ALICE luminosity determination for p-Pb collisions at $\\sqrt{s_{\\rm NN}}=8.16$ TeV

CERN Document Server

2018-01-01

Luminosity determination in ALICE is based on visible cross sections measured in van der Meer scans. In 2016, the Large Hadron Collider provided proton-lead collisions at a centre-of-mass energy of $\\sqrt{s_{\\rm NN}}=8.16$ TeV. There were two scans, one with the proton beam traveling towards the ALICE forward muon spectrometer and the second with the proton beam traveling in the opposite direction. During these scans cross sections were measured for two classes of visible interactions, based on particle detection in the ALICE luminometers: the T0 detector with pseudorapidity coverage $4.6<\\eta< 4.9$, $-3.3<\\eta<-3.0$ and the V0 detector covering $2.8<\\eta< 5.1$, $-3.7<\\eta<-1.7$. This document describes the experimental setup for such measurements and reports their results.

KIT(D816V) Induces SRC-Mediated Tyrosine Phosphorylation of MITF and Altered Transcription Program in Melanoma

DEFF Research Database (Denmark)

Phung, Bengt; Kazi, Julhash U; Lundby, Alicia

2017-01-01

The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine phosphorylat......The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine.......Implications: This study demonstrates that an oncogenic tyrosine kinase mutant, KIT(D816V), can alter the transcriptional program of the transcription factor MITF in melanoma Mol Cancer Res; 15(9); 1265-74. ©2017 AACR....

30 CFR 816.150 - Roads: general.

Science.gov (United States)

2010-07-01

... altering the normal flow of water in streambeds or drainage channels; (6) Prevent or control damage to... part of any road shall be located in the channel of an intermittent or perennial stream unless... 816.57 of this chapter. (2) Roads shall be located to minimize downstream sedimentation and flooding...

Multiparticle correlations and higher order harmonics in pPb collisions at $\\sqrt{s_{_\\text{NN}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

The second- and third-order azimuthal anisotropy Fourier harmonics are studied in pPb collisions at $\\sqrt{s_{_\\text{NN}}}=8.16~\\mathrm{TeV}$ over a wide range of event multiplicities. The second-order, ``elliptic'' harmonic moment is obtained through four-, six-, and eight-particle correlations and the third-order, ``triangular'' harmonic moment is studied using four-particle correlations. The data were collected by the CMS experiment during the 2016 LHC run. A sample of peripheral PbPb collisions at $\\sqrt{s_{_{\\text{NN}}}}=5.02~\\mathrm{TeV}$, covering a similar range of event multiplicities to the pPb results, is also analyzed. Theoretical predictions that assume a hydrodynamic evolution of the created medium with initial-state density fluctuations are compared to the experimental results.

30 CFR 816.131 - Cessation of operations: Temporary.

Science.gov (United States)

2010-07-01

..., revegetation, environmental monitoring, and water treatment activities that will continue during the temporary... Section 816.131 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...

Prompt and nonprompt J/ψ production and nuclear modification in pPb collisions at sNN=8.16 TeV

Directory of Open Access Journals (Sweden)

R. Aaij

2017-11-01

Full Text Available The production of J/ψ mesons is studied in proton-lead collisions at the centre-of-mass energy per nucleon pair sNN=8.16 TeV with the LHCb detector at the LHC. The double differential cross-sections of prompt and nonprompt J/ψ production are measured as a function of the J/ψ transverse momentum and rapidity in the nucleon–nucleon centre-of-mass frame. Forward-to-backward ratios and nuclear modification factors are determined. The results are compared with theoretical calculations based on collinear factorisation using nuclear parton distribution functions, on the colour glass condensate or on coherent energy loss models.

30 CFR 816.47 - Hydrologic balance: Discharge structures.

Science.gov (United States)

2010-07-01

...-SURFACE MINING ACTIVITIES § 816.47 Hydrologic balance: Discharge structures. Discharge from sedimentation... shall be controlled, by energy dissipators, riprap channels, and other devices, where necessary, to reduce erosion, to prevent deepening or enlargement of stream channels, and to minimize disturbance of...

The Marine Guanidine Alkaloid Crambescidin 816 Induces Calcium Influx and Cytotoxicity in Primary Cultures of Cortical Neurons through Glutamate Receptors.

Science.gov (United States)

Mendez, Aida G; Juncal, Andrea Boente; Silva, Siguara B L; Thomas, Olivier P; Martín Vázquez, Víctor; Alfonso, Amparo; Vieytes, Mercedes R; Vale, Carmen; Botana, Luís M

2017-07-19

Crambescidin 816 is a guanidine alkaloid produced by the sponge Crambe crambe with known antitumoral activity. While the information describing the effects of this alkaloid in central neurons is scarce, Cramb816 is known to block voltage dependent calcium channels being selective for L-type channels. Moreover, Cramb816 reduced neuronal viability through an unknown mechanism. Here, we aimed to describe the toxic activity of Cramb816 in cortical neurons. Since calcium influx is considered the main mechanism responsible for neuronal cell death, the effects of Cramb816 in the cytosolic calcium concentration of cortical neurons were studied. The alkaloid decreased neuronal viability and induced a dose-dependent increase in cytosolic calcium that was also related to the presence of calcium in the extracellular media. The increase in calcium influx was age dependent, being higher in younger neurons. Moreover, this effect was prevented by glutamate receptor antagonists, which did not fully block the cytotoxic effect of Cramb816 after 24 h of treatment but completely prevented Cramb816 cytotoxicity after 10 min exposure. Therefore, the findings presented herein provide new insights into the cytotoxic effect of Cramb816 in cortical neurons.

46 CFR 176.816 - Miscellaneous systems and equipment.

Science.gov (United States)

2010-10-01

... 100 GROSS TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.816 Miscellaneous systems and equipment. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test and make available for inspection all items in the ship's outfit, such as ground...

Crambescidin 816 induces calcium influx though glutamate receptors in primary cultures of cortical neurons

Directory of Open Access Journals (Sweden)

Víctor Martín Vázquez

2014-06-01

In summary, our data suggest that the cytotoxic effect of 10 μM Cramb816 in cortical neurons may be related to an increase in the cytosolic calcium concentration elicited by the toxin, which is shown to be mediated by glutamate receptor activation. Further studies analyzing the effect of glutamate receptor blockers on the cytotoxic effect of Cramb816 are needed to confirm this hypothesis.

Prompt photon production in $\\sqrt{s_\\mathrm{NN}} = 8.16$ TeV $p$+Pb collisions with ATLAS

CERN Document Server

The ATLAS collaboration

2017-01-01

The inclusive production cross-section for isolated, prompt photons in $p$+Pb collisions at $\\sqrt{s_\\mathrm{NN}} = 8.16$~TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of $162$~nb$^{-1}$. The cross-section is measured as a function of photon transverse energy from $25$ to $500$~GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton-- and nucleus--going directions. Results are reported in the nucleon--nucleon center of mass collision frame. The nuclear modification factor $R_{p\\mathrm{Pb}}$ is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in $pp$ collisions at $8$~TeV. The cross-sections and $R_{p\\mathrm{Pb}}$ values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-sectio...

Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $ {\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV

CERN Document Server

Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Mahmoud, Mohammed; Mohammed, Yasser; Salama, Elsayed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Zhang, Sijing; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Fischer, Robert; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Stefaniuk, Nazar; Tholen, Heiner; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Vámi, Tamás Álmos; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Ravindra Kumar Verma, Ravindra; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Shtol, Dmitry; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; Garcia-Ferrero, Juan; García Alonso, Andrea; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Reichmann, Michael; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Li, You-ying; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Auzinger, Georg; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tran, Benjamin; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel

2018-01-01

The elliptic azimuthal anisotropy coefficient ($v_2$) is measured for charm ($ {\\mathrm{D^0}} $) and strange ($ {\\mathrm{K^0_S}} $, $ \\Lambda $, $ \\Xi^-$, and $ \\Omega^-$) hadrons, using a data sample of pPb collisions collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV. A significant positive $v_2$ signal from long-range azimuthal correlations is observed for all particle species in high-multiplicity pPb collisions. The measurement represents the first observation of possible long-range collectivity for open heavy flavor hadrons in small systems. The results suggest that charm quarks have a smaller $v_2$ than the lighter quarks, probably reflecting a weaker collective behavior. This effect is not seen in the larger PbPb collision system at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 TeV, also presented.

Elliptic flow of charm and strange hadrons in high-multiplicity pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

First measurements of the elliptic flow of prompt D$^{0}$ mesons in comparison to $\\mathrm{K^0_S}$, $\\Lambda$, $\\Xi^{-}$, and $\\Omega^{-}$ hadrons in pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$ are reported. The results are based on data collected by the CMS experiment at the LHC and are presented for particles at midrapidity with transverse momentum up to 8 GeV/c after correcting for the contribution of back-to-back jet correlations. The results are compared to PbPb collision data at $\\sqrt{s_{_{NN}}} = 5.02~\\mathrm{TeV}$ for $30-50\\%$ centrality. A significant elliptic flow ($v_2$) signal is observed for all particles, in very high-multiplicity ($\\sim 200$ charged particles) pPb events. When divided by the number of constituent quarks and studied as function of the transverse kinetic energy per quark, the D$^{0}$ $v_2$ values are observed to be significantly smaller than those of light flavor particles, an effect not observed in PbPb collisions. These results show a weaker collective flow assoc...

Prospective evaluation of the diagnostic value of sensitive KIT D816V mutation analysis of blood in adults with suspected systemic mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, H; Bindslev-Jensen, C

2017-01-01

BACKGROUND: Sensitive KIT D816V mutation analysis of blood has been proposed to guide bone marrow (BM) investigation in suspected systemic mastocytosis (SM). The aim of this prospective study was for the first time to compare the D816V status of the "screening blood sample" used to guide BM biopsy...... in suspected SM to the outcome of the subsequent BM investigation. METHODS: Fifty-eight adult patients with suspected SM were included. The outcome of sensitive KIT D816V analysis of blood was compared to the result of the BM investigation. RESULTS: Screening blood samples from 44 of 58 patients tested D816V...... patients did not fulfill any diagnostic SM criteria (excluding tryptase criterion). Of the 48 SM patients, 90% tested D816V-positive. Thirteen SM patients presented with Hymenoptera venom-induced anaphylaxis, no skin lesions, and baseline serum tryptase ≤20 ng/mL. Of these, 92% tested D816V...

Inclusive J/$\\psi$ production at forward and backward rapidity in p-Pb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

CERN Document Server

Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

2018-01-01

Inclusive J/$\\psi$ production is studied in p-Pb interactions at a centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{NN}}$ = 8.16 TeV, using the ALICE detector at the CERN LHC. The J/$\\psi$ meson is reconstructed, via its decay to a muon pair, in the centre-of-mass rapidity intervals 2.03 < $y_{cms}$ < 3.53 and −4.46 < $y_{cms}$ < −2.96, where positive and negative $y_{cms}$ refer to the p-going and Pb-going direction, respectively. The transverse momentum coverage is $p_{T}$ < 20 GeV/$c$. In this paper, $y_{cms}$- and $p_{T}$-differential cross sections for inclusive J/$\\psi$ production are presented, and the corresponding nuclear modification factors RpPb are shown. Forward results show a suppression of the J/ψ yield with respect to pp collisions, concentrated in the region $p_{T}$ $\\lesssim$ 5 GeV/$c$. At backward rapidity no significant suppression is observed. The results are compared to previous measurements by ALICE in p-Pb collisions at $\\sqrt{s_{NN}}$ = 5.02 TeV and to...

KIT D816V mutation-positive cell fractions in lesional skin biopsies from adults with systemic mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

2013-01-01

Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized.......Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized....

Sensitive KIT D816V mutation analysis of blood as a diagnostic test in mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Bindslev-Jensen, Carsten

2014-01-01

The recent progress in sensitive KIT D816V mutation analysis suggests that mutation analysis of peripheral blood (PB) represents a promising diagnostic test in mastocytosis. However, there is a need for systematic assessment of the analytical sensitivity and specificity of the approach in order...... to establish its value in clinical use. We therefore evaluated sensitive KIT D816V mutation analysis of PB as a diagnostic test in an entire case-series of adults with mastocytosis. We demonstrate for the first time that by using a sufficiently sensitive KIT D816V mutation analysis, it is possible to detect...... the mutation in PB in nearly all adult mastocytosis patients. The mutation was detected in PB in 78 of 83 systemic mastocytosis (94%) and 3 of 4 cutaneous mastocytosis patients (75%). The test was 100% specific as determined by analysis of clinically relevant control patients who all tested negative. Mutation...

Targeted ultradeep next-generation sequencing as a method for KIT D816V mutation analysis in mastocytosis

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne

2016-01-01

mutation levels. In this study, we established an NGS-based KIT mutation analysis and analyzed the sensitivity of D816V detection using the Ion Torrent platform. Eighty-two individual NGS analyses were included in the study. All samples were also analyzed using highly sensitive KIT D816V mutation...

