    Ottery, Faith D.; Kasenic, Suzanne; Sealy, Martine J.; DeBolt, Susan P.; Isenring, Elizabeth; Jager-Wittenaar, Harriët

    2015-01-01

    Purpose: The Patient-Generated Subjective Global Assessment (PG-SGA), including the PG-SGA Short Form (SF, aka ‘abridged’), was originally developed in the mid 1990’s as a scored, patient self-report, paperbased instrument and has been widely validated. The PG-SGA (SF) has been used for screening, assessment and monitoring, triageing for multimodal intervention and for evaluation of clinical and health economic outcomes. There have been ad hoc translations, often with permission of the origin...

  10. Do ‘Cheeseburger Bills’ Work? Effects of Tort Reform for Fast Food

    OpenAIRE

    Christopher S. Carpenter; D. Sebastian Tello-Trillo

    2015-01-01

    After highly publicized lawsuits against McDonald’s in 2002, 26 states adopted Commonsense Consumption Acts (CCAs) – aka ‘Cheeseburger Bills’ – that greatly limit fast food companies’ liability for weight-related harms. We provide the first evidence of the effects of CCAs using plausibly exogenous variation in the timing of CCA adoption across states. In two-way fixed effects models, we find that CCAs significantly increased stated attempts to lose weight and consumption of fruits and vegetab...

  11. Rapid Mission Assurance Assessment via Sociotechnical Modeling and Simulation

    Science.gov (United States)

    2015-05-01

    their abstractions and omissions of details, are repeated within the computer security world in the egg -defense model (aka the M&M model)—a hard shell...McPherson & Smith-Lovin, 1987) and revisited by those authors in (M. McPherson, Lovin, & Cook , 2001) among many others. The third interaction pattern is...Face-to-Face Groups. American Sociological Review, 52, 370-379. McPherson, M., Lovin, L., & Cook , J. (2001). Birds of a Feather: Homophily in Social

  12. The Afghan National Police: Turning a Counterinsurgency Problem into a Solution

    Science.gov (United States)

    2009-12-01

    27 “Special Forces groups are organized in small teams of 12 men — a.k.a. Operational Detachment Alpha (ODA). A typical Green Beret’s Team structure...Human Progress, 98. 162 Akbar S. Ahmed and David M. Hart, Islam in Tribal Societies: From the Atlas to the Indus (London; Boston: Routledge & Kegan ...Boston: Routledge & Kegan Paul, 1984. Al Jazeera. “Taliban Issue Code of Conduct.” Al Jazeera English Central/S. Asia (July 27, 2009), http

  13. Combinatorial Auctions without Money

    Science.gov (United States)

    2014-05-01

    istence of thresholds (a.k.a., critical prices) (for every set). The result in Theorem 3.4 relates to the characterization of truthful CAs with money and no...with money and no verification, each bidder optimizes her valu- ation minus the critical price over all her demanded sets; in the setting without money...auctions. ICALP, pp. 90-101, 2010. [2] P. Briest, P. Krysta, and B. Vöcking. Approximation techniques for utilitarian mechanism design. STOC, pp. 39-48

  14. The mid-latitude ionosphere under quiet geomagnetic conditions: propagation analysis of SuperDARN radar observations from large ionospheric perturbations

    OpenAIRE

    De Larquier, Sebastien

    2013-01-01

    The Earth's ionosphere is a dynamic environment strongly coupled to the neutral atmosphere, magnetosphere and solar activity. In the context of this research, we restrict our interest to the mid-latitude (a.k.a., sub-auroral) ionosphere during quiet geomagnetic conditions. The Super Dual Auroral Radar Network (SuperDARN) is composed of more than 30 low-power High Frequency (HF, from 8-18 MHz) Doppler radars covering the sub-auroral, auroral and polar ionosphere in both hemispheres. SuperDARN ...

  15. Assessing extraterrestrial regolith material simulants for in-situ resource utilization based 3D printing

    OpenAIRE

    Goulas, A; Binner, JGP; Harris, RA; Friel, RJ

    2017-01-01

    This research paper investigates the suitability of ceramic multi-component materials, which are found on the Martian and Lunar surfaces, for 3D printing (aka Additive Manufacturing) of solid structures. 3D printing is a promising solution as part of the cutting edge field of future in situ space manufacturing applications. 3D printing of physical assets from simulated Martian and Lunar regolith was successfully performed during this work by utilising laser-based powder bed fusion equipment. ...

  16. Profiling, assessing and matching personalities active in social media

    OpenAIRE

    Hennessy, Ciarán; Smeaton, Alan F.

    2016-01-01

    The world of social media influencers, bloggers and online “clothes horses” is a relatively new one. New-media personalities, a.k.a. “clothes horses”, are now endorsing brands, products and companies in a more subtle way than through traditional advertising. They carefully cultivate and position their personal brands with a view to persuading businesses to use them for relatively inexpensive, often local, online marketing campaigns. In the world of traditional media, companies wishing to adve...

  17. Towards a Secure Framework for mHealth. A Case Study in Mobile Data Collection Systems

    OpenAIRE

    Gejibo, Samson Hussien

    2015-01-01

    The rapid growth in the mobile communications technology and wide cellular coverage created an opportunity to satisfy the demand for low-cost health care solutions. Mobile Health (a.k.a. mHealth) is a promising health service delivery concept that utilizes mobile communications technology to bridge the gap between remotely and sparsely populated communities and health care providers. So far, several mHealth applications have been developed and deployed in the field. Among those, a digital inf...

  18. Easing Gently into OpenSRF, Part 2

    OpenAIRE

    Dan Scott

    2010-01-01

    The Open Service Request Framework (or OpenSRF, pronounced "open surf") is an inter-application message passing architecture built on XMPP (aka "jabber"). The Evergreen open source library system is built on an OpenSRF architecture to support loosely coupled individual components communicating over an OpenSRF messaging bus. This article introduces OpenSRF, demonstrates how to build OpenSRF services through simple code examples, explains the technical foundations on which OpenSRF is built, and...

  19. Easing Gently into OpenSRF, Part 1

    OpenAIRE

    Dan Scott

    2010-01-01

    The Open Service Request Framework (or OpenSRF, pronounced "open surf") is an inter-application message passing architecture built on XMPP (aka "jabber"). The Evergreen open source library system is built on an OpenSRF architecture to support loosely coupled individual components communicating over an OpenSRF messaging bus. This article introduces OpenSRF, demonstrates how to build OpenSRF services through simple code examples, explains the technical foundations on which OpenSRF is built, and...

  20. Why there is no supernatural morality: response to Miller's opening statement.

    Science.gov (United States)

    Shermer, Michael

    2016-11-01

    If one is going to argue that objective morality depends on an Archimedean point outside the natural world, then it would seem to imply that this source is necessarily supernatural. Thus, Christian Miller begins by defining precisely who he thinks this supernatural moral law giver is: the omniscient, omnipotent, and omnibenevolent creator of the universe who is still actively involved with human affairs-Elohim, Jehovah, Yahweh, or Allah-aka God. Already I'm skeptical. © 2016 New York Academy of Sciences.