Determination of D816V mutation in the c-kIt gene in the Slovenian patients with acute myeloid leukemia and systemic mastocytosis

Directory of Open Access Journals (Sweden)

Martina Fink

2012-12-01

Full Text Available Background: D816V mutation in the C-KIT gene is present in more than 90 % of patients with systemic mastocytosis (SM and 2–7 % of patients with acute myeloid leukemia (AML. D816V mutation is caused by the substitution of adenine with thymine at 2447 nucleotide sequence in the C-KIT gene. This nucleotide substitution causes the replacment of aspartate acid by valine at codon 816 of the KIT protein. KIT protein with D816V mutation acts as constitutively active tyrosine kinase that promotes cell proliferation and inhibits apoptosis. The purpose of our study was to determine the incidence of D816V mutation in the C-KIT gene in Slovenian patients with AML and in patients with suspected systemic mastocytosis. Patients and methods: In the retrospective study, 71 patients with AML and 25 patients with suspected systemic mastocytosis were included. D816V mutation in the C-KIT gene was determined by polymerase chain reaction (PCR and the resulting PCR products were analyzed by agarose gel electrophoresis. Results: D816V mutation in KIT protein was determined in 7 % of patients with AML and in 32 % patients with suspected systemic mastocytosis. Conclusions: Identification of D816V mutation in the C-KIT gene must always be performed in patients with suspected systemic mastocytosis. The determination of this mutation contributes to the diagnosis and treatment selection. The finding of D816V mutation in the C-KIT gene in patients with AML and concomitant genetic modifications RUNX-RUNX1T1 (typical translocation t(8; 21 (q22, q22 or CBFB-MYH11, which is the result of inversion on chromosome 16–(inv (16 (p13, q22, however, indicates a faster, more aggressive course of the disease and predicts a worse outcome. The finding of the mutation in other patients with AML may indicate the presence of concomitant AML and SM, which was not found in our patients.

30 CFR 816.15 - Casing and sealing of drilled holes: Permanent.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Permanent...-SURFACE MINING ACTIVITIES § 816.15 Casing and sealing of drilled holes: Permanent. When no longer needed... exploration hole, other drilled hole or borehole, well, and other exposed underground opening shall be capped...

30 CFR 816.73 - Disposal of excess spoil: Durable rock fills.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess spoil: Durable rock fills...-SURFACE MINING ACTIVITIES § 816.73 Disposal of excess spoil: Durable rock fills. The regulatory authority may approve the alternative method of disposal of excess durable rock spoil by gravity placement in...

30 CFR 816.13 - Casing and sealing of drilled holes: General requirements.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: General...-SURFACE MINING ACTIVITIES § 816.13 Casing and sealing of drilled holes: General requirements. Each exploration hole, other drill or borehole, well, or other exposed underground opening shall be cased, sealed...

Lipofection of siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well culture system.

Science.gov (United States)

Ikeda, Shuntaro; Sugimoto, Miki; Kume, Shinichi

2018-04-13

Bovine preimplantation embryos exhibit dramatic biological changes between before and after the 8-16-cell stage. Here we report a simple lipofection method to transfect siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well (WOW) culture system. Bovine one-cell embryos produced in vitro were freed from the zona pellucida and cultured up to the 8-16-cell stage in WOW dishes. The 8-16-cell embryos were lipofected with siRNA and the transfection efficiency was assessed at 48 h of transfection. Lipofection with a red fluorescent non-targeting siRNA revealed the importance of zona removal for transfection of siRNA into embryos. Using this method, we knocked down the methionine adenosyltransferase 2A (MAT2A) gene, achieving a significant reduction in MAT2A expression (P lipofection', may be useful to analyze gene functions in bovine preimplantation embryos without expensive equipment and skill-intensive techniques.

30 CFR 816.87 - Coal mine waste: Burning and burned waste utilization.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Burning and burned waste...-SURFACE MINING ACTIVITIES § 816.87 Coal mine waste: Burning and burned waste utilization. (a) Coal mine... extinguishing operations. (b) No burning or burned coal mine waste shall be removed from a permitted disposal...

arXiv Top-quark pair production cross sections at NNLO+NNLL in pPb collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV

CERN Document Server

d'Enterria, David

Total and fiducial top pair ($t\\bar{t}$) production cross sections in proton-lead (pPb) collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV are computed at next-to-next-to-leading-order (NNLO) accuracy including next-to-next-to-leading-log (NNLL) gluon resummation, using the CT14 and CT10 proton parton distribution functions (PDF), and the EPPS16 and EPS09 nuclear PDF parametrizations for the lead ion. The total cross sections amount to $\\sigma(pPb\\to t\\bar{t}+X) = 59.0 \\pm 5.3$(CT14+EPPS16)$\\,^{+1.6}_{-2.1}$(scale) nb, and $57.5 \\pm \\,^{+4.3}_{-3.3}$(CT10+EPS09)$\\,^{+1.5}_{-2.0}$(scale) nb, with small modifications with respect to the result computed using the free proton PDF alone. The normalized ratio of pPb to pp cross sections (nuclear modification factor) is $R_{pPb} = 1.04 \\,^{\\pm 0.07(EPPS16)}_{\\pm0.03(EPS09)}$. In the lepton+jets decay mode, $t\\bar{t} \\to b\\bar{b} W(\\ell\

Improved detection of the KIT D816V mutation in patients with systemic mastocytosis using a quantitative and highly sensitive real-time qPCR assay

DEFF Research Database (Denmark)

Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Møller, Michael Boe

2011-01-01

The vast majority of patients with systemic mastocytosis (SM) carry the somatic D816V mutation in the KIT gene. The KIT D816V mutation is one of the minor criteria for a diagnosis of SM according to the 2008 World Health Organization classification of myeloproliferative neoplasms. In the present ...

The TI-Nspire CAS: A Happy-Medium Mobile Device for Grades 8-16 Mathematics Classrooms

Science.gov (United States)

Zelkowski, Jeremy

2011-01-01

This article justifies classifying the TI-Nspire CAS Touchpad as a mobile device for grades 8-16 mathematics classrooms equipped with a Navigator system. The 2010 Horizon Report: K-12 indicates virtually every secondary school aged child has some sort of mobile device. Yet, many school policies ban the use of mobile devices, preventing students…

Study of collective flow of inclusive muons in p–Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 8.16 TeV with ALICE

CERN Document Server

Chetcuti, Wayne Jordan

2017-01-01

This work focuses on the results obtained from the ALICE muon spectrometer for the measurement of the elliptic flow of muons at forward rapidity in p–Pb collisions at 8.16 TeV. The muon triggered data sample that was used, gave the minimum-bias data sample, as well as sufficient statistics at intermediate and high $p_T$ . The correction for the non-uniform detector appearance was performed and the Generic Q-cumulant method for 2- and 4-particle correlations was applied to get the elliptic flow of inclusive muons. From the results of the elliptic flow, it was suggested that the observed hydrodynamic-like particle correlations at high multiplicity in small systems may come out from the same underlying physics mechanisms as that in heavy-ion collisions.

$D$ meson production and long-range azimuthal correlation in $8.16~\\mathrm{TeV}$ $p$+Pb collisions with ATLAS

CERN Document Server

The ATLAS collaboration

2017-01-01

The production of $D^{0}(\\overline{D^0})$ and $D^{*\\pm}$ mesons has been measured with the ATLAS detector in $p$+Pb collisions at $\\sqrt{s_{_\\mathrm{NN}}}=8.16~\\mathrm{TeV}$ with an integrated luminosity of $76.3\\mu b^{-1}$ taken in 2016. The $D$ meson production asymmetry between forward ($0 < y^* < 0.5$) and backward ($-0.5 < y^* < 0$) center-of-mass rapidities is studied, and no significant asymmetry is observed. Azimuthal correlations between inclusive $D^{*\\pm}$ and charged particles are also presented in intervals of event-wise charged-particle multiplicity. The second-order harmonic coefficients for inclusive $D^{*\\pm}$ and charged particles azimuthal correlation have been extracted using template fits.

Mutation D816V alters the internal structure and dynamics of c-KIT receptor cytoplasmic region: implications for dimerization and activation mechanisms.

Directory of Open Access Journals (Sweden)

Elodie Laine

2011-06-01

Full Text Available The type III receptor tyrosine kinase (RTK KIT plays a crucial role in the transmission of cellular signals through phosphorylation events that are associated with a switching of the protein conformation between inactive and active states. D816V KIT mutation is associated with various pathologies including mastocytosis and cancers. D816V-mutated KIT is constitutively active, and resistant to treatment with the anti-cancer drug Imatinib. To elucidate the activating molecular mechanism of this mutation, we applied a multi-approach procedure combining molecular dynamics (MD simulations, normal modes analysis (NMA and binding site prediction. Multiple 50-ns MD simulations of wild-type KIT and its mutant D816V were recorded using the inactive auto-inhibited structure of the protein, characteristic of type III RTKs. Computed free energy differences enabled us to quantify the impact of D816V on protein stability in the inactive state. We evidenced a local structural alteration of the activation loop (A-loop upon mutation, and a long-range structural re-organization of the juxta-membrane region (JMR followed by a weakening of the interaction network with the kinase domain. A thorough normal mode analysis of several MD conformations led to a plausible molecular rationale to propose that JMR is able to depart its auto-inhibitory position more easily in the mutant than in wild-type KIT and is thus able to promote kinase mutant dimerization without the need for extra-cellular ligand binding. Pocket detection at the surface of NMA-displaced conformations finally revealed that detachment of JMR from the kinase domain in the mutant was sufficient to open an access to the catalytic and substrate binding sites.

Pediatric acute myeloid leukemia with t(8;16)(p11;p13), a distinct clinical and biological entity: a collaborative study by the International-Berlin-Frankfurt-Münster AML-study group

Science.gov (United States)

Coenen, Eva A.; Zwaan, C. Michel; Reinhardt, Dirk; Harrison, Christine J.; Haas, Oskar A.; de Haas, Valerie; Mihál, Vladimir; De Moerloose, Barbara; Jeison, Marta; Rubnitz, Jeffrey E.; Tomizawa, Daisuke; Johnston, Donna; Alonzo, Todd A.; Hasle, Henrik; Auvrignon, Anne; Dworzak, Michael; Pession, Andrea; van der Velden, Vincent H. J.; Swansbury, John; Wong, Kit-fai; Terui, Kiminori; Savasan, Sureyya; Winstanley, Mark; Vaitkeviciene, Goda; Zimmermann, Martin; Pieters, Rob; van den Heuvel-Eibrink, Marry M.

2013-01-01

In pediatric acute myeloid leukemia (AML), cytogenetic abnormalities are strong indicators of prognosis. Some recurrent cytogenetic abnormalities, such as t(8;16)(p11;p13), are so rare that collaborative studies are required to define their prognostic impact. We collected the clinical characteristics, morphology, and immunophenotypes of 62 pediatric AML patients with t(8;16)(p11;p13) from 18 countries participating in the International Berlin-Frankfurt-Münster (I-BFM) AML study group. We used the AML-BFM cohort diagnosed from 1995-2005 (n = 543) as a reference cohort. Median age of the pediatric t(8;16)(p11;p13) AML patients was significantly lower (1.2 years). The majority (97%) had M4-M5 French-American-British type, significantly different from the reference cohort. Erythrophagocytosis (70%), leukemia cutis (58%), and disseminated intravascular coagulation (39%) occurred frequently. Strikingly, spontaneous remissions occurred in 7 neonates with t(8;16)(p11;p13), of whom 3 remain in continuous remission. The 5-year overall survival of patients diagnosed after 1993 was 59%, similar to the reference cohort (P = .14). Gene expression profiles of t(8;16)(p11;p13) pediatric AML cases clustered close to, but distinct from, MLL-rearranged AML. Highly expressed genes included HOXA11, HOXA10, RET, PERP, and GGA2. In conclusion, pediatric t(8;16)(p11;p13) AML is a rare entity defined by a unique gene expression signature and distinct clinical features in whom spontaneous remissions occur in a subset of neonatal cases. PMID:23974201

Information about diagnosis and prognosis related to anxiety and depression in children with cancer aged 8-16 years

NARCIS (Netherlands)

Last, B. F.; van Veldhuizen, A. M.

1996-01-01

The aim of this study was to test the hypothesis that being openly informed about the diagnosis and prognosis benefits the emotional well-being of children with cancer. A stratified sample of 56 children with cancer aged 8-16 years and their parents participated. The parents were interviewed about

Prompt and isolated photons in 8.16 TeV p+Pb collisions with ATLAS

CERN Document Server

Hill, Kurt Keys; The ATLAS collaboration

2018-01-01

The inclusive production cross-section for isolated, prompt photons in p+Pb collisions at √sNN = 8.16 TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of 162 nb−1. The cross-section is measured as a function of photon transverse energy from 25 to 500 GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton– and nucleus–going directions. Results are reported in the nucleon–nucleon center of mass collision frame. The nuclear modification factor RpPb is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in pp collisions at 8 TeV. The cross-sections and RpPb values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-section is suppressed due to the different up and down valence...

Systemic mastocytosis uncommon in KIT D816V mutation positive core-binding factor acute myeloid leukemia

DEFF Research Database (Denmark)

Kristensen, Thomas; Preiss, Birgitte; Broesby-Olsen, Sigurd

2012-01-01

Abstract The KIT D816V mutation is detected in the vast majority of adult cases of systemic mastocytosis (SM). The mutation is also frequently detected in core-binding factor acute myeloid leukemia (CBF-AML) defined by the presence of t(8;21)(q22;q22); RUNX1-RUNX1T1 or inv(16)(p13.1;q22)/t(16;16)(p...