  1. Artillery Engagement Simulation

    Science.gov (United States)

    1980-05-01

    coordinate* of the burst point to 10 meter accuracy (4 digit number). 7. Press R/S. Calculator will run for approximately one second and display the...northing coordinate* of the burst point to 10 meter accuracy (4 digit number). 8. If it is not desired to send azimuth and distance instructions to the...Now Delhi 1 USA Agey for Aviation Safety, Ft Rucker. ATTN: Educ Advisor I Pars Rsch Ofc, Libary , AKA. Israel Defense Forces I USA Aviation Sch. Ft

  2. Management and Development of the Western Resources Project

    Energy Technology Data Exchange (ETDEWEB)

    Terry Brown

    2009-03-09

    The purpose of this project was to manage the Western Resources Project, which included a comprehensive, basin-wide set of experiments investigating the impacts of coal bed methane (CBM; a.k.a. coal bed natural gas, CBNG) production on surface and groundwater in the Powder River Basin in Wyoming. This project included a number of participants including Apache Corporation, Conoco Phillips, Marathon, the Ucross Foundation, Stanford University, the University of Wyoming, Montana Bureau of Mines and Geology, and Western Research Institute.

  3. Three-dimensional ultrashort optical Airy beams in an inhomogeneous medium with carbon nanotubes

    Science.gov (United States)

    Zhukov, Alexander V.; Bouffanais, Roland; Belonenko, Mikhail B.; Dvuzhilov, Ilya S.

    2017-03-01

    In this Letter, we consider the problem of the dynamics of propagation of three-dimensional optical pulses (a.k.a. light bullets) with an Airy profile through a heterogeneous environment of carbon nanotubes. We show numerically that such beams exhibit sustained and stable propagation. Moreover, we demonstrate that by varying the density modulation period of the carbon nanotubes one can indirectly control the pulse velocity, which is a particularly valuable feature for the design and manufacturing of novel pulse delay devices.

  4. Evolutionary Game for Mining Pool Selection in Blockchain Networks

    OpenAIRE

    Liu, Xiaojun; Wang, Wenbo; Niyato, Dusit; Zhao, Narisa; Wang, Ping

    2017-01-01

    In blockchain networks adopting the proof-of-work schemes, the monetary incentive is introduced by the Nakamoto consensus protocol to guide the behaviors of the full nodes (i.e., block miners) in the process of maintaining the consensus about the blockchain state. The block miners have to devote their computation power measured in hash rate in a crypto-puzzle solving competition to win the reward of publishing (a.k.a., mining) new blocks. Due to the exponentially increasing difficulty of the ...

  5. STUDYING THE EFFECTS OF SPORTING HABITS ON THE SELF-ESTEEM OF DISABLED INDIVIDUALS

    OpenAIRE

    Erdoğan; Bülent; Gökhan; Serkan Tevabil

    2014-01-01

    It is considered that whether disabled individuals have low or high self- esteem Serkan T. AKA3 affects their interactions with the other individuals and how they cope with the challenges they come across in a society. Therefore, it is great significance to study the factors that are effective in boosting the self-esteem of such individuals. Bülent TATLISU2 The purpose of this study is to investigate the effects of sporting habits and different variables on the self-esteem level of ...

  6. Antifragile Electronic Warfare

    OpenAIRE

    Lichtman, Marc

    2014-01-01

    This letter introduces the concept of antifragile electronic warfare (EW), which we define as the ability to allow a communications link to improve performance due to the presence of a jammer. This concept should not be confused with jamming countermeasures (a.k.a. anti-jamming or electronic protection). Rather, antifragile EW can be thought of as the next step beyond simply avoiding or mitigating jamming. After introducing the concept we narrow down the subset of jammers this concept can be ...

  7. Benchmarking Software Assurance Implementation

    Science.gov (United States)

    2011-05-18

    product The chicken#. (a.k.a. Process Focused Assessment ) – Management Systems ( ISO 9001, ISO 27001 , ISO 2000) – Capability Maturity Models (CMMI...Assurance PRM, RMM, Assurance for CMMI)) – Lifecycle Processes ( ISO /IEEE 15288, ISO /IEEE 12207) – COBIT, ITIL, MS SDL, OSAMM, BSIMM 5 The egg...a.k.a Product Focused Assessments) – SCAP - NIST-SCAP – ISO /OMG W3C – KDM, BPMN, RIF, XMI, RDF – OWASP Top 10 – SANS TOP 25 – Secure Code Check Lists

  8. Electronic Biometric Transmission Specification. Version 1.2

    Science.gov (United States)

    2006-11-08

    Prescribed by ANSI Std Z39-18 Electronic Biometric Transmission Specification DIN: DOD_BTF_TS_EBTS_ Nov06_01.02.00 i Revision History Revision...contains: • the ORI • a Greenwich Mean (a.k.a. Zulu or UTC) date/time stamp • a code for the software used at the point of collection/transmission...long names and would generally include the tribe name. Subfield 1 Item 1 Character Type AS Characters 1 to 50 Special Characters: Any 7-bit non

  9. Capacity-achieving CPM schemes

    OpenAIRE

    Perotti, Alberto; Tarable, Alberto; Benedetto, Sergio; Montorsi, Guido

    2008-01-01

    The pragmatic approach to coded continuous-phase modulation (CPM) is proposed as a capacity-achieving low-complexity alternative to the serially-concatenated CPM (SC-CPM) coding scheme. In this paper, we first perform a selection of the best spectrally-efficient CPM modulations to be embedded into SC-CPM schemes. Then, we consider the pragmatic capacity (a.k.a. BICM capacity) of CPM modulations and optimize it through a careful design of the mapping between input bits and CPM waveforms. The s...

  10. Expectancies for cigarettes, e-cigarettes, and nicotine replacement therapies among e-cigarette users (aka vapers).

    Science.gov (United States)

    Harrell, Paul T; Marquinez, Nicole S; Correa, John B; Meltzer, Lauren R; Unrod, Marina; Sutton, Steven K; Simmons, Vani N; Brandon, Thomas H

    2015-02-01

    Use of e-cigarettes has been increasing exponentially, with the primary motivation reported as smoking cessation. To understand why smokers choose e-cigarettes as an alternative to cigarettes, as well as to US Food and Drug Administration (FDA)--approved nicotine replacement therapies (NRT), we compared outcome expectancies (beliefs about the results of drug use) for the three nicotine delivery systems among vapers, i.e., e-cigarette users, who were former smokers. Vapers (N = 1,434) completed an online survey assessing 14 expectancy domains as well as perceived cost and convenience. We focused on comparisons between e-cigarettes and cigarettes to determine the attraction of e-cigarettes as a smoking alternative and between e-cigarettes and NRT to determine perceived advantages of e-cigarettes over FDA-approved pharmacotherapy. Participants believed that e-cigarettes, in comparison to conventional cigarettes, had fewer health risks; caused less craving, withdrawal, addiction, and negative physical feelings; tasted better; and were more satisfying. In contrast, conventional cigarettes were perceived as better than e-cigarettes for reducing negative affect, controlling weight, providing stimulation, and reducing stress. E-cigarettes, compared to NRT, were perceived to be less risky, cost less, cause fewer negative physical feelings, taste better, provide more satisfaction, and be better at reducing craving, negative affect, and stress. Moderator analyses indicated history with ad libitum forms of NRT was associated with less positive NRT expectancies. The degree to which expectancies for e-cigarettes differed from expectancies for either tobacco cigarettes or NRT offers insight into the motivation of e-cigarette users and provides guidance for public health and clinical interventions to encourage smoking-related behavior change. © The Author 2014. Published by Oxford University Press on behalf of the Society for Research on Nicotine and Tobacco. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  11. Adventures in Music Translation: Italian Songs and Arias (aka “The Yellow Book” and Me

    Directory of Open Access Journals (Sweden)

    Lynn Penrod

    2017-06-01

    Full Text Available This article is a general exploration of translation issues involved in the translation and performance of the art song, arguing that although critical interest in recent years has been growing, the problems involved in these hybrid translation projects involving both text and music present a number of conundrums: primacy of text or music, focus on performability, and age-old arguments about fidelity and/or foreignization vs domestication. Using information from theatre translation and input from singers themselves, the author argues that this particular area of translation studies will work best in the future with a collaborative approach that includes translators, musicologists, and performers working together in order to produce the most “singable” text as possible for the art song in performance.

  12. Gut Microbiome of Coexisting BaAka Pygmies and Bantu Reflects Gradients of Traditional Subsistence Patterns

    Czech Academy of Sciences Publication Activity Database

    Gomez, A.; Petrželková, Klára Judita; Burns, M. B.; Yeoman, C. J.; Amato, K. R.; Vlčková, K.; Modrý, David; Todd, A.; Robinson, C. A. J.; Remis, M. J.; Torralba, M.; Morton, E.; Umana, J. D.; Carbonero, F.; Gaskins, H. R.; Nelson, K. E.; Wilson, B. A.; Stumpf, R. M.; White, B. A.; Leigh, S. R.; Blekhman, R.

    2016-01-01

    Roč. 14, č. 9 (2016), s. 2142-2153 ISSN 2211-1247 Institutional support: RVO:60077344 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: EE - Microbiology, Virology Impact factor: 8.282, year: 2016

  13. Gut microbiome of coexisting BaAka pygmies and Bantu reflects gradients of traditional subsistence patterns

    Czech Academy of Sciences Publication Activity Database

    Gomez, A.; Petrželková, Klára Judita; Burns, M. B.; Yeoman, C. J.; Amato, K. R.; Vlčková, K.; Modrý, D.; Todd, A.; Robinson, C. A. J.; Remis, M. J.; Torralba, M.; Morton, E.; Umana, J. D.; Carbonero, F.; Gaskins, H. R.; Nelson, K.; Wilson, B. A.; Stumpf, R. M.; White, B. A.; Leigh, S. R.; Blekhman, R.

    2016-01-01

    Roč. 14, č. 9 (2016), s. 2142-2153 ISSN 2211-1247 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : western lowland gorillas * microbiome * metabolomics * foraging ecology * anthropogenic interactions Subject RIV: EG - Zoology Impact factor: 8.282, year: 2016

  14. Professional development and extension programs

    Energy Technology Data Exchange (ETDEWEB)

    Bereznai, G. [University of Ontario Institute of Technology, Oshawa, ON (Canada)

    2015-07-01

    Professional Development (PD) refers to the means by which people acquire, develop, maintain and enhance the specialist knowledge and skills needed to practice in their profession. Extension Programs (aka Continuing Education) are offered by most post-secondary degree/diploma/certificate granting institutions.The courses are typically taken on a part-time basis, and course delivery often includes distance learning technology. An important implementation of PD is via workplace training, industry specific seminars, workshops and non-credit courses offered by a wide range of service providers.

  15. Reflections of a Technocrat: Managing Defense, Air, and Space Programs during the Cold War

    Science.gov (United States)

    2006-08-01

    American-Rockwell OV-10 Bronco , which made its maiden flight in 1965. Deployed to Vietnam three years later, the Bronco was adopted by the Air Force as a...to its em- barrassment, the Air Force had to adapt the Navy’s A-1 Skyraider, A-7 Corsair II, F-4 Phantom II, and the Marines’ OV-10 Bronco for...Station in El Segundo, California, the SecAF’s Office of Special Projects (aka NRO Pro- gram A) performed a variety of support functions as well as

  16. Professional development and extension programs

    International Nuclear Information System (INIS)

    Bereznai, G.

    2015-01-01

    Professional Development (PD) refers to the means by which people acquire, develop, maintain and enhance the specialist knowledge and skills needed to practice in their profession. Extension Programs (aka Continuing Education) are offered by most post-secondary degree/diploma/certificate granting institutions.The courses are typically taken on a part-time basis, and course delivery often includes distance learning technology. An important implementation of PD is via workplace training, industry specific seminars, workshops and non-credit courses offered by a wide range of service providers.

  17. Analiza metroloških karakteristika uređaja za optičku digitalizaciju stomatoloških CAD/CAM sistema

    OpenAIRE

    Trifković, Branka V.

    2012-01-01

    Razvoj i unapređenje metoda 3D digitalizacije u proteklih četrdeset godina, omogućio je da se ideja o primeni digitalnog otiska u stomatologiji pretvori u stvarnost. Za razliku od konvencionalnog otiska koji predstavlja kopiju zuba i okolnih tkiva u negativu, 3D digitalizacija je postupak u okviru koga se vrši prikupljanje podataka u vidu koordinata – tačaka i obavla njihovo prevođenje u digitalnu formu. Razlike u radnim principima postupaka 3D digitalizacije predstavljale su p...

  18. Initial investment to 3D printing technologies in a construction company

    OpenAIRE

    Cernohorsky, Zdenek; Matejka, Petr

    2017-01-01

    This article deals with an initial investment to 3D printing technologies in a construction company. The investment refers to the use of building information models and their integration with 3D printing technology within a construction company. In the first part, there will be discussed an introduction of 3D printing scheme in a construction company from a lifecycle perspective in general. As a part of this scheme, the ideal variant of an initial investment will be considered a.k.a a pilot p...

  19. Incremental Integrity Checking: Limitations and Possibilities

    DEFF Research Database (Denmark)

    Christiansen, Henning; Martinenghi, Davide

    2005-01-01

    Integrity checking is an essential means for the preservation of the intended semantics of a deductive database. Incrementality is the only feasible approach to checking and can be obtained with respect to given update patterns by exploiting query optimization techniques. By reducing the problem...... to query containment, we show that no procedure exists that always returns the best incremental test (aka simplification of integrity constraints), and this according to any reasonable criterion measuring the checking effort. In spite of this theoretical limitation, we develop an effective procedure...