Differential effects of CSF-1R D802V and KIT D816V homologous mutations on receptor tertiary structure and allosteric communication.

Directory of Open Access Journals (Sweden)

Priscila Da Silva Figueiredo Celestino Gomes

Full Text Available The colony stimulating factor-1 receptor (CSF-1R and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs, are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR and facilitated its departure from the kinase domain (KD. In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind.

Differential Effects of CSF-1R D802V and KIT D816V Homologous Mutations on Receptor Tertiary Structure and Allosteric Communication

Science.gov (United States)

Da Silva Figueiredo Celestino Gomes, Priscila; Panel, Nicolas; Laine, Elodie; Pascutti, Pedro Geraldo; Solary, Eric; Tchertanov, Luba

2014-01-01

The colony stimulating factor-1 receptor (CSF-1R) and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs), are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR) and facilitated its departure from the kinase domain (KD). In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind. PMID:24828813

Observation of prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ meson elliptic flow in high-multiplicity pPb collisions at $\\sqrt{s_{_{\\mathrm{NN}}}} = 8.16~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2018-01-01

The measurement of the elliptic flow of prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ mesons in high-multiplicity pPb collisions is reported using a data sample collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy $\\sqrt{s_{_{\\mathrm{NN}}}} = 8.16~\\mathrm{TeV}$. The $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ mesons are reconstructed using the dimuon channel with both muons detected in a forward rapidity region with either $-2.86 < y_{\\rm cm} < -1.86$ or $0.94 < y_{\\rm cm}< 1.94$. Significant and positive $v_2$ values are measured for the prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ meson, as extracted from long-range two-particle correlations with charged hadrons, over the transverse momentum range of $2 < p_{\\mathrm{T}} < 8~\\mathrm{GeV}$. This measurement provides direct evidence for charm quark collectivity in a small collision system. By comparing the prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ results with previous CMS measurement...

Cisco CCNA/CCENT Exam 640-802, 640-822, 640-816 Preparation Kit With Cisco Router Simulations

CERN Document Server

Liu, Dale

2009-01-01

Three exams, two certifications, one complete Cisco training solution for networking professionals! .. .. The CCNA exam is an entry-level IT certification from Cisco Systems for professionals installing and maintaining route and switched networks. The current exam material covers networking concepts along with new and updated content on network security fundamentals and the basics of wireless networking. .. .. This book can be used as a study guide for either track you choose to receive your CCNA – the single exam, 640-802 or the combined 640-822 and 640-816, and for the CCENT certification wh

77 FR 72252 - Airworthiness Directives; Reims Aviation S.A. Airplanes

Science.gov (United States)

2012-12-05

... material used in nose landing gear (NLG) attachment brackets which could lead to failure of the NLG bracket..., Kansas City, Missouri 64106. For information on the availability of this material at the FAA, call (816..., 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090...

D meson production and long-range azimuthal correlation in 8.16 TeV p+Pb collisions with ATLAS

CERN Document Server

Hu, Qipeng; The ATLAS collaboration

2018-01-01

Measurements of prompt charm mesons ($D^0$ and $D^*$) productions and azimuthal correlations between inclusive $D^*$ and charged particles are presented in p+Pb collisions data at 8.16 TeV collected in 2016 by ATLAS. No significant production asymmetry between forward and backward and asymmetry is observed. A finite $2\\cos(2\\Delta\\phi)$ modulation for inclusive $D^*$ is observed with a $1\\sim2\\sigma$ significance, depending on multiplicity, broadly consistent with what have been observed for light hadrons and HF muons.

Applications of Direct Analysis in Real Time-Mass Spectrometry (DART-MS) in Allium Chemistry. (Z)-Butanethial S-Oxide and 1-Butenyl Thiosulfinates and Their S-(E)-1-Butenylcysteine S-Oxide Precursor from Allium siculum

Czech Academy of Sciences Publication Activity Database

Kubec, R.; Cody, R.B.; Dane, A.J.; Musah, R.A.; Schraml, Jan; Vattekkatte, A.; Block, E.

2010-01-01

Roč. 58, č. 2 (2010), s. 1121-1128 ISSN 0021-8561 R&D Projects: GA AV ČR IAA400720706 Grant - others:NSF(US) CHE-0744578 Institutional research plan: CEZ:AV0Z40720504 Keywords : allium siculum * nectaroscordum * allium cepa Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.816, year: 2010

The transcriptome of the human mast cell leukemia cells HMC-1.2: an approach to identify specific changes in the gene expression profile in KitD816V systemic mastocytosis.

Science.gov (United States)

Haenisch, B; Herms, S; Molderings, G J

2013-05-01

To circumvent the costly isolation procedure associated with tissue mast cells, human mast cell lines such as HMC-1 are employed in mastocytosis research, but their relation to mutated mast cells in systemic mastocytosis has not been investigated systematically. In the present study, we determined the transcriptome of HMC-1.2 cells and compared the expression data with those reported in the literature for normal human resting lung and tonsillar mast cells as well as leukocytes from peripheral blood and mononuclear cells from bone marrow aspirates of patients with D816 V-positive systemic mastocytosis. Our results suggest that HMC-1.2 cells are an appropriate model for the investigation of this variant of systemic mast cell activation disease. The data confirm previous suggestions that the pathologically increased activity of mast cells in patients with D816 V-positive systemic mastocytosis can be deduced from the detection of mutation-related changes in the gene expression profile in leukocytes from peripheral blood and in mononuclear cells from bone marrow aspirates. Thus, mutation-related changes of the expression profile can serve as surrogates (besides clustering of mast cells, expression of CD25, and increased release of tryptase) for the presence of the mutation D816 V in tyrosine kinase Kit in patients with systemic mastocytosis according to the WHO criteria. Whether this also holds true for systemic mast cell activation disease caused by other mutations in Kit or other mast cell activity-related genes is a subject for future studies.

77 FR 33127 - Airworthiness Directives; HPH s. r.o. Sailplanes

Science.gov (United States)

2012-06-05

... available in the AD docket shortly after receipt. FOR FURTHER INFORMATION CONTACT: Taylor Martin, Aerospace...: (816) 329-4138; fax: (816) 329-4090; email: taylor[email protected] . SUPPLEMENTARY INFORMATION: Comments... sailplane. (f) Actions and Compliance Unless already done, do the following actions in accordance with HPH...

78 FR 11978 - Airworthiness Directives; Reims Aviation S.A. Airplanes

Science.gov (United States)

2013-02-21

... used in nose landing gear (NLG) attachment brackets could lead to failure of the NLG bracket with... referenced service information at the FAA, Small Airplane Directorate, 901 Locust, Kansas City, Missouri..., Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: [email protected]..

78 FR 19088 - Airworthiness Directives; REIMS AVIATION S.A. Airplanes

Science.gov (United States)

2013-03-29

... the FAA, call (816) 329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA...; fax: (816) 329-4090; email: albert.mercado@faa.gov . SUPPLEMENTARY INFORMATION: Discussion We issued a... procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace Engineer, FAA, Small...

78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes

Science.gov (United States)

2013-01-03

... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa... requested using the procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace...

Pediatric acute myeloid leukemia with t(8;16)(p11;p13), a distinct clinical and biological entity: A collaborative study by the International-Berlin- Frankfurt-Münster AML-study group

NARCIS (Netherlands)

E.A. Coenen (Eva); C.M. Zwaan (Christian Michel); D. Reinhardt (Dirk); C.J. Harrison (Christine); O.A. Haas (Oskar); V. de Haas (Valerie); V. Mihál (Vladimir); B. de Moerloose (Barbara); M. Jeison (Marta); J.E. Rubnitz (Jeffrey); D. Tomizawa (Daisuke); D. Johnston (Donna); T.A. Alonzo (Todd); H. Hasle (Henrik); A. Auvrignon (Anne); M.N. Dworzak (Michael); A. Pession (Andrea); V.H.J. van der Velden (Vincent); J. Swansbury (John); K.-F. Wong (Kit-Fai); N. Terui (Nobuhiko); S. Savasan (Sureyya); M. Winstanley (Mark); G. Vaitkeviciene (Goda); M. Zimmermann (Martin); R. Pieters (Rob); M.M. van den Heuvel-Eibrink (Marry)

2013-01-01

textabstractIn pediatric acute myeloid leukemia (AML), cytogenetic abnormalities are strong indicators of prognosis. Some recurrent cytogenetic abnormalities, such as t(8;16)(p11;p13), are so rare that collaborative studies are required to define their prognostic impact. We collected the clinical

Two-particle correlations on transverse momentum and momentum dissipation in Au-Au collisions at (sNN) = 130 GeV

Czech Academy of Sciences Publication Activity Database

Adams, J.; Bielčík, J.; Bielčíková, J.; Bysterský, Michal; Chaloupka, Petr; Jakl, P.; Kapitán, J.; Kushpil, Vasilij; Lednický, R.; Pachr, M.; Šumbera, Michal

2007-01-01

Roč. 34, č. 5 (2007), s. 799-816 ISSN 0954-3899 R&D Projects: GA ČR GA202/04/0793 Institutional research plan: CEZ:AV0Z10480505 Keywords : two -particle correlations Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.485, year: 2007

KIT D816V Positive Acute Mast Cell Leukemia Associated with Normal Karyotype Acute Myeloid Leukemia.

Science.gov (United States)

Lopes, Marta; Teixeira, Maria Dos Anjos; Casais, Cláudia; Mesquita, Vanessa; Seabra, Patrícia; Cabral, Renata; Palla-García, José; Lau, Catarina; Rodrigues, João; Jara-Acevedo, Maria; Freitas, Inês; Vizcaíno, Jose Ramón; Coutinho, Jorge; Escribano, Luis; Orfao, Alberto; Lima, Margarida

2018-01-01

Mast cell (MC) leukemia (MCL) is extremely rare. We present a case of MCL diagnosed concomitantly with acute myeloblastic leukemia (AML). A 41-year-old woman presented with asthenia, anorexia, fever, epigastralgia, and diarrhea. She had a maculopapular skin rash, hepatosplenomegaly, retroperitoneal adenopathies, pancytopenia, 6% blast cells (BC) and 20% MC in the peripheral blood, elevated lactate dehydrogenase, cholestasis, hypoalbuminemia, hypogammaglobulinemia, and increased serum tryptase (184  μ g/L). The bone marrow (BM) smears showed 24% myeloblasts, 17% promyelocytes, and 16% abnormal toluidine blue positive MC, and flow cytometry revealed 12% myeloid BC, 34% aberrant promyelocytes, a maturation blockage at the myeloblast/promyelocyte level, and 16% abnormal CD2-CD25+ MC. The BM karyotype was normal, and the KIT D816V mutation was positive in BM cells. The diagnosis of MCL associated with AML was assumed. The patient received corticosteroids, disodium cromoglycate, cladribine, idarubicin and cytosine arabinoside, high-dose cytosine arabinoside, and hematopoietic stem cell transplantation (HSCT). The outcome was favorable, with complete hematological remission two years after diagnosis and one year after HSCT. This case emphasizes the need of an exhaustive laboratory evaluation for the concomitant diagnosis of MCL and AML, and the therapeutic options.

D meson production and long-range azimuthal correlation in 8.16 TeV p+Pb collisions with ATLAS

CERN Document Server

Hu, Qipeng; The ATLAS collaboration

2017-01-01

Measurements of production of prompt charm mesons (D0 and D*) and azimuthal correlations between inclusive D* and charged particles are presented in p+Pb collisions data at 8.16 TeV collected in 2016 by ATLAS. The prompt charm meson production is measured in minimum bias p+Pb data, reconstructed via two decay channels: D0->K+pi and D*->D0+pi->K+pi+pi. The production asymmetry between forward and backward center-of-mass rapidities for the charm mesons is studied for the range of |y*| < 0.5, and no significant asymmetry is observed. In the D*-hadron correlations, the pT of identified D* is more closely related to the pt of primordial heavy quarks, relative to the measurement of their decay muons. A finite elliptic harmonic coefficient for inclusive D* and charge particles have been extracted with a significance of one to two standard deviations, depending on multiplicity, broadly consistent with what have been observed for light hadrons and muons from heavy quark decaying.