  20. On uniqueness in diffuse optical tomography

    International Nuclear Information System (INIS)

    Harrach, Bastian

    2009-01-01

    A prominent result of Arridge and Lionheart (1998 Opt. Lett. 23 882–4) demonstrates that it is in general not possible to simultaneously recover both the diffusion (aka scattering) and the absorption coefficient in steady-state (dc) diffusion-based optical tomography. In this work we show that it suffices to restrict ourselves to piecewise constant diffusion and piecewise analytic absorption coefficients to regain uniqueness. Under this condition both parameters can simultaneously be determined from complete measurement data on an arbitrarily small part of the boundary

  1. Paying for Likes? Understanding Facebook like fraud using honeypots

    OpenAIRE

    De Cristofaro, E.; Friedman, A.; Jourjon, G.; Kaafar, M. A.; Shafiq, M. Z.

    2014-01-01

    Facebook pages offer an easy way to reach out to a very large audience as they can easily be promoted using Facebook's advertising platform. Recently, the number of likes of a Facebook page has become a measure of its popularity and profitability, and an underground market of services boosting page likes, aka like farms, has emerged. Some reports have suggested that like farms use a network of profiles that also like other pages to elude fraud protection algorithms, however, to the best of ou...

  2. Paying for Likes? Understanding Facebook Like Fraud Using Honeypots

    OpenAIRE

    De Cristofaro, Emiliano; Friedman, Arik; Jourjon, Guillaume; Kaafar, Mohamed Ali; Shafiq, M. Zubair

    2014-01-01

    Facebook pages offer an easy way to reach out to a very large audience as they can easily be promoted using Facebook's advertising platform. Recently, the number of likes of a Facebook page has become a measure of its popularity and profitability, and an underground market of services boosting page likes, aka like farms, has emerged. Some reports have suggested that like farms use a network of profiles that also like other pages to elude fraud protection algorithms, however, to the best of ou...

  3. HERMES project management I

    CERN Multimedia

    CERN. Geneva

    2013-01-01

    A two-hours course on the HERMES Project Management Methodology to the attention of Project Leaders and Project Participants. The methodology is quickly presented; the focus is put on the roles and responsibilities and on the project initiation phase. The course is given in French with slides in English. On April 22nd 2013, a new version of the HERMES methodology was made public. For practical reasons, this course is still given based on the 2009 version of HERMES (a.k.a. HERMES 4).

  4. A Comparative Study of Analog Voltage-mode Control Methods for Ultra-Fast Tracking Power Supplies

    DEFF Research Database (Denmark)

    Høyerby, Mikkel Christian Wendelboe; Andersen, Michael Andreas E.

    2007-01-01

    This paper presents a theoretical and experimental comparison of the standard PWM/PID voltage-mode control method for single-phase buck converters with two highperformance self-oscillating (a.k.a. sliding mode) control methods. The application considered is ultra-fast tracking power supplies...... (UFTPSs) for RF power amplifiers, where the switching converter needs to track a varying reference voltage precisely and quickly while maintaining low output impedance. The small-signal analyses performed on the different controllers show that the hysteretic-type controller can achieve the highest loop...

  5. Migan

    OpenAIRE

    Richard Price; Sally Price

    1994-01-01

    [First paragraph] Our friend Charlemagne (a.k.a. Émilien), who lives down the road and considers himself a breadfruit connoisseur, says that there's only one other tree in southern Martinique whose fruit compares with ours. From our back porch, during the tree's several flowerings each year, we can reach out and piek low-growing fruit by hand, or with a knife-and-pole contraption cut down a milk-flecked orb from higher up in the broad green leaves. This particular tree may even be descen...

  6. The supernova-regulated ISM. III. Generation of vorticity, helicity, and mean flows

    Science.gov (United States)

    Käpylä, M. J.; Gent, F. A.; Väisälä, M. S.; Sarson, G. R.

    2018-03-01

    Context. The forcing of interstellar turbulence, driven mainly by supernova (SN) explosions, is irrotational in nature, but the development of significant amounts of vorticity and helicity, accompanied by large-scale dynamo action, has been reported. Aim. Several earlier investigations examined vorticity production in simpler systems; here all the relevant processes can be considered simultaneously. We also investigate the mechanisms for the generation of net helicity and large-scale flow in the system. Methods: We use a three-dimensional, stratified, rotating and shearing local simulation domain of the size 1 × 1 × 2 kpc3, forced with SN explosions occurring at a rate typical of the solar neighbourhood in the Milky Way. In addition to the nominal simulation run with realistic Milky Way parameters, we vary the rotation and shear rates, but keep the absolute value of their ratio fixed. Reversing the sign of shear vs. rotation allows us to separate the rotation- and shear-generated contributions. Results: As in earlier studies, we find the generation of significant amounts of vorticity, the rotational flow comprising on average 65% of the total flow. The vorticity production can be related to the baroclinicity of the flow, especially in the regions of hot, dilute clustered supernova bubbles. In these regions, the vortex stretching acts as a sink of vorticity. In denser, compressed regions, the vortex stretching amplifies vorticity, but remains sub-dominant to baroclinicity. The net helicities produced by rotation and shear are of opposite signs for physically motivated rotation laws, with the solar neighbourhood parameters resulting in the near cancellation of the total net helicity. We also find the excitation of oscillatory mean flows, the strength and oscillation period of which depend on the Coriolis and shear parameters; we interpret these as signatures of the anisotropic-kinetic-α (AKA) effect. We use the method of moments to fit for the turbulent transport

  7. Enzyme replacement prevents enamel defects in hypophosphatasia mice

    Science.gov (United States)

    Yadav, Manisha C.; de Oliveira, Rodrigo Cardoso; Foster, Brian L.; Fong, Hanson; Cory, Esther; Narisawa, Sonoko; Sah, Robert L.; Somerman, Martha; Whyte, Michael P.; Millán, José Luis

    2012-01-01

    Hypophosphatasia (HPP) is the inborn error of metabolism characterized by deficiency of alkaline phosphatase activity leading to rickets or osteomalacia and to dental defects. HPP occurs from loss-of-function mutations within the gene that encodes the tissue-nonspecific isozyme of alkaline phosphatase (TNAP). TNAP knockout (Alpl−/−, a.k.a. Akp2−/−) mice closely phenocopy infantile HPP, including the rickets, vitamin B6-responsive seizures, improper dentin mineralization, and lack of acellular cementum. Here, we report that lack of TNAP in Alpl−/− mice also causes severe enamel defects, which are preventable by enzyme replacement with mineral-targeted TNAP (ENB-0040). Immunohistochemistry was used to map the spatiotemporal expression of TNAP in the tissues of the developing enamel organ of healthy mouse molars and incisors. We found strong, stage-specific expression of TNAP in ameloblasts. In the Alpl−/− mice, histological, μCT, and scanning electron microscopy analysis showed reduced mineralization and disrupted organization of the rods and inter-rod structures in enamel of both the molars and incisors. All of these abnormalities were prevented in mice receiving from birth daily subcutaneous injections of mineral-targeting, human TNAP (sALP-FcD10, a.k.a. ENB-0040) at 8.2 mg/kg/day for up to 44 days. These data reveal an important role for TNAP in enamel mineralization, and demonstrate the efficacy of mineral-targeted TNAP to prevent enamel defects in HPP. PMID:22461224

  8. Comprehensive in silico prediction and analysis of chlamydial outer membrane proteins reflects evolution and life style of the Chlamydiae

    Directory of Open Access Journals (Sweden)

    Myers Garry

    2009-12-01

    Full Text Available Abstract Background Chlamydiae are obligate intracellular bacteria comprising some of the most important bacterial pathogens of animals and humans. Although chlamydial outer membrane proteins play a key role for attachment to and entry into host cells, only few have been described so far. We developed a comprehensive, multiphasic in silico approach, including the calculation of clusters of orthologues, to predict outer membrane proteins using conservative criteria. We tested this approach using Escherichia coli (positive control and Bacillus subtilis (negative control, and applied it to five chlamydial species; Chlamydia trachomatis, Chlamydia muridarum, Chlamydia (a.k.a. Chlamydophila pneumoniae, Chlamydia (a.k.a. Chlamydophila caviae, and Protochlamydia amoebophila. Results In total, 312 chlamydial outer membrane proteins and lipoproteins in 88 orthologous clusters were identified, including 238 proteins not previously recognized to be located in the outer membrane. Analysis of their taxonomic distribution revealed an evolutionary conservation among Chlamydiae, Verrucomicrobia, Lentisphaerae and Planctomycetes as well as lifestyle-dependent conservation of the chlamydial outer membrane protein composition. Conclusion This analysis suggested a correlation between the outer membrane protein composition and the host range of chlamydiae and revealed a common set of outer membrane proteins shared by these intracellular bacteria. The collection of predicted chlamydial outer membrane proteins is available at the online database pCOMP http://www.microbial-ecology.net/pcomp and might provide future guidance in the quest for anti-chlamydial vaccines.

  9. The performance of single and multi-collector ICP-MS instruments for fast and reliable 34S/32S isotope ratio measurements†

    Science.gov (United States)

    Pröfrock, Daniel; Irrgeher, Johanna; Prohaska, Thomas

    2016-01-01

    The performance and validation characteristics of different single collector inductively coupled plasma mass spectrometers based on different technical principles (ICP-SFMS, ICP-QMS in reaction and collision modes, and ICP-MS/MS) were evaluated in comparison to the performance of MC ICP-MS for fast and reliable S isotope ratio measurements. The validation included the determination of LOD, BEC, measurement repeatability, within-lab reproducibility and deviation from certified values as well as a study on instrumental isotopic fractionation (IIF) and the calculation of the combined standard measurement uncertainty. Different approaches of correction for IIF applying external intra-elemental IIF correction (aka standard-sample bracketing) using certified S reference materials and internal inter-elemental IIF (aka internal standardization) correction using Si isotope ratios in MC ICP-MS are explained and compared. The resulting combined standard uncertainties of examined ICP-QMS systems were not better than 0.3–0.5% (uc,rel), which is in general insufficient to differentiate natural S isotope variations. Although the performance of the single collector ICP-SFMS is better (single measurement uc,rel = 0.08%), the measurement reproducibility (>0.2%) is the major limit of this system and leaves room for improvement. MC ICP-MS operated in the edge mass resolution mode, applying bracketing for correction of IIF, provided isotope ratio values with the highest quality (relative combined measurement uncertainty: 0.02%; deviation from the certified value: <0.002%). PMID:27812369

  10. The Rucio Consistency Service

    CERN Document Server

    Serfon, Cedric; The ATLAS collaboration

    2016-01-01

    One of the biggest challenge with Large scale data management system is to ensure the consistency between the global file catalog and what is physically on all storage elements. To tackle this issue, the Rucio software which is used by the ATLAS Distributed Data Management system has been extended to automatically handle lost or unregistered files (aka Dark Data). This system automatically detects these inconsistencies and take actions like recovery or deletion of unneeded files in a central manner. In this talk, we will present this system, explain the internals and give some results.

  11. Rsa algoritam i njegova praktična primena

    OpenAIRE

    Kuljanski R. Sonja

    2010-01-01

    RSA algoritam jeste algoritam sa javnim ključem koji uključuje tri koraka: generisanje ključa, enkripciju i dekripciju. RSA enkripciona šema je determinističaka što znači da se osnovni tekst uvek enkriptuje u isti šifrovani tekst za unapred zadati javni ključ. Da bi se izbegao ovaj problem, praktična implementacija RSA algoritma obično koristi neke strukture, kao što je dodavanje slučajnog teksta u samu poruku pre enkripcije. Ovo dodavanje obezbeđuje da osnovna poruka bude s...

  12. French Modular Impoundment: Final Cost and Performance Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Drown, Peter [French Development Enterprises, LLC, North Billerica, MA (United States); French, Bill [French Development Enterprises, LLC, North Billerica, MA (United States)

    2017-05-17

    This report comprises the Final Cost and Performance Report for the Department of Energy Award # EE0007244, the French Modular Impoundment (aka the “French Dam”.) The French Dam is a system of applying precast modular construction to water control structures. The “French Dam” is a term used to cover the construction means/methods used to construct or rehabilitate dams, diversion structures, powerhouses, and other hydraulic structures which impound water and are covered under FDE’s existing IP (Patents # US8414223B2; US9103084B2.)

  13. Structural Logical Relations

    DEFF Research Database (Denmark)

    Schürmann, Carsten; Sarnat, Jeffrey

    2008-01-01

    Tait's method (a.k.a. proof by logical relations) is a powerful proof technique frequently used for showing foundational properties of languages based on typed lambda-calculi. Historically, these proofs have been extremely difficult to formalize in proof assistants with weak meta-logics......, such as Twelf, and yet they are often straightforward in proof assistants with stronger meta-logics. In this paper, we propose structural logical relations as a technique for conducting these proofs in systems with limited meta-logical strength by explicitly representing and reasoning about an auxiliary logic...

  14. National CO2 emissions trading in European perspective; Nationale CO2-emissiehandel in Europees perspectief

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-06-01

    This report is the reaction of the Social and economic council (SER) in the Netherlands to the request of the Dutch Ministry of Housing, Spatial Planning en Environment (VROM) to formulate an advice on the final report of the Committee CO2 Trade (a.k.a the Vogtlander Committee). This Committee has drafted a proposal for a CO2 emission trade system in the Netherlands. The SER has also taken into account the proposal of the European Committee on a guideline for CO2 emission trade in the European Union (EU)

  15. Relative Entropy, Interaction Energy and the Nature of Dissipation

    Directory of Open Access Journals (Sweden)

    Bernard Gaveau

    2014-06-01

    Full Text Available Many thermodynamic relations involve inequalities, with equality if a process does not involve dissipation. In this article we provide equalities in which the dissipative contribution is shown to involve the relative entropy (a.k.a. Kullback-Leibler divergence. The processes considered are general time evolutions both in classical and quantum mechanics, and the initial state is sometimes thermal, sometimes partially so. By calculating a transport coefficient we show that indeed—at least in this case—the source of dissipation in that coefficient is the relative entropy.