DMPD: TLR signaling. [Dynamic Macrophage Pathway CSML Database

Lifescience Database Archive (English)

Full Text Available kira S. Publication Cell Death Differ. 2006 May;13(5):816-25. Pathway - PNG File (.png) SVG File (.svg) HTML File (.html...16410796 TLR signaling. Kawai T, Akira S. Cell Death Differ. 2006 May;13(5):816-25. (.png) (.svg) (.html

2016 Accomplishments. Tritium aging studies on stainless steel. Forging process effects on the fracture toughness properties of tritium-precharged stainless steel

Energy Technology Data Exchange (ETDEWEB)

Morgan, Michael J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

2017-01-01

Forged austenitic stainless steels are used as the materials of construction for pressure vessels designed to contain tritium at high pressure. These steels are highly resistant to tritium-assisted fracture but their resistance can depend on the details of the forging microstructure. During FY16, the effects of forging strain rate and deformation temperature on the fracture toughness properties of tritium-exposed-and-aged Type 304L stainless steel were studied. Forgings were produced from a single heat of steel using four types of production forging equipment – hydraulic press, mechanical press, screw press, and high-energy-rate forging (HERF). Each machine imparted a different nominal strain rate during the deformation. The objective of the study was to characterize the J-Integral fracture toughness properties as a function of the industrial strain rate and temperature. The second objective was to measure the effects of tritium and decay helium on toughness. Tritium and decay helium effects were measured by thermally precharging the as-forged specimens with tritium gas at 34.5 MPa and 350°C and aging for up to five years at -80°C to build-in decay helium prior to testing. The results of this study show that the fracture toughness properties of the as-forged steels vary with forging strain rate and forging temperature. The effect is largely due to yield strength as the higher-strength forgings had the lower toughness values. For non-charged specimens, fracture toughness properties were improved by forging at 871°C versus 816°C and Screw-Press forgings tended to have lower fracture toughness values than the other forgings. Tritium exposures reduced the fracture toughness values remarkably to fracture toughness values averaging 10-20% of as-forged values. However, forging strain rate and temperature had little or no effect on the fracture toughness after tritium precharging and aging. The result was confirmed by fractography which indicated that fracture modes

Measurement of correlated azimuthal anisotropy Fourier harmonics with subevent cumulants in pPb collisions at 8.16 TeV

CERN Document Server

CMS Collaboration

2018-01-01

Event-by-event correlations of azimuthal anisotropy Fourier coefficients ($v_n$) in 8.16 TeV pPb data are extracted using a subevent four-particle cumulant technique with the CMS experiment at the LHC. Each combination of four particles is required to fall into two, three or four distinct subevents within the full pseudorapidity range from -2.4 to 2.4 using tracks with transverse momentum between 0.3 and 3.0 GeV/c. Using the subevent technique, $v_n$ correlations are measured as a function of particle multiplicity and compared to the standard method without using subevents. At high multiplicity, $v_2$ and $v_3$ anticorrelation exhibits a consistent behavior among the various methods. The $v_2$ and $v_4$ correlation strength is found to depend on the number of subevents used in the calculation. Toward the low-multiplicity region, data from different methods diverge because of different contributions of few-particle correlations. The results presented represent a key step in understanding the onset of collectiv...

75 FR 30268 - Airworthiness Directives; AeroSpace Technologies of Australia Pty Ltd Models N22B, N22S, and N24A...

Science.gov (United States)

2010-06-01

... cap, near the wing strut attachment. We are issuing this AD to require actions to correct the unsafe... City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090; e-mail: [email protected] strut attachment. Amendment 1 adopts the manufacturer's latest service bulletin. Its new inspection...

Efeito da intensidade do exercício de corrida intermitente 30s:15s no tempo de manutenção no ou próximo do VO2max Effect of intensity of intermittent running exercise 30s:15s at the time maintenance at or near VO2max

Directory of Open Access Journals (Sweden)

Rafael Alves de Aguiar

2013-03-01

Full Text Available O presente estudo comparou o tempo mantido acima de 90% (t90VO2max e de 95% VO2max (t95VO2max em três diferentes intensidades de exercício. Após a realização de um teste incremental para determinar o VO2max, oito estudantes de educação física ativos (23 ± 3 anos executaram três sessões de exercícios intermitentes (100, 110 e 120% da velocidade do VO2max (vVO2max com razão esforço:recuperação de 30s:15s. O t95VO2max foi significantemente maior em 110%vVO2max (EI110% (218,1 ± 81,6 s quando comparado a 100%vVO2max (EI100% (91,9 ± 75,2s e a 120%vVO2max (EI120% (126,3 ± 29,4 s, porém sem diferença entre EI100% e EI120%. O t90VO2max somente apresentou diferença significante entre EI110% e EI120%. Portanto, conclui-se que durante exercício intermitente com razão 30s:15s, a intensidade de 110%vVO2max apresenta-se mais adequada para manter o VO2 próximo ou no VO2max por um tempo maior.The present study compared the time maintained above 90% (t90VO2max or 95% VO2max (t95VO2max in three different exercise intensities. After performing an incremental test to determine VO2max, eight physical education active students (23 ± 3 years performed three intermittent exercise sessions (100, 110 e 120% velocity of VO2max (vVO2max with ratio effort:recovery of 30s:15s. The t95%VO2max was significantly higher at 110%vVO2max (EI110% (218.1 ± 81.6s compared to 100% vVO2max (EI100% (91.9 ± 75.2s and 120%vVO2max (EI120% (126.3 ± 29.4s, but without differences between EI100% and EI120%. The t90%vVO2max was significantly different only between EI110% and 120%. Therefore, we conclude that during intermittent exercise with ratio 30s:15s, the intensity of 110%vVO2max appears more appropriate to maintain VO2max for a longer time.

Forging the frontiers: Travellers and documents on the South Africa-Mozambique border, 1890s-1940s

Directory of Open Access Journals (Sweden)

Andrew MacDonald

Full Text Available It is well known that the Union of South Africa started to build an onerous border regime at the turn of the twentieth century in order to secure a White Man's Country in southern Africa. Newly formed, ambitious Immigration Departments consequently targeted 'Asiatics', poor whites and finally 'surplus' Africans from the 1920s onwards. An infrastructure of exclusion (detention and deportation compounds, police patrols, fingerprint offices and so on soon emerged at the region's maritime gateways as the colonial states sought to undermine decentralised indigenous societies characterised by long-term mobility. This article shows that the Union remained vulnerable on its eastern frontier with Mozambique and Swaziland, where 'undesirables' continued to arrive in numbers. Long-distance movement had a long precedent in these borderlands, and it proved difficult for colonial states to forge effective border controls until deep into the twentieth century. Based on extensive and critical engagement with multiple border control archives, the article traces the gradual 'paperisation of the border, and follows a thriving market in identity permits in southern Mozambique and Swaziland, which became important backdoor entry points to the Union. The main people to exploit corrupt local officials and entrepreneurial headmen on either side of the border were those associated with the merchant houses of coastal west India, syndicates from the Portuguese Atlantic island of Madeira, and long-distance, so-called 'tropical', African migrants. Together they forged sophisticated networks that moved permits, people and money across the region and gave south-east Africa's border builders hard and often thankless paperwork.

Communication and coping as predictors of fertility problem stress: cohort study of 816 participants who did not achieve a delivery after 12 months of fertility treatment

DEFF Research Database (Denmark)

Schmidt, L; Holstein, B E; Christensen, Ulla

2005-01-01

BACKGROUND: We investigated coping strategies and communication strategies as predictors of fertility problem stress 12 months after start of fertility treatment. METHODS: We used a prospective, longitudinal cohort design including 2250 people beginning fertility treatment with a 12-month follow......-up. Data were based on self-administered questionnaires measuring communication with partner and with other people, coping strategies: active-avoidance coping, active-confronting coping, passive-avoidance coping, meaning-based coping, and fertility problem stress. The study population included those...... participants (n = 816, men and women) who had not achieved pregnancy by assisted reproduction or delivery at follow-up. RESULTS: Among both men and women, difficulties in partner communication predicted high fertility problem stress (odds ratio for women, 3.47, 95% confidence interval 2.09-5.76; odds ratio...

Military Operations Research Society Symposium (70th): Military Operations Research at the Next Frontier. Held at Fort Leavenworth, Kansas on 18-20 June 2002. Final Program and Book of Abstracts.

Science.gov (United States)

2002-05-20

Bowling Center Snack Bar variety, grilled orders Restaurants In Leavenworth Area Many of the nationally franchised "fast-food" eateries are available in... Cafe 608 Main Weston, MO 816-640-2835 *Fannie’s (Home Style Buffet) 600 Prairie View Rd Platte City, MO 816-431-5675 High Noon Saloon & Brewery 206

Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety

Science.gov (United States)

Forging New Cocoa Keys: The Impact of Unlocking the Cocoa Bean’s Genome on Pre-harvest Food Safety David N. Kuhn, USDA ARS SHRS, Miami FL Sometimes it's hard to see the value and application of genomics to real world problems. How will sequencing the cacao genome affect West African farmers? Thi...

78 FR 68357 - Airworthiness Directives; Aermacchi S.p.A. Airplanes

Science.gov (United States)

2013-11-14

..., Kansas City, Missouri 64106. For information on the availability of this material at the FAA, call (816... . SUPPLEMENTARY INFORMATION: Discussion The European Aviation Safety Agency (EASA), which is the Technical Agent... Societa Finmeccanica has issued Mandatory Bollettino Tecnico (English Translation: Technical Bulletin) No...

27 CFR 447.22 - Forgings, castings, and machined bodies.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Forgings, castings, and... IMPLEMENTS OF WAR The U.S. Munitions Import List § 447.22 Forgings, castings, and machined bodies. Articles on the U.S. Munitions Import List include articles in a partially completed state (such as forgings...

Search for Large Extra Dimensions via Single Photons Plus Missing Energy Final States at √s = 1.96 TeV

Energy Technology Data Exchange (ETDEWEB)

Carrera, Edgar Fernando [Florida State Univ., Tallahassee, FL (United States)

2008-12-01

This dissertation presents a search for large extra dimensions in the single photon plus missing transverse energy final states. We use a data sample of approximately 2.7 fb^-1 of p$\\bar{p}$ collisions at √s = 1.96 TeV (recorded with the D^- detector) to investigate direct Kaluza Klein graviton production and set limits, at the 95% C.L., on the fundamental mass scale M_D from 970 GeV to 816 GeV for two to eight extra dimensions.

Disruption of dopamine homeostasis has sexually dimorphic effects on senescence characteristics of Drosophila melanogaster

Czech Academy of Sciences Publication Activity Database

Bednářová, Andrea; Hanna, M. E.; Rakshit, K.; O’Donnell, J. M.; Krishnan, N.

2017-01-01

Roč. 45, č. 6 (2017), s. 816-825 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LH14047 Grant - others:GA JU(CZ) 038/2014/P Institutional support: RVO:60077344 Keywords : 4-hydroxynonenal * aging * circadian rhythms Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.941, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/ejn.13525/pdf

γ-decay of {}_{8}^{16}{{\\rm{O}}}_{8}\\,{and}\\,{}_{7}^{16}{{\\rm{N}}}_{9} in proton-neutron Tamm-Dancoff and random phase approximations with optimized surface δ interaction

Science.gov (United States)

Pahlavani, M. R.; Firoozi, B.

2016-09-01

γ-ray transitions from excited states of {}16{{N}} and {}16{{O}} isomers that appear in the γ spectrum of the {}616{{{C}}}10\\to {}716{{{N}}}9\\to {}816{{{O}}}8 beta decay chain are investigated. The theoretical approach used in this research starts with a mean-field potential consisting of a phenomenological Woods-Saxon potential including spin-orbit and Coulomb terms (for protons) in order to obtain single-particle energies and wave functions for nucleons in a nucleus. A schematic residual surface delta interaction is then employed on the top of the mean field and is treated within the proton-neutron Tamm-Dancoff approximation (pnTDA) and the proton-neutron random phase approximation. The goal is to use an optimized surface delta interaction interaction, as a residual interaction, to improve the results. We have used artificial intelligence algorithms to establish a good agreement between theoretical and experimental energy spectra. The final results of the ‘optimized’ calculations are reasonable via this approach.

UCAC and URAT: Optical Astrometric Catalog Observing Programs

Science.gov (United States)

2010-09-21

12 100 K 1.0 1997 Tycho-2 G/S yes <= 12 2.5 M 10..100 2000 UCAC G yes 8..16 100 M 20.. 70 2004+ 2MASS G no IR...UCAC3 G yes 8..16 100 M 20.. 70 2009 first CCD survey 2MASS G no IR 500 M 90 2003 1 epoch USNO-B G yes 12..21 1000 M 200 2003 Schmidt plates PanSTARRS G

Adsorption of DNA/RNA nucleobases onto single-layer MoS2 and Li-Doped MoS2: A dispersion-corrected DFT study

Science.gov (United States)

Sadeghi, Meisam; Jahanshahi, Mohsen; Ghorbanzadeh, Morteza; Najafpour, Ghasem

2018-03-01

The kind of sensing platform in nano biosensor plays an important role in nucleic acid sequence detection. It has been demonstrated that graphene does not have an intrinsic band gap; therefore, transition metal dichalcogenides (TMDs) are desirable materials for electronic base detection. In the present work, a comparative study of the adsorption of the DNA/RNA nucleobases [Adenine (A), Cytosine (C) Guanine (G), Thymine (T) and Uracil (U)] onto the single-layer molybdenum disulfide (MoS2) and Li-doped MoS2 (Li-MoS2) as a sensing surfaces was investigated by using Dispersion-corrected Density Functional Theory (D-DFT) calculations and different measure of equilibrium distances, charge transfers and binding energies for the various nucleobases were calculated. The results revealed that the interactions between the nucleobases and the MoS2 can be strongly enhanced by introducing metal atom, due to significant charge transfer from the Li atom to the MoS2 when Lithium is placed on top of the MoS2. Furthermore, the binding energies of the five nucleobases were in the range of -0.734 to -0.816 eV for MoS2 and -1.47 to -1.80 eV for the Li-MoS2. Also, nucleobases were adsorbed onto MoS2 sheets via the van der Waals (vdW) force. This high affinity and the renewable properties of the biosensing platform demonstrated that Li-MoS2 nanosheet is biocompatible and suitable for nucleic acid analysis.

22 CFR 121.10 - Forgings, castings and machined bodies.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Forgings, castings and machined bodies. 121.10... STATES MUNITIONS LIST Enumeration of Articles § 121.10 Forgings, castings and machined bodies. Articles on the U.S. Munitions List include articles in a partially completed state (such as forgings...

Dicty_cDB: VHI816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

C-terminal BRE overexpression in 11q23-rearranged and t(8;16) acute myeloid leukemia is caused by intragenic transcription initiation.

Science.gov (United States)

Marneth, A E; Prange, K H M; Al Hinai, A S A; Bergevoet, S M; Tesi, N; Janssen-Megens, E M; Kim, B; Sharifi, N; Yaspo, M L; Kuster, J; Sanders, M A; Stoetman, E C G; Knijnenburg, J; Arentsen-Peters, T C J M; Zwaan, C M; Stunnenberg, H G; van den Heuvel-Eibrink, M M; Haferlach, T; Fornerod, M; Jansen, J H; Valk, P J M; van der Reijden, B A; Martens, J H A

2018-03-01

Overexpression of the BRE (brain and reproductive organ-expressed) gene defines a distinct pediatric and adult acute myeloid leukemia (AML) subgroup. Here we identify a promoter enriched for active chromatin marks in BRE intron 4 causing strong biallelic expression of a previously unknown C-terminal BRE transcript. This transcript starts with BRE intron 4 sequences spliced to exon 5 and downstream sequences, and if translated might code for an N terminally truncated BRE protein. Remarkably, the new BRE transcript was highly expressed in over 50% of 11q23/KMT2A (lysine methyl transferase 2A)-rearranged and t(8;16)/KAT6A-CREBBP cases, while it was virtually absent from other AML subsets and normal tissues. In gene reporter assays, the leukemia-specific fusion protein KMT2A-MLLT3 transactivated the intragenic BRE promoter. Further epigenome analyses revealed 97 additional intragenic promoter marks frequently bound by KMT2A in AML with C-terminal BRE expression. The corresponding genes may be part of a context-dependent KMT2A-MLLT3-driven oncogenic program, because they were higher expressed in this AML subtype compared with other groups. C-terminal BRE might be an important contributor to this program because in a case with relapsed AML, we observed an ins(11;2) fusing CHORDC1 to BRE at the region where intragenic transcription starts in KMT2A-rearranged and KAT6A-CREBBP AML.

FLAG-induced remission in a patient with acute mast cell leukemia (MCL exhibiting t(7;10(q22;q26 and KIT D816H

Directory of Open Access Journals (Sweden)

Peter Valent

2014-01-01

Full Text Available Mast cell leukemia (MCL is a life-threatening disease associated with high mortality and drug-resistance. Only few patients survive more than 12 months. We report on a 55-year-old female patient with acute MCL diagnosed in May 2012. The disease was characterized by a rapid increase in white blood cells and mast cells (MC in the peripheral blood, and a rapid increase of serum tryptase levels. The KIT D816H mutation was detected in the blood and bone marrow (BM. Induction chemotherapy with high-dose ARA-C and fludarabine (FLAG was administered. Unexpectedly, the patient entered a hematologic remission with almost complete disappearance of neoplastic MC and a decrease of serum tryptase levels to normal range after 2 cycles of FLAG. Consecutively, the patient was prepared for allogeneic stem cell transplantation. However, shortly after the third cycle of FLAG, tryptase levels increased again, immature MC appeared in the blood, and the patient died from cerebral bleeding. Together, this case shows that intensive chemotherapy regimens, like FLAG, may induce remission in acute MCL. However, treatment responses are short-lived and the overall outcome remains dismal in these patients. We propose to separate this acute type of MCL from more subacute or chronic variants of MCL.

Anti-Saccharomyces cerevisiae antibody is not useful to differentiate between Crohn′s disease and intestinal tuberculosis in India

Directory of Open Access Journals (Sweden)

Ghoshal U

2007-01-01

Full Text Available Context : Clinical, endoscopic, radiological and histological parameters of intestinal tuberculosis (IT and Crohn′s disease (CD are so similar that differentiation between these two diseases, which require different treatment, is difficult. Anti- Saccharomyces cerevisiae antibody (ASCA, which is often present in the sera of patients with CD, may be potentially useful to differentiate CD from IT. Aim : To evaluate the role of enzyme-linked immunosorbent assay test for ASCA in serum in differentiating CD from intestinal tuberculosis. Settings and Design : Prospective case-control study. Materials and Methods: Sixteen patients with IT, 16 CD, 36 UC diagnosed using standard parameters and 12 controls (11 healthy subjects and one with colonic carcinoma were tested for IgG ASCA in serum. Statistical Analysis Used : Categorical variables were analyzed using Chi-square test with Yates′ correction, as applicable. Continuous variables were analyzed using Mann-Whitney U test. Results : Eight of 16 (50% patients with IT, 10 of 16 with CD (62%, nine of 35 with UC (26% and one of 12 controls tested positive for ASCA in serum. Though the frequency of ASCA in serum was comparable among patients with IT and CD (8/16 vs. 10/16, P = ns, IT and UC (8/16 vs. 9/35, P =ns, CD and UC (10/16 vs. 9/35, P =ns, its frequency in CD or IT but not in UC was higher than healthy controls ( P < 0.01. Conclusions : Serum ASCA is unlikely to be useful to differentiate between CD and IT in India.

Potencial genético de progênies de feijão-caupi segregantes quanto ao tipo da inflorescência

Directory of Open Access Journals (Sweden)

Fábio Ribeiro Barros

2011-02-01

Full Text Available O objetivo deste trabalho foi avaliar o potencial genético produtivo de progênies de feijão-caupi (Vigna unguiculata segregantes quanto ao tipo da inflorescência. Foram avaliadas 68 progênies F4 obtidas dos retrocruzamentos: (TV x 5058-09C x Cacheado-roxo x TV x 5058-09C e (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816, com os genitores. Dois experimentos foram conduzidos no delineamento de blocos ao acaso, tendo-se avaliado 17 progênies, com quatro repetições, em parcelas subdivididas quanto à inflorescência: simples e composta. A análise estatística foi realizada por modelos mistos via procedimento REML/BLUP. As estimativas das variâncias genéticas foram significativas para todos os caracteres estudados. Os caracteres comprimento do pedúnculo, número médio de vagens por pedúnculo e floração inicial apresentaram alta variabilidade e expressão do componente genético para a inflorescência composta. As progênies de inflorescência simples apresentam potencial genético produtivo similar às progênies de inflorescência composta. As progênies resultantes do retrocruzamento (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816 são promissoras como estratégia para aumentar os níveis atuais de produtividade do feijão-caupi.

Reparation of damaged forging dies

Directory of Open Access Journals (Sweden)

Vukić Lazić

2015-03-01

Full Text Available The forging dies are in exploitation exposed to elevated temperatures and variable impact loads, both compressive and shear. Steels for manufacturing of these tools must endure those loads while maintaining mechanical properties and being resistant to wear and thermal fatigue. For those reasons, the alloyed steels are used for making the forging dies, though they have less weldability, because alloying increases proneness to hardening. Any reparatory hard facing (HF of the damaged dies would require the specially adjusted technology to the particular piece. In this paper reparatory hard facing of dies used for forging pieces in the automobile industry is considered. Prior to reparatory hard facing of the real tools, numerous experimental hard facings on models were performed. All the model hard facings were done on the same steels which were used for production of the real forging dies. To define the optimal hard facing technology one needs to derive the optimal combination of the adequate heat treatment(s, to select the proper filler metals and the welding procedure. The established optimal HF technology was applied to real forging dies whose service life was further monitored in conditions of exploitation

Predicting renal graft failure by sCD30 levels and de novo HLA antibodies at 1year post-transplantation.

Science.gov (United States)

Wang, Dong; Wu, Guojun; Chen, Jinhua; Yu, Ziqiang; Wu, Weizhen; Yang, Shunliang; Tan, Jianming

2012-06-01

HLA antibodies and sCD30 levels were detected in the serum sampled from 620 renal graft recipients at 1 year post-transplantation, which were followed up for 5 years. Six-year graft and patient survivals were 81.6% and 91.0%. HLA antibodies were detected in 45 recipients (7.3%), of whom there were 14 cases with class I antibodies, 26 cases with class II, and 5 cases with both class I and II. Much more graft loss was record in recipients with HLA antibodies than those without antibodies (60% vs. 15.1%, psCD30 levels were recorded in recipients suffering graft loss than the others (73.9±48.8 U/mL vs. 37.3±14.6 U/mL, psCD30 levels, recipients with low sCD30 levels (sCD30 on graft survival was not only independent but also additive. Therefore, post-transplantation monitoring of HLA antibodies and sCD30 levels is necessary and recipients with elevated sCD30 level and/or de novo HLA antibody should be paid more attention in order to achieve better graft survival. Copyright © 2012 Elsevier B.V. All rights reserved.

Morphological analysis of polymer systems with broad particle size distribution

Czech Academy of Sciences Publication Activity Database

Šlouf, Miroslav; Ostafinska, Aleksandra; Nevoralová, Martina; Fortelný, Ivan

2015-01-01

Roč. 42, April (2015), s. 8-16 ISSN 0142-9418 R&D Projects: GA ČR(CZ) GA14-17921S Institutional support: RVO:61389013 Keywords : polymer blends * morphology * image analysis Subject RIV: JJ - Other Materials Impact factor: 2.350, year: 2015

The State of the Art in Cold Forging Lubrication

DEFF Research Database (Denmark)

Bay, Niels

1994-01-01

The manufature of components in steel, aluminium and copper alloys by cold forging production has increased ever since the 1950's. Typical processes are forward rod extrusion and backward can extrusion, upsetting, ironing, tube extrusion and radial extrusion. The tribological conditions in cold...... forging are extremely severe due to large surface expansion and normal pressure in the tool/workpiece interface combined with elevated tool temperatures. Except for the more simple cold forging operations successful production therefore requires advanced lubrication systems. The present paper gives...... a detailed description of the state of art for lubricant systems for cold forging of C-steels and low alloy steels as well as aluminium alloys including all the basic operations such as cleaning of the slugs, application of eventual conversion coating and lubrication. As regards cold forging of steel...

Electric-field-induced tetragonal phase in [Pb(Mg.sub.1/3./sub.Nb.sub.2/3./sub.)O.sub.3./sub.].sub.0.68./sub.-[PbTiO.sub.3./sub.].sub.0.32./sub. by Raman scattering

Czech Academy of Sciences Publication Activity Database

Rafalovskyi, Iegor; Gregora, Ivan; Hlinka, Jiří

2016-01-01

Roč. 89, 7-8 (2016), s. 816-822 ISSN 0141-1594 R&D Projects: GA ČR GA15-04121S Institutional support: RVO:68378271 Keywords : phase transition * MPB * relaxor ferroelectric Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.060, year: 2016

Numerical Study of Forced Vibration Suppression by Parametric Anti-Resonance

Czech Academy of Sciences Publication Activity Database

Pešek, Luděk; Šulc, Petr; Půst, Ladislav

2016-01-01

Roč. 41, č. 3 (2016), s. 527-533 ISSN 0137-5075 R&D Projects: GA ČR GA16-04546S Institutional support: RVO:61388998 Keywords : active damping * parametric anti -resonance * external harmonic excitation Subject RIV: BI - Acoustics Impact factor: 0.816, year: 2016

Riigikogu liikmed ja sotsiaalteadlased näevad Eestit erinevalt / Tõnis Saarts

Index Scriptorium Estoniae

Saarts, Tõnis

2006-01-01

8.-16. veebruarini 2006. a. Riigikogu liikmete ja sotsiaalteadlaste seas läbiviidud ekspertküsitluse tulemuste analüüs. Poliitikute ning sotsioloogide vastuste sarnasusest ja erinevustest. Rootsi demokraatiaauditi mudelist. Tabelid

Development of integral type forgings for steam generator of nuclear power plant

International Nuclear Information System (INIS)

Suzuki, Komei; Sato, Ikuo; Murai, Etsuo

1992-01-01

The use of integral type steel forgings for the construction of pressure vessel enhances the structural integrity of components and makes the fabrication of components and the execution of in-service inspection (ISI) easier than those fabrication from plate and casting materials. Such steel forgings have been realized for steam generator (SG) for nuclear power plant as follows : (1) Forged shell ring : change from welding fabrication of formed plates to forging ; (2) Forged conical shell ring : ditto ; (3) Forged head integral with nozzles (s) : (i) Primary head : change from casting to forging ; (ii) Secondary head : change from welding fabrication of formed plates to forging. These steel forgings have been realized by recent development in manufacturing technologies, such as steel making, forging processes and heat treatment which are vital to the quality of steel forgings. Some examples of recent typical high quality steel forgings developed by the Japan Steel Works, Ltd. (JSW) are introduced, and the main points of the manufacturing technique and the quality attained are also described. (author)

Forged Signature Distinction Using Convolutional Neural Network for Feature Extraction

Directory of Open Access Journals (Sweden)

Seungsoo Nam

2018-01-01

Full Text Available This paper proposes a dynamic verification scheme for finger-drawn signatures in smartphones. As a dynamic feature, the movement of a smartphone is recorded with accelerometer sensors in the smartphone, in addition to the moving coordinates of the signature. To extract high-level longitudinal and topological features, the proposed scheme uses a convolution neural network (CNN for feature extraction, and not as a conventional classifier. We assume that a CNN trained with forged signatures can extract effective features (called S-vector, which are common in forging activities such as hesitation and delay before drawing the complicated part. The proposed scheme also exploits an autoencoder (AE as a classifier, and the S-vector is used as the input vector to the AE. An AE has high accuracy for the one-class distinction problem such as signature verification, and is also greatly dependent on the accuracy of input data. S-vector is valuable as the input of AE, and, consequently, could lead to improved verification accuracy especially for distinguishing forged signatures. Compared to the previous work, i.e., the MLP-based finger-drawn signature verification scheme, the proposed scheme decreases the equal error rate by 13.7%, specifically, from 18.1% to 4.4%, for discriminating forged signatures.