  16. Sound & The Senses

    DEFF Research Database (Denmark)

    Schulze, Holger

    2012-01-01

    How are those sounds you hear right now technically generated and post-produced, how are they aesthetically conceptualized and how culturally dependant are they really? How is your ability to hear intertwined with all the other senses and their cultural, biographical and technological constructio...... over time? And how is listening and sounding a deeply social activity – constructing our way of living together in cities as well as in apartment houses? A radio feature with Jonathan Sterne, AGF a.k.a Antye Greie, Jens Gerrit Papenburg & Holger Schulze....

  17. USAmerican Studies in the United Kingdom

    Directory of Open Access Journals (Sweden)

    Richard Ellis

    2006-01-01

    Full Text Available It is first necessary to lay down some framing parameters to the study of the USA in the UK’s Higher Education (HE institutions—its Universities and Colleges: -A 2004 article in The Guardian by Polly Toynbee, widely read around the world-the introduction of “top-up” fees which UK and EU citizens wishing to enter UK HE-USAmerican Studies’ “critical mass” in any one institution;  -the quinquennial government-imposed “Research Assessment” Exercise—aka the RAE-the British Association of American...

  18. INTEGRAL/JEM-X reports enhanced activity from the HMXB 4U 1036-56

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Fiocchi, M.; Bazzano, A.

    2015-01-01

    During the Galactic Plane Scanning performed by INTEGRAL on December 11th, 2015, the X-ray monitor JEM-X has detected enhanced activity from the high mass X-ray binary (HMXB) 4U 1036-56, aka RX J1037.5-5647. The position of the source was covered by the JEM-X field of view two times between UTC 6...... 1036-56 is a Be X-ray pulsar (e.g. Torres et al. 2012, ApJ 761, 49), whose last outburst was reported by Swift in February 2012 (Krimm et al. ATel #3936)....

  19. Low energy nuclear reactions driven by discrete breathers

    OpenAIRE

    Dubinko, Vladimir

    2014-01-01

    A new mechanism of LENR in solids is proposed, which is based on the large amplitude anharmonic lattice vibrations, a.k.a. intrinsic localized modes or discrete breathers (DBs). In particular, so called gap DBs, which can arise in diatomic crystals such as metal hydrides, are argued to be the LENR catalyzers. The large mass difference between H or D and the metal atoms provides a gap in phonon spectrum, in which DBs can be excited in the H/D sub-lattice resulting in extreme dynamic closing of...

  20. "Reflections of the Loss of Rumeli on the Turkish Poetry"

    OpenAIRE

    GÜNEŞ, Mehmet

    2011-01-01

    Losing the land of Rumeli has had significant reflections on the Turkish poetry. Poets such as Rıza Tevfik, Mehmet kif, Aka Gündüz, Arif Nihat, etc. wrote poems on how much the sudden loss of Rumeli, which had long been under the Turkish rule, influenced the feelings of the Turkish people quite negatively. They harshly criticized the negligence and the incompetence of the rulers which accelerated the loss of the land during the Balkan War. One can easily observe the dramatic style in such po...

  1. Reflections of the Loss of Rumeli on the Turkish Poetry

    OpenAIRE

    GÜNEŞ, Mehmet

    2016-01-01

    Losing the land of Rumeli has had significant reflections on the Turkish poetry. Poets such as Rıza Tevfik, Mehmet Âkif, Aka Gündüz, Arif Nihat, etc. wrote poems on how much the sudden loss of Rumeli, which had long been under the Turkish rule, influenced the feelings of the Turkish people quite negatively. They harshly criticized the negligence and the incompetence of the rulers which accelerated the loss of the land during the Balkan War. One can easily observe the dramatic style in such p...

  2. Statističke metode u kontroli kvalitete mlijeka i proizvoda

    OpenAIRE

    Filajdić, Mirko; Ritz, Milana; Vahčić, Nada; Vojnović, Vera; Grüner, Matilda; Vujanić, Diana

    1991-01-01

    Nakon osnivanja Analitičke sekcije na XXVIII. simpoziju mljekarske industrije 1990. godine ukazala se potreba proširenja spoznaja ili obnova znanja iz primjene statističkih metoda u interpretaciji rezultata analiza pri provjeri kakvoće mlijeka i mliječnih proizvoda. 1. Utvrđivanje slučajnih pogrešaka u rezultatima analiza - Prvi dio rada sadrži nekoliko praktičnih primjera utvrđivanja slučajne pogreške rezultata analiza kad se rezultati izražavaju kao kontinuirane ili diskretne veličine mjere...

  3. Influencia de la geometría de techumbres de vivienda unifamiliar para integración de energía solar activa (BIPYTA)

    OpenAIRE

    Zalamea, Esteban Felipe; García, Rodrigo Hernán; Sánchez Arriagada, Reinaldo

    2016-01-01

    Este trabajo fue parte de programa de investigación Conicyt CONFIN AKA-ERNC 007, (Chile, Conicyt 912, 2013). Se revisa la integración arquitectónica de sistemas de energía solar activa (colectores híbridos con aire) en techumbres de viviendas unifamiliares recientes en Concepción, Chile, determinando la influencia de la composición volumétrica de faldones captadores. Se descifra la incidencia de orientación e inclinación respecto a trayectoria solar, considerando que si bien es recomendab...

  4. MAXI/GSC detection of a new outburst from SAX J1810.8-2609

    Science.gov (United States)

    Negoro, H.; Mihara, T.; Nakahira, S.; Yatabe, F.; Takao, Y.; Matsuoka, M.; Kawai, N.; Sugizaki, M.; Tachibana, Y.; Morita, K.; Sakamoto, T.; Serino, M.; Sugita, S.; Kawakubo, Y.; Hashimoto, T.; Yoshida, A.; Nakajima, M.; Sakamaki, A.; Maruyama, W.; Ueno, S.; Tomida, H.; Ishikawa, M.; Sugawara, Y.; Isobe, N.; Shimomukai, R.; Ueda, Y.; Tanimoto, A.; Morita, T.; Yamada, S.; Tsuboi, Y.; Iwakiri, W.; Sasaki, R.; Kawai, H.; Sato, T.; Tsunemi, H.; Yoneyama, T.; Yamauchi, M.; Hidaka, K.; Iwahori, S.; Kawamuro, T.; Yamaoka, K.; Shidatsu, M.

    2018-05-01

    We report a new X-ray outburst from the low-mass X-ray binary SAX J1810.8-2609 (aka V4722 Sgr; Ubertini et al. 1998, IAUC 6838) observed with MAXI/GSC. The enhancement was recognized from 2018 April 23 (MJD 58231), and X-ray count rates in the 2-4 keV and 4-10 keV bands peaked on April 26 at 0.085 +/- 0.008 c/s/cm2 ( 80 mCrab) and 0.096+/-0.008 c/s/cm2 ( 82 mCrab), respectively.

  5. Ainult hulludele : [ultra-võistluste sarjast Haanja100 Neliküritus] / Ivar Tupp aka Dr Holden

    Index Scriptorium Estoniae

    Tupp, Ivar

    2011-01-01

    Tartu üliõpilaste looduskaitseringi Lumeilvese matkadest ehk Eesti 20 kõrgeima mäetipu vallutamisest, millest kasvas välja haanjamatkad.ee, mis korraldab ka ülipika distantsiga spordivõistluste sarja Haanja neliküritus. Lisa: Matk üle mägede

  6. Stanford-Binet & WAIS IQ Differences and Their Implications for Adults with Intellectual Disability (aka Mental Retardation)

    OpenAIRE

    Silverman, Wayne; Miezejeski, Charles; Ryan, Robert; Zigman, Warren; Krinsky-McHale, Sharon; Urv, Tiina

    2010-01-01

    Stanford-Binet and Wechsler Adult Intelligence Scale (WAIS) IQs were compared for a group of 74 adults with intellectual disability (ID). In every case, WAIS Full Scale IQ was higher than the Stanford-Binet Composite IQ, with a mean difference of 16.7 points. These differences did not appear to be due to the lower minimum possible score for the Stanford-Binet. Additional comparisons with other measures suggested that the WAIS might systematically underestimate severity of intellectual impairm...

  7. Stanford-Binet & WAIS IQ Differences and Their Implications for Adults with Intellectual Disability (aka Mental Retardation).

    Science.gov (United States)

    Silverman, Wayne; Miezejeski, Charles; Ryan, Robert; Zigman, Warren; Krinsky-McHale, Sharon; Urv, Tiina

    2010-03-01

    Stanford-Binet and Wechsler Adult Intelligence Scale (WAIS) IQs were compared for a group of 74 adults with intellectual disability (ID). In every case, WAIS Full Scale IQ was higher than the Stanford-Binet Composite IQ, with a mean difference of 16.7 points. These differences did not appear to be due to the lower minimum possible score for the Stanford-Binet. Additional comparisons with other measures suggested that the WAIS might systematically underestimate severity of intellectual impairment. Implications of these findings are discussed regarding determination of disability status, estimating prevalence of ID, assessing dementia and aging-related cognitive declines, and diagnosis of ID in forensic cases involving a possible death penalty.

  8. MINERALIZING, STEAM REFORMING TREATMENT OF HANFORD LOW-ACTIVITY WASTE (a.k.a. INEEL/EXT-05-02526)

    International Nuclear Information System (INIS)

    A. L. Olson; N. R. Soelberg; D. W. Marshall; G. L. Anderson

    2005-01-01

    The U.S. Department of Energy (DOE) documented, in 2002, a plan for accelerating cleanup of the Hanford Site, located in southeastern Washington State, by at least 35 years. A key element of the plan was acceleration of the tank waste program and completion of ''tank waste treatment by 2028 by increasing the capacity of the planned Waste Treatment Plant (WTP) and using supplemental technologies for waste treatment and immobilization''. The plan identified steam reforming technology as a candidate for supplemental treatment of as much as 70% of the low-activity waste (LAW). Mineralizing steam reforming technology, offered by THOR Treatment Technologies, LLC would produce a denitrated, granular mineral waste form using a high-temperature fluidized bed process. A pilot scale demonstration of the technology was completed in a 15-cm-diameter reactor vessel. The pilot scale facility was equipped with a cyclone separator and heated sintered metal filters for particulate removal, a thermal oxidizer for reduced gas species and NOx destruction, and a packed activated carbon bed for residual volatile species capture. The pilot scale equipment is owned by the DOE, but located at the Science and Technology Applications Research (STAR) Center in Idaho Falls, ID. Pilot scale testing was performed August 2-5, 2004. Flowsheet chemistry and operational parameters were defined through a collaborative effort involving Idaho National Engineering and Environmental Laboratory (INEEL), Savannah River National Laboratory (SRNL), and THOR Treatment Technologies personnel. Science Application International Corporation, owners of the STAR Center, personnel performed actual pilot scale operation. The pilot scale test achieved a total of 68.4 hours of cumulative/continuous processing operation before termination in response to a bed de-fluidization condition. 178 kg of LAW surrogate were processed that resulted in 148 kg of solid product, a mass reduction of about 17%. The process achieved essentially complete bed turnover within approximately 40 hours. Samples of mineralized solid product materials were analyzed for chemical/physical properties. SRNL will report separately the results of product performance testing that were accomplished

  9. Intra-annual variability of carbon and nitrogen stable isotopes in suspended organic matter in waters of the western continental shelf of India

    Digital Repository Service at National Institute of Oceanography (India)

    Maya, M.V.; Karapurkar, S.G.; Naik, H.; Roy, R.; Shenoy, D.M.; Naqvi, S.W.A.

    receives large runoff from land during the SW monsoon and the associated terrestrial organic matter inputs may possibly play a role in biogeochemical cycling. 2 Methods 2.1 Sampling Time series measurements were carried out at the Candolim Time Series (CaTS...) station (aka Sta. G5), which is located CaTS~10 km Fig. 1. Map of the study area showing the location of Candolim Time Series (CaTS) station (G5) off Goa. at Lat. 15◦31prime N, Long. 73◦39prime E, approximately 10 km off Candolim Beach (Goa), central...

  10. On the Reconciliation of the Extended Nelson-Siegel and the Extended Vasicek Models (with a View Towards Swap and Swaption Valuation)

    DEFF Research Database (Denmark)

    Jørgensen, Peter Løchte

    Extended Nelson-Siegel models are widely used by e.g. practitioners and central banks to estimate current term structures of riskless zero-coupon interest rates, whereas other models such as the extended Vasicek model (a.k.a. the Hull-White model) are popular for pricing interest rate derivatives....... This paper establishes theoretical consistency between these two types of models by showing how to specify the extended Vasicek model such that its implied initial term structure curve precisely matches a given extended Nelson-Siegel specification. That is, we show how to reconcile the two classes of models...

  11. Preliminary results from a numerical study on the appendix gap losses in a Stirling engine

    DEFF Research Database (Denmark)

    Andersen, Stig Kildegård; Carlsen, Henrik; Thomsen, Per Grove

    2005-01-01

    Analytical expressions for the losses in the displacer clearance gap, a.k.a. the appendix gap, have been refined during the last decades. But most real life Stirling engines violate the assumptions behind these expressions and hence the expressions may not be applicable. In this study the gap has...... been included directly into a one dimensional Stirling engine model. Practical aspects of the method, such as handling the moving wall in the gap while achieving an energy conserving model formulation and handling discontinuous derivatives in the equations, are discussed. A study on the convergence...... output of the engine....