78 FR 23112 - Airworthiness Directives; Grob-Werke Airplanes

Science.gov (United States)

2013-04-18

... material at the FAA, call (816) 329-4148. FOR FURTHER INFORMATION CONTACT: Taylor Martin, Aerospace...: (816) 329-4138; fax: (816) 329-4090; email: taylor[email protected] . SUPPLEMENTARY INFORMATION... to detect cracks and prevent the part from failing. (f) Actions and Compliance Unless already done...

Ultrafast Plasmonic Electron Emission from Ag Nanolayers with Different Roughness

Czech Academy of Sciences Publication Activity Database

Márton, I.; Ayadi, V.; Rácz, P.; Stefaniuk, T.; Wróbel, Piotr; Földi, P.; Dombi, P.

2016-01-01

Roč. 11, č. 3 (2016), s. 811-816 ISSN 1557-1955 Institutional support: RVO:67985882 Keywords : Nanoparticles * Ultrafast phenomena * Electron emission Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.139, year: 2016

Des pommes de terre plus saines et plus nutritives contribuent à la ...

International Development Research Centre (IDRC) Digital Library (Canada)

Spanish, PDF, 816 KB). Il s'agit de l'une des fiches de la collection Recherche et changement, qui présente certaines des incidences que l'on commence à constater dans la foulée des projets qu'a subventionnés en Amérique latine ...

Haemogregarines of freshwater turtles from Southeast Asia with a description of Haemogregarina sacaliae sp. n. and a redescription of Haemogregarina pellegrini Laveran and Pettit, 1910

Czech Academy of Sciences Publication Activity Database

Dvořáková, N.; Kvičerová, Jana; Hostovský, M.; Široký, P.

2015-01-01

Roč. 142, č. 6 (2015), s. 816-826 ISSN 0031-1820 R&D Projects: GA ČR(CZ) GAP506/11/1738 Institutional support: RVO:60077344 Keywords : Haemogregarines * Haemogregarina * Sacalia * Platysternon * Malayemys * phylogeny * 18S rDNA Subject RIV: EG - Zoology Impact factor: 3.031, year: 2015

Labeling of pancreatic islets with iron oxide nanoparticles for in vivo detection with magnetic resonance

Czech Academy of Sciences Publication Activity Database

Berková, Z.; Jirák, D.; Zacharovová, K.; Kříž, J.; Lodererová, A.; Girman, P.; Koblas, T.; Dovolilová, E.; Vancová, Marie; Hájek, M.; Saudek, F.

2008-01-01

Roč. 85, č. 1 (2008), s. 155-159 ISSN 0041-1337 R&D Projects: GA MŠk 2B06175; GA MŠk LN00A065 Institutional research plan: CEZ:AV0Z60220518 Keywords : pancreatic islet s * islet s transplantation * iron nanoparticles Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 3.816, year: 2008

Stainless steel forgings for nuclear chemical plants

International Nuclear Information System (INIS)

1982-02-01

This Specification covers detailed requirements for the supply of austenitic stainless steel forgings used in radioactive and corrosive areas within the Nuclear Industry. With the exception of 316S51 the materials specified are all suitable for contact with nitric acid, 316S51 being included as suitable for use in contact with sodium and other alkali metals at elevated temperatures. (author)

Looking for answers to L-type calcium channels in the ageing brain (Commentary on Zanos et al.)

Czech Academy of Sciences Publication Activity Database

Proft, Juliane; Weiss, Norbert

2015-01-01

Roč. 42, č. 8 (2015), s. 2496-2498 ISSN 0953-816X R&D Projects: GA ČR GA15-13556S; GA MŠk 7AMB15FR015 Institutional support: RVO:61388963 Keywords : rat basal forebrain * age * neurons Subject RIV: CE - Biochemistry Impact factor: 2.975, year: 2015

Phenotype abnormality: 311 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 311 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u816i increased efficiency during process... named seed dormancy process ... increased efficiency ... seed dormancy process ...

Manufacturing of Precision Forgings by Radial Forging

International Nuclear Information System (INIS)

Wallner, S.; Harrer, O.; Buchmayr, B.; Hofer, F.

2011-01-01

Radial forging is a multi purpose incremental forging process using four tools on the same plane. It is widely used for the forming of tool steels, super alloys as well as titanium- and refractory metals. The range of application goes from reducing the diameters of shafts, tubes, stepped shafts and axels, as well as for creating internal profiles for tubes in Near-Net-Shape and Net-Shape quality. Based on actual development of a weight optimized transmission input shaft, the specific features of radial forging technology is demonstrated. Also a Finite Element Model for the simulation of the process is shown which leads to reduced pre-processing effort and reduced computing time compared to other published simulation methods for radial forging. The finite element model can be applied to quantify the effects of different forging strategies.

77 FR 19061 - Airworthiness Directives; Pilatus Aircraft Ltd. Airplanes

Science.gov (United States)

2012-03-30

... attachment. We are issuing this AD to require actions to address the unsafe condition on these products... City, Missouri 64106. For information on the availability of this material at the FAA, call (816) 329... Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090...

Synchronization of gamma oscillations increases functional connectivity of human hippocampus and inferior-middle temporal cortex during repetitive visuomotor events

Czech Academy of Sciences Publication Activity Database

Babiloni, C.; Bareš, M.; Vecchio, F.; Brázdil, M.; Jurák, Pavel; Moretti, D. V.; Ubaldi, A.; Rossini, P. M.; Rektor, I.

2004-01-01

Roč. 19, č. 1 (2004), s. 1 - 11 ISSN 0953-816X Institutional research plan: CEZ:AV0Z2065902 Keywords : brain rhythms * CNV paradigm * stereo EEG Subject RIV: FH - Neurology Impact factor: 3.820, year: 2004

Význam mitochondrií v srdečním svalu

Czech Academy of Sciences Publication Activity Database

Škárka, Libor; Ošťádal, Bohuslav

2004-01-01

Roč. 143, č. 12 (2004), s. 809-816 ISSN 0008-7335 R&D Projects: GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : heart muscle * mitochondria * ischemic heart disease Subject RIV: ED - Physiology

Methods of forging steel

OpenAIRE

Pečoler, Primož

2014-01-01

The following work presents processes of steel forming, challenges when forging steel, forming machines suitable for forging and which choice of machine is most suitable for forging. We can separate steel forming to free forging and drop forging. Free forging can be divided to hand forging and machine forging. The correct choice of furnaces is also very important. We must reach correct temperature in the furnace for raw steel to melt with less scalings. In diploma I mentioned some machine...

Comparison study of multistep forging and injection forging of automobile fasteners

OpenAIRE

Chen Senyong; Qin Yi

2015-01-01

In order to improve production efficiency, injection forging as a feasible approach was introduced to automobile fasteners production. In the study reported in this paper, two forging approaches, traditional multistep forging and injection forging, were analysed by using a finite element method. Using ABAQUS and DEFORM, some significant factors, namely, forging force, energy consumption, component accuracy and stress distribution in the die, were compared to explore the potential and challeng...

Categories and continua of destructive and constructive marital conflict tactics from the perspective of U.S. and Welsh children.

Science.gov (United States)

Goeke-Morey, Marcie C; Cummings, E Mark; Harold, Gordon T; Shelton, Katherine H

2003-09-01

Categories and continua of parents' marital conflict tactics based on multiple, conceptually grounded criteria were tested. Participants were 175 U.S. children, ages 8-16 years (88 boys, 87 girls) and 327 Welsh children, ages 11-12 years (159 boys, 168 girls). Children's responses (affective, cognitive, behavioral) to analog presentations of 10 everyday marital conflict tactics enacted by fathers or mothers showed substantial variation as a function of tactic used. Orderings of conflict tactics on the various response criteria varied as a function of moderators, particularly the gender of the parent expressing the conflict tactic. Conflict tactics were classified as either constructive or destructive according to criteria derived from the emotional security hypothesis. Except for calm discussion, classifications did not change regardless of cultural group, parent gender, or child age or gender. Recommendations for negotiating everyday marital conflict for the children's sake are discussed.

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 9. Grasshoppers – Generalists to Specialists? S V Eswaran Akanksha Jindal. General Article Volume 18 Issue 9 September 2013 pp 810-816. Fulltext. Click here to view fulltext PDF. Permanent link:

Structural insight into RNA catalysis revealed by molecular dynamics simulations and QM/MM calculation

Czech Academy of Sciences Publication Activity Database

Banáš, P.; Walter, N.G.; Šponer, Jiří; Otyepka, Michal

2009-01-01

Roč. 26, č. 6 (2009), s. 816 ISSN 0739-1102. [The 17th Conversation . 16.06.2009-20.06.2009, Albany] Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : QM/MM * RNA Subject RIV: BO - Biophysics

Mechanistic model of the oxygen reduction catalyzed by a metal-free porphyrin in one- and two-phase liquid systems

Czech Academy of Sciences Publication Activity Database

Trojánek, Antonín; Langmaier, Jan; Záliš, Stanislav; Samec, Zdeněk

2013-01-01

Roč. 110, NOV 2013 (2013), s. 816-821 ISSN 0013-4686 R&D Projects: GA ČR GAP208/11/0697 Institutional support: RVO:61388955 Keywords : oxygen reduction * metal -free porphyrin * catalysis Subject RIV: CG - Electrochemistry Impact factor: 4.086, year: 2013

Response to Comment on Preconditioning of matrices partitioned in 2 2 block form: Eigenvalue estimates and Schwarz DD for mixed FEM

Czech Academy of Sciences Publication Activity Database

Axelsson, Owe; Blaheta, Radim

2013-01-01

Roč. 20, č. 3 (2013), s. 536-539 ISSN 1070-5325 Institutional support: RVO:68145535 Keywords : saddle point matrices * inverses * preconditioning Subject RIV: BA - General Mathematics Impact factor: 1.424, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/nla.816/pdf

Ultrathin 1T-phase MoS2 nanosheets decorated hollow carbon microspheres as highly efficient catalysts for solar energy harvesting and storage

KAUST Repository

Hsiao, Min-Chien

2017-02-08

The composite of MoS2 and hollow carbon sphere (MoS2@HCS) is prepared via a glucose-assisted one pot synthesis. The composite consists of hierarchical spheres with a diameter of 0.5–4 μm and these hollow spheres are decorated with a number of curled and interlaced MoS2 nanosheets. After the composite is subject to the lithium intercalation, the MoS2 is converted from 2H to 1T phase. In this current work, the activities of 1T-MoS2@HCS toward photocatalytic hydrogen evolution and the reduction of I3− in dye-sensitized solar cells (DSCs) are systemically investigated. When evaluated as the photocatalyst for hydrogen evolution, the amount of evolved hydrogen over 1T-MoS2@HCS can reach 143 μmol in 2 h, being 3.6 times higher than as-synthesized 2H-MoS2@HCS. Additionally, the 1T-MoS2@HCS can be employed as the counter electrode (CE) material in DSCs. The DSCs based on 1T-MoS2@HCS CE possesses the power conversion efficiency of 8.94%, being higher than that with 2H-MoS2@HCS CE (8.16%) and comparable to that with Pt CE (8.87%). Our study demonstrates that 1T-MoS2@HCS has a great potential as an inexpensive alternative to Pt catalysts.

Ultrathin 1T-phase MoS2 nanosheets decorated hollow carbon microspheres as highly efficient catalysts for solar energy harvesting and storage

KAUST Repository

Hsiao, Min-Chien; Chang, Chin-Yu; Niu, Li-Juan; Bai, Feng; Li, Lain-Jong; Shen, Hsin-Hui; Lin, Jeng-Yu; Lin, Tsung-Wu

2017-01-01

The composite of MoS2 and hollow carbon sphere (MoS2@HCS) is prepared via a glucose-assisted one pot synthesis. The composite consists of hierarchical spheres with a diameter of 0.5–4 μm and these hollow spheres are decorated with a number of curled and interlaced MoS2 nanosheets. After the composite is subject to the lithium intercalation, the MoS2 is converted from 2H to 1T phase. In this current work, the activities of 1T-MoS2@HCS toward photocatalytic hydrogen evolution and the reduction of I3− in dye-sensitized solar cells (DSCs) are systemically investigated. When evaluated as the photocatalyst for hydrogen evolution, the amount of evolved hydrogen over 1T-MoS2@HCS can reach 143 μmol in 2 h, being 3.6 times higher than as-synthesized 2H-MoS2@HCS. Additionally, the 1T-MoS2@HCS can be employed as the counter electrode (CE) material in DSCs. The DSCs based on 1T-MoS2@HCS CE possesses the power conversion efficiency of 8.94%, being higher than that with 2H-MoS2@HCS CE (8.16%) and comparable to that with Pt CE (8.87%). Our study demonstrates that 1T-MoS2@HCS has a great potential as an inexpensive alternative to Pt catalysts.