  12. Darwin model in plasma physics revisited

    International Nuclear Information System (INIS)

    Xie, Huasheng; Zhu, Jia; Ma, Zhiwei

    2014-01-01

    Dispersion relations from the Darwin (a.k.a., magnetoinductive or magnetostatic) model are given and compared with those of the full electromagnetic model. Analytical and numerical solutions show that the errors from the Darwin approximation can be large even if phase velocity for a low-frequency wave is close to or larger than the speed of light. Besides missing two wave branches associated mainly with the electron dynamics, the coupling branch of the electrons and ions in the Darwin model is modified to become a new artificial branch that incorrectly represents the coupling dynamics of the electrons and ions. (paper)

  13. Uloga kućnih ljubimaca u socioemocionalnom  razvoju djece školskog uzrasta

    OpenAIRE

    Smojver-Ažić, Sanja; Topalović, Zorica

    2010-01-01

    Rezultati istraživanja potvrđuju kako je odrastanje uz kućnoga ljubimca povezano sa socioemocionalnim razvojem djece. Cilj ovoga istraživanja bio je ispitati odnos u kojemu stoje privrženost majci, privrženost kućnomu ljubimcu i empatija, socijalna kompetencija i usamljenost. U istraživanju je sudjelovalo 480 učenika četvrtoga, šestoga i osmoga razreda osnovnih škola u Istri (226 djevojčica i 254 dječaka) te njihovi roditelji. U ispitanom uzorku 63 % djece ima jednoga ili više kućnih ljubi...

  14. Developer communities, education and innovation

    Directory of Open Access Journals (Sweden)

    Andrés L. Martínez Ortiz

    2015-05-01

    Full Text Available Andrés L. Martínez Ortiz, a.k.a Almo, is Developer Program Manager in Google's Engineering Organisation. He is focused on driving the success of Google's developer products and the open web by creating a thriving ecosystem of 3rd party applications and businesses built on them. Closely with Product Management, Marketing, Public Relations, Business Development, and other, he works with and supports developer communities, initiating activities that meet the needs of the innovation ecosystem. In addition, he meets with developers and partners in large companies, startups, universities and enterprises, promoting open standards and Google technologies.

  15. Efekt neposredne blizine u kontekstu pretilosti kod djece

    OpenAIRE

    Čulić, Ana

    2015-01-01

    Cilj ovog istraživanja bio je ispitati postoji li kod djece razlika u procjeni preferencije druženja s određenim djetetom ovisno o tjelesnoj težini procjenjivanog djeteta. Također, ispitano je hoće li grupa djece od strane ispitanika biti preferirana za druženje onoliko koliko će biti preferiran njen najmanje poželjan član, a ne kao suma iskazanih preferencija prema svakom članu grupe posebno.U istraživanju je sudjelovao prigodni uzorak od 59 dječaka i 43 djevojčice od prvog do četvrtog razre...

  16. Efficiency Versus Instability in Plasma Accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, Valeri [Fermilab; Burov, Alexey [Fermilab; Nagaitsev, Sergei [Fermilab

    2017-01-05

    Plasma wake-field acceleration in a strongly nonlinear (a.k.a. the blowout) regime is one of the main candidates for future high-energy colliders. For this case, we derive a universal efficiency-instability relation, between the power efficiency and the key instability parameter of the witness bunch. We also show that in order to stabilize the witness bunch in a regime with high power efficiency, the bunch needs to have high energy spread, which is not presently compatible with collider-quality beam properties. It is unclear how such limitations could be overcome for high-luminosity linear colliders.

  17. Odnos između ortodontskih i izgovornih poremećaja u adolescenata

    OpenAIRE

    Hunski, M.; Ivičević-Desnica, J.; Škarić, I.; Horga, D.

    2003-01-01

    Različita su istraživanja pokazala da je broj izgovornih poremećaja veći u populaciji s ortodontskim anomalijama nego u osoba bez njih. Odnos između anatomskih struktura u orofacijalnoj regiji i izgovornih kompenzacijskih mehanizama u osoba s ortodontskim anomalijama zanimljiv je i s teoretskoga i s praktičnoga stajališta. U ovom je istraživanju na uzorku od 282 srednjoškolca (203 - 72% djevojaka i 79 - 28% dječaka) u dobi od 15 do 18 godina istražen odnos između ortodontskih i izgovornih por...

  18. Športsko rekreativne aktivnosti pogodne za bolesnike s osteoporozom

    OpenAIRE

    ŠAKIĆ, Davorin; BADOVINAC, Olga; AMERL-ŠAKIĆ, Vjekoslava

    2000-01-01

    Tjelovježba i povećana tjelesna aktivnost neraskidivi su dio svakog preventivnog ili terapijskog postupka kod osteoporoze. Povećanje snage mišića uz opterećenje vlastitom težinom u uspravnom stavu važan su stimulator izgradnje kosti aksijalnog skeleta, čime se smanjuje rizik od frakture, a istodobno povećava potpora kralješnice i stoga su kolapsi kralješaka manje vjerojatni. Vježbom se povećava koordinacija pokreta i time smanjuje mogućnost pada, povećava sposobnost zaštite od posljedica pada...

  19. Improved Pulse Detection from Head Motions Using DCT

    DEFF Research Database (Denmark)

    Irani, Ramin; Nasrollahi, Kamal; Moeslund, Thomas B.

    2014-01-01

    . To measure it, physicians traditionally, either sense the pulsations of some blood vessels or install some sensors on the body. In either case, there is a need for a physical contact between the sensor and the body to obtain the heartbeat rate. This might not be always feasible, for example, for applications......The heart pulsation sends out the blood throughout the body. The rate in which the heart performs this vital task, heartbeat rate, is of curial importance to the body. Therefore, measuring heartbeat rate, a.k.a. pulse detection, is very important in many applications, especially the medical ones...

  20. VizieR Online Data Catalog: Intermediate-luminosity X-ray objects catalog (Colbert+, 2002)

    Science.gov (United States)

    Colbert, E. J. M.; Ptak, A. F.

    2002-11-01

    ROSAT, and now Chandra, X-ray images allow studies of extranuclear X-ray point sources in galaxies other than our own. X-ray observations of normal galaxies with ROSAT and Chandra have revealed that off-nuclear, compact, intermediate-luminosity (LX[2-10keV]>=1039erg/s) X-ray objects (IXOs, a.k.a. ULXs [ultraluminous X-ray sources]) are quite common. Here we present a catalog and finding charts for 87 IXOs in 54 galaxies, derived from all of the ROSAT HRI imaging data for galaxies with cz<=5000km/s from the Third Reference Catalog of Bright Galaxies. (2 data files).