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education. Akanksha Jindal. Articles written in Resonance – Journal of Science Education. Volume 18 Issue 9 September 2013 pp 810-816 General Article. Grasshoppers – Generalists to Specialists? S V Eswaran Akanksha Jindal · More Details Fulltext PDF ...

Nanocomposite Ti/hydrocarbon plasma polymer films from reactive magnetron sputtering as growth support for osteoblast-like and endothelial cells

Czech Academy of Sciences Publication Activity Database

Grinevich, A.; Bačáková, Lucie; Choukourov, A.; Boldyryeva, H.; Pihosh, Y.; Slavinska, D.; Nosková, Lenka; Škuciová, Mária; Lisá, Věra; Biederman, H.

88A, č. 4 (2009), s. 952-966 ISSN 1549-3296 R&D Projects: GA AV ČR(CZ) KAN101120701 Institutional research plan: CEZ:AV0Z50110509 Keywords : titanium * maturation * plasma Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.816, year: 2009

Constitutive salicylic acid accumulation in pi4kIII beta 1 beta 2 Arabidopsis plants stunts rosette but not root growth

Czech Academy of Sciences Publication Activity Database

Šašek, Vladimír; Janda, Martin; Delage, E.; Puyaubert, J.; Guivarc'h, A.; Maseda, Encarnación López; Dobrev, Petre; Caius, J.; Valentová, O.; Burketová, Lenka; Zachowski, A.; Ruelland, E.

2014-01-01

Roč. 203, č. 3 (2014), s. 805-816 ISSN 0028-646X R&D Projects: GA ČR(CZ) GAP501/11/1654 Institutional support: RVO:61389030 Keywords : Arabidopsis * dwarf phenotype * hormone transduction Subject RIV: CE - Biochemistry Impact factor: 7.672, year: 2014

Intensification of the separation of CuO nanoparticles from their highly diluted suspension using a foam flotation column with S type internal

International Nuclear Information System (INIS)

Hu, Nan; Li, Rui; Wu, Zhao-liang; Huang, Di; Li, Hong Zhen

2015-01-01

Foam flotation is a promising technique for recovering nanoparticles from their highly diluted suspensions. In this work, a novel S type internal was developed to intensify the foam flotation of CuO nanoparticles (357.6 nm in average particle size) from their suspension of 6.2 × 10 −2  mmol/L. By enhancing foam drainage, the S type internal increased the enrichment ratio of CuO nanoparticles by 139.3 ± 12.5 % without significantly affecting their recovery percentage. Under the optimal conditions of Cetyl trimethyl ammonium bromide (CTAB) concentration 0.45 mmol/L, superficial airflow rate 2.6 mm/s, and volumetric feed rate 1.0 mL/min, the enrichment ratio and recovery percentage of CuO nanoparticles reached 81.6 ± 4.1 and 95.4 ± 4.9 %, respectively, using the foam flotation column with the S type internal. Furthermore, about 95 % CTAB could be recycled by recovering CTAB from the foamate and the residual solution. The recovered CuO nanoparticles were associated with CTAB molecules, so they had better dispersity and dispersion stability than the starting CuO nanoparticles. Therefore, they would have good reusability

Using of material-technological modelling for designing production of closed die forgings

Science.gov (United States)

Ibrahim, K.; Vorel, I.; Jeníček, Š.; Káňa, J.; Aišman, D.; Kotěšovec, V.

2017-02-01

Production of forgings is a complex and demanding process which consists of a number of forging operations and, in many cases, includes post-forge heat treatment. An optimized manufacturing line is a prerequisite for obtaining prime-quality products which in turn are essential to profitable operation of a forging company. Problems may, however, arise from modifications to the manufacturing route due to changing customer needs. As a result, the production may have to be suspended temporarily to enable changeover and optimization. Using material-technological modelling, the required modifications can be tested and optimized under laboratory conditions outside the plant without disrupting the production. Thanks to material-technological modelling, the process parameters can be varied rapidly in response to changes in market requirements. Outcomes of the modelling runs include optimum parameters for the forging part’s manufacturing route, values of mechanical properties, and results of microstructure analysis. This article describes the use of material-technological modelling for exploring the impact of the amount of deformation and the rate of cooling of a particular forged part from the finish-forging temperature on its microstructure and related mechanical properties.

Microstructure evolution and mechanical properties of a particulate reinforced magnesium matrix composites forged at elevated temperatures

International Nuclear Information System (INIS)

Deng, K.K.; Wu, K.; Wang, X.J.; Wu, Y.W.; Hu, X.S.; Zheng, M.Y.; Gan, W.M.; Brokmeier, H.G.

2010-01-01

SiCp/AZ91 magnesium matrix composite was fabricated by stir casting. The as-cast ingots were cut into cylindrical billets, and then forged at different temperatures (320, 370, 420, 470 and 520 deg. C) at a constant RAM speed of 15 mm/s with 50% reduction. The microstructure evolution of the composites during forging was investigated by optical microscope, scanning electron microscope, and transmission electron microscope. The texture of the forged composites was measured by neutron diffraction. Mechanical properties of the composite at different forging temperatures were tested by tensile tests at room temperature. It was found that a strong basal plane texture formed during forging, and the intensity of basal plane texture weakened as forging temperatures increased. The particle distribution in the composite was significantly improved by hot forging. Typical microstructures were obtained after forging at different temperatures and the composite with different microstructures offered different mechanical properties during tensile test.

Fractography analysis of tool samples used for cold forging

DEFF Research Database (Denmark)

Dahl, K.V.

2002-01-01

Three fractured tool dies used for industrial cold forging have been investigated using light optical microscopy and scanning electron microscopy. Two of the specimens were produced using the traditional Böhler P/M steel grade s790, while the lastspecimen was a third generation P/M steel produced...... using new technology developed by Böhler. All three steels have the same nominal composition of alloying elements. The failure in both types of material occurs as a crack formation at a notch inside ofthe tool. Generally the cold forging dies constructed in third generation steels have a longer lifetime...

On the road to silicon-nanoparticle laser

Czech Academy of Sciences Publication Activity Database

Fojtík, A.; Valenta, J.; Pelant, Ivan; Kálal, M.; Fiala, P.

2007-01-01

Roč. 181, - (2007), s. 88-92 ISSN 0924-0136 R&D Projects: GA AV ČR IAA1010316; GA MŠk LC510 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystals * silicon * elektroluminescence * laser * photonics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.816, year: 2007

30 CFR 816.49 - Impoundments.

Science.gov (United States)

2010-07-01

..., prudent, engineering practices and any design criteria established by the regulatory authority. The... surrounding landowners for agricultural, industrial, recreational, or domestic uses. (6) The impoundment will... safely removed in accordance with current, prudent, engineering practices. Such an impoundment shall be...

Hot Deformation Behavior and Pulse Current Auxiliary Isothermal Forging of Hot Pressing Sintering TiAl Based Alloys.

Science.gov (United States)

Shi, Chengcheng; Jiang, Shaosong; Zhang, Kaifeng

2017-12-16

This paper focuses on the fabrication of as-forged Ti46.5Al2Cr1.8Nb-(W, B) alloy via pulse current auxiliary isothermal forging (PCIF). The starting material composed of near gamma (NG) microstructure was fabricated by adopting pre-alloyed powders via hot pressing sintering (HPS) at 1300 °C. Isothermal compression tests were conducted at a strain rate range of 0.001-0.1 s -1 and a temperature range of 1125-1275 °C to establish the constitutive model and processing map. The optimal hot deformation parameters were successfully determined (in a strain rate range of 10 -3 -2.5 × 10 -3 s -1 and temperature range of 1130-1180 °C) based on the hot processing map and microstructure observation. Accordingly, an as-forged TiAl based alloy without cracks was successfully fabricated by PCIF processing at 1175 °C with a nominal strain rate of 10 -3 s -1 . Microstructure observation indicated that complete dynamic recrystallization (DRX) and phase transformation of γ→α₂ occurred during the PCIF process. The elongation of as-forged alloy was 136%, possessing a good secondary hot workability, while the sintered alloy was only 66% when tested at 900 °C with a strain rate of 2 × 10 -4 s -1 .

Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

International Nuclear Information System (INIS)

Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K.; Hort, N.; Kainer, K. U.

2016-01-01

Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

Forging of cast Mg-3Sn-2Ca-0.4Al-0.4Si magnesium alloy using processing map

Energy Technology Data Exchange (ETDEWEB)

Rao, K. P.; Suresh, K.; Prasad, Y. V. R. K. [University of Hong Kong, Hong Kong (China); Hort, N.; Kainer, K. U. [Magnesium Innovation Centre, Geesthacht (Germany)

2016-06-15

Mg-3Sn-2Ca (TX32) alloy has good creep resistance but limited workability. Minor amounts of Al and Si have been added to TX32 for improving its hot workability. The processing map for the TX32-0.4Al-0.4Si alloy exhibited two workability domains in the temperature and strain rate ranges: (1) 310-415.deg.C/0.0003-0.003 s-1 and (2) 430-500.deg.C/0.003-3 s-1. The alloy exhibited flow instability at temperatures < 350.deg.C at strain rates > 0.01 s-1. The alloy has been forged to produce a cup shape component to validate these findings of processing map. Finite-element (FE) simulation has been performed for obtaining the local variations of strain and strain rate within the forging. The microstructures of the forged components under the optimal domain conditions revealed dynamically recrystallized grains, and those forged in the flow instability regime have fractured and exhibited flow localization bands and cracks. The experimental load stroke curves correlated well with those obtained by FE simulation.

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

Science Academies' Refresher Course on Theoretical Structural Geology, Crystallography, Mineralogy, Thermodynamics, Experimental Petrology and Theoretical Geophysics · More Details Abstract Fulltext PDF. pp 816-816 Information and Announcements. Science Academies' Refresher Course in Foundations of ...

Reduced extracellular space in the brain of tenascin-R- and HNK-1-sulphotransferase deficient mice

Czech Academy of Sciences Publication Activity Database

Syková, Eva; Voříšek, Ivan; Mazel, Tomáš; Antonova, Tatiana; Schachner, M.

2005-01-01

Roč. 22, č. 8 (2005), s. 1873-1880 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA309/04/0753; GA MŠk(CZ) 1M0538 Institutional research plan: CEZ:AV0Z50390512 Keywords : diffusion * extracellular matrix Subject RIV: FH - Neurology Impact factor: 3.949, year: 2005

Serotonin fibre sprouting and increase in serotonin transporter immunoreactivity in the CA1 area of hippocampus in a triple transgenic mouse model of Alzheimer's disease

Czech Academy of Sciences Publication Activity Database

Noristani, H. N.; Olabarria, M.; Verkhratsky, Alexei; Rodríguez Arellano, Jose Julio

2010-01-01

Roč. 32, č. 1 (2010), s. 71-79 ISSN 0953-816X R&D Projects: GA ČR GA309/09/1696; GA ČR GA305/08/1384 Institutional research plan: CEZ:AV0Z50390703 Keywords : Alzheimer's disease * hippocampus * plasticity Subject RIV: FH - Neurology Impact factor: 3.658, year: 2010

Low-level determination of silicon in biological materials using radiochemical neutron activation analysis

Czech Academy of Sciences Publication Activity Database

Kučera, Jan; Zeisler, R.

2005-01-01

Roč. 263, č. 3 (2005), s. 811-816 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z10480505 Keywords : gel breast implants * alzhemers-disease * renal-failure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.460, year: 2005

Status epilepticus in immature rats leads to behavioural and cognitive impairment and epileptogenesis

Czech Academy of Sciences Publication Activity Database

Kubová, Hana; Mareš, Pavel; Suchomelová, Lucie; Brožek, Gustav; Druga, Rastislav; Pitkanen, A.

2004-01-01

Roč. 19, č. 12 (2004), s. 3255-3265 ISSN 0953-816X R&D Projects: GA MZd NF6474; GA ČR GA309/01/0285 Institutional research plan: CEZ:AV0Z5011922 Keywords : epilepsy * elevated plus-maze * Morris water-maze Subject RIV: FH - Neurology Impact factor: 3.820, year: 2004

77 FR 73456 - Notice of Intent To Grant Exclusive Patent License; Fiber Optic Sensor Systems Technology...

Science.gov (United States)

2012-12-10

...; Fiber Optic Sensor Systems Technology Corporation AGENCY: Department of the Navy, DoD. ACTION: Notice. SUMMARY: The Department of the Navy hereby gives notice of its intent to grant to Fiber Optic Sensor... Modulated Fiber Optic Pressure Sensor, Navy Case No. 83,816.//U.S. Patent No. 7,149,374: Fiber Optic...

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. G Sridhar. Articles written in Pramana – Journal of Physics. Volume 75 Issue 5 November 2010 pp 807-816 Invited Papers. Physics and technology of tunable pulsed single longitudinal mode dye laser · G Sridhar V S Rawat Nitin Kawade Sunita Singh L M Gantayet.

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 8. Science Academies' Refresher Course in Foundations of Physical Chemistry and its Applications. Information and Announcements Volume 22 Issue 8 August 2017 pp 816-816 ...

Forging Long Shafts On Disks

Science.gov (United States)

Tilghman, Chris; Askey, William; Hopkins, Steven

1989-01-01

Isothermal-forging apparatus produces long shafts integral with disks. Equipment based on modification of conventional isothermal-forging equipment, required stroke cut by more than half. Enables forging of shafts as long as 48 in. (122 cm) on typical modified conventional forging press, otherwise limited to making shafts no longer than 18 in. (46cm). Removable punch, in which forged material cools after plastic deformation, essential novel feature of forging apparatus. Technology used to improve such products as components of gas turbines and turbopumps and of other shaft/disk parts for powerplants, drive trains, or static structures.

Precision forging technology for aluminum alloy

Science.gov (United States)

Deng, Lei; Wang, Xinyun; Jin, Junsong; Xia, Juchen

2018-03-01

Aluminum alloy is a preferred metal material for lightweight part manufacturing in aerospace, automobile, and weapon industries due to its good physical properties, such as low density, high specific strength, and good corrosion resistance. However, during forging processes, underfilling, folding, broken streamline, crack, coarse grain, and other macro- or microdefects are easily generated because of the deformation characteristics of aluminum alloys, including narrow forgeable temperature region, fast heat dissipation to dies, strong adhesion, high strain rate sensitivity, and large flow resistance. Thus, it is seriously restricted for the forged part to obtain precision shape and enhanced property. In this paper, progresses in precision forging technologies of aluminum alloy parts were reviewed. Several advanced precision forging technologies have been developed, including closed die forging, isothermal die forging, local loading forging, metal flow forging with relief cavity, auxiliary force or vibration loading, casting-forging hybrid forming, and stamping-forging hybrid forming. High-precision aluminum alloy parts can be realized by controlling the forging processes and parameters or combining precision forging technologies with other forming technologies. The development of these technologies is beneficial to promote the application of aluminum alloys in manufacturing of lightweight parts.

Trithallium tetraselenophosphate Tl3PSe4, and trithallium tetrathioarsenate, Tl3AsS4, by neutron time-of-flight diffraction

International Nuclear Information System (INIS)

Alkire, R.W.; Vergamini, P.J.; Larson, A.C.; Morosin, B.

1984-01-01

Room-temperature (293 K) single-crystal structure determinations of the isostructural materials Tl 3 PSe 4 and Tl 3 AsS 4 were performed at the Los Alamos National Laboratory Pulsed Neutron Facility. For Tl 3 PSe 4 : Msub(r) = 959.92, Pcmn, a = 9.276 (1), b = 11.036 (2), c = 9.058 (1) A, V = 927.27 A 3 , Z = 4, Dsub(m) = 6.87 (2), Dsub(x) = 6.876 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 252.5 fm. For Tl 3 AsS 4 : Msub(r) = 816.29, Pcmn, a = 9.084 (3), b = 10.877 (3), c = 8.877 (3) A, V = 877.11 A 3 , Z = 4, Dsub(m) = 6.18 (2), Dsub(x) = 6.181 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 177.2 fm. For Tl 3 PSe 4 (Tl 3 AsS 4 ), 1929 (1013) reflections were measured with I > 3sigma(I) and refined by full-matrix least squares to R(F) = 0.061 (0.063). Results on atomic refinement from this study represent an order of magnitude increase in precision over previous single-crystal X-ray structural work using Mo Kα radiation. The PSe 4 3- (AsS 4 3- ) groups have essentially tetrahedral configurations and one Tl + ion shows large anisotropic thermal motion which is structure related. (Auth.)

Triploidy induction in Nile tilapia, Oreochromis niloticus L. using pressure, heat and cold shocks

Digital Repository Service at National Institute of Oceanography (India)

Hussain, M.G.; Chatterji, A.; McAndrew, B.J.; Johnstone, R.

stream_size 7 stream_content_type text/plain stream_name Theor_Appl_Genet_81_6.pdf.txt stream_source_info Theor_Appl_Genet_81_6.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

Effect of auditory cortex lesions on the discrimination of frequency-modulated tones in rats

Czech Academy of Sciences Publication Activity Database

Rybalko, Natalia; Šuta, Daniel; Nwabueze-Ogbo, Fidel Chijoke; Syka, Josef

2006-01-01

Roč. 23, - (2006), s. 1614-1622 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA309/04/1074; GA MZd(CZ) NR8113; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50390512 Keywords : avoidance conditioning * lateralization Subject RIV: FH - Neurology Impact factor: 3.709, year: 2006

N-w-Propyl-L-arginine (L-NPA) reduces status epilepticus and early epileptogenic events in a mouse model of epilepsy: behavioural, EEG and immunohistochemical analyses

Czech Academy of Sciences Publication Activity Database

Beamer, E.; Otáhal, Jakub; Sills, G.J.; Thippeswamy, T.

2012-01-01

Roč. 36, č. 9 (2012), s. 3194-3203 ISSN 0953-816X R&D Projects: GA ČR(CZ) GAP303/10/0999 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : aberrant sprouting * gliosis * nitric oxide * seizure * telemetry Subject RIV: FH - Neurology Impact factor: 3.753, year: 2012

Ethyl Acetate Synthesis by Coupling of Fixed-bed Reactor and Reactive Distillation Column—Process Integration Aspects

Czech Academy of Sciences Publication Activity Database

Smejkal, Q.; Kolena, J.; Hanika, Jiří

2009-01-01

Roč. 154, 1-3 (2009), s. 236-240 ISSN 1385-8947. [International Conference on Chemical Reactors - CHEMREACTOR -18 /18./. Malta, 23.09.2008-03.10.2008] Institutional research plan: CEZ:AV0Z40720504 Keywords : ethyl acetate * esterification * reactive distillation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.816, year: 2009

On the role of ozone in long-term trends in the upper atmosphere-ionosphere system

Czech Academy of Sciences Publication Activity Database

Laštovička, Jan

2012-01-01

Roč. 30, č. 5 (2012), s. 811-816 ISSN 0992-7689 R&D Projects: GA ČR GAP209/10/1792 Keywords : Ionosphere-atmosphere interactions * Mid-latitude ionosphere Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.518, year: 2012 http://www.ann-geophys.net/30/811/2012/angeo-30-811-2012.html

Influence of segregations and hydrogen flakes on the mechanical properties of forged RPV steels

International Nuclear Information System (INIS)

Eiselt, C.C.; May, J.; Hein, H.

2013-01-01

In the frame of relevant 1970s/80s German research programs (e.g. FKS research program on component safety and others), many investigations on large forgings manufactured from Reactor Pressure Vessel (RPV) materials such as 20 MnMoNi 5 5 and 22 NiMoCr 3 7 have been performed. Lately, after ultrasonic testing hydrogen flakes in connection with segregation zones have been observed in a few RPV forgings. The earlier R and D programs contained a number of special heats, which covered a defined defect state (lower bound heats) with relevance to the recent observations of numerous UT indications in RPV forgings of two PWRs. Therefore, the results of these former research programs were now reviewed. The studies included an evaluation of the effects of macro/micro segregations as well as hydrogen flakes on the mechanical properties. As part of the mechanical technological experiments Charpy impact tests in different orientations (e.g. L-T, T-L and S-T) together with fracture mechanics and large scale tensile tests were carried out in segregated and non segregated material zones. In this context the letters L,T,S indicate the longitudinal, transversal and short transverse (thickness) direction with respect to rolling direction of the forging axis. The first letter indicates the direction of the principal stress, while the second letter stands for the crack propagation direction [1]. Furthermore the irradiation behavior of segregated material regions was analyzed and compared to non segregated material regions. Key results of these analyses indicate that in most cases upper shelf levels are lowered in segregated material parts compared to non segregated areas. In addition the segregations cause a larger scattering of impact energies. A high hydrogen content in combination with segregations has overall detrimental effects on the mechanical properties. However, there seems to be no specific segregation influence on the materials' irradiation reaction.

75 FR 53846 - Airworthiness Directives; GA 8 Airvan (Pty) Ltd Models GA8 and GA8-TC320 Airplanes

Science.gov (United States)

2010-09-02

... and inboard main ribs around the area of the Horizontal Stabiliser rear pivot attachment. Additionally... City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090. SUPPLEMENTARY INFORMATION... main ribs around the area of the Horizontal Stabiliser rear pivot attachment. Additionally, failure of...

77 FR 1622 - Airworthiness Directives; Socata Airplanes

Science.gov (United States)

2012-01-11

... the FAA, call (816) 329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA...; fax: (816) 329-4090; email: albert.mercado@faa.gov . SUPPLEMENTARY INFORMATION: Discussion We issued a.... Send information to ATTN: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901...

Properties of powder metallurgy steel forgings

International Nuclear Information System (INIS)

Crowson, A.; Anderson, F.E.

1977-01-01

The effects of processing variables on the mechanical properties of heat-treated powder metallurgy (P/M) steel forgings were determined. Prealloyed 4600 steel powder blended with graphite to yield 4640 was compacted into preforms and hot forged in a warm, closed die. Variables studied were preform density, method of lubrication, preform sintering (time, temperature and atmosphere), forging pressure (20 and 40 tsi) and temperature (1850 0 F, 2000 0 F and 2200 0 F), and forging ratio (0.75 and 0.95). Relationships between interconnected porosity and total porosity for the various preform densities were determined. High density compacts required higher sintering temperatures due to the restricted mobility of the reducing gases in the pores. Die wall lubrication was comparable to admixed lubrication, and it simplified powder mixing and preform sintering operations. Forgings with densities from 99 to 99.8 percent of theoretical density were attained with a forging pressure of 20 to 40 tsi and preform temperatures of 2000 0 F and above. At forging conditions which resulted in forgings with acceptable mechanical properties, complete die fill was accomplished at a forging ratio of 0.95, whereas incomplete die fill resulted at a forging ratio of 0.75. The response of P/M forgings to heat treatment was comparable to that for wrought materials, and the resultant tensile and yield strengths were equivalent to the strength values described for wrought 4640 steel in AMS specification 6317B. In addition, ductility and impact properties of P/M forgings with near theoretical density (99.5+ percent) were comparable to bar stock forgings

Relation between stimulus and response in frog olfactory receptor neurons in vivo

Czech Academy of Sciences Publication Activity Database

Rospars, J. P.; Lánský, Petr; Duchamp, A.; Duchamp-Viret, P.

2003-01-01

Roč. 18, č. 5 (2003), s. 1135-1154 ISSN 0953-816X R&D Projects: GA ČR GA309/02/0168 Grant - others:CZ - FR(CZ) Projekt Barrande 972 SL; NATO(XX) LST CLG 976786 Institutional research plan: CEZ:AV0Z5011922 Keywords : intensity coding * olfaction Subject RIV: ED - Physiology Impact factor: 3.872, year: 2003

Development of gut inflammation in mice colonized with mucosa-associated bacteria from patients with ulcerative colitis

Czech Academy of Sciences Publication Activity Database

Du, Z.; Hudcovic, T.; Mrázek, J.; Kozáková, H.; Šrůtková, D.; Schwarzer, M.; Tlaskalová-Hogenová, H.; Kostovčík, M.; Kverka, Miloslav

2015-01-01

Roč. 7, dec 21 (2015), s. 32 ISSN 1757-4749 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA ČR(CZ) GAP303/12/0535 Institutional support: RVO:68378041 Keywords : dysbiosis * microbiota * germ-free mice * ulcerative colitis Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.816, year: 2015

Lung Function Impairment in Relation to Asbestos-Induced Pleural Lesions with Reference to the Extent of the Lesions and the Initial Parenchymal Fibrosis.

Czech Academy of Sciences Publication Activity Database

Lebedová, J.; Dlouhá, B.; Rychlá, L.; Neuwirth, J.; Brabec, Marek; Pelclová, D.; Fenclová, Z.

2003-01-01

Roč. 29, č. 5 (2003), s. 388-395 ISSN 0355-3140 Source of funding: V - iné verejné zdroje Keywords : asbestos exposure * asbestos-induced pleural lesion * asbestosis * lung function impairmentp * arenchymal fibrosis * pleural change * pleural thickening * ventilation impairment Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.816, year: 2003 http://www.jstor.org/stable/40967314

Metabolic adaptations and reduced respiration of the copepod ...

African Journals Online (AJOL)

The results reveal a reduction by 96% of metabolic rate in deep-living, diapausing C5s relative to surface-dwelling, active individuals. Only 14.4% of this metabolic reduction is explained by the lower ambient temperature at depth and a Q10 value of 2.34. Therefore, the major fraction (81.6%) of the metabolic reduction is ...

Simulation of N(2)O Abatement in Waste Gases by Its Decomposition over a K-Promoted Co-Mn-Al Mixed Oxide Catalyst

Czech Academy of Sciences Publication Activity Database

Obalová, L.; Jirátová, Květa; Karásková, K.; Kovanda, F.

2011-01-01

Roč. 32, 5/SI/ (2011), s. 816-820 ISSN 0253-9837. [6th International Conference on Environmental Catalysis (6th ICEC). Beijing, 12.09.2010-15.09.2010] Institutional research plan: CEZ:AV0Z40720504 Keywords : nitrous oxide * catalytic decomposition * nitric acid production Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.171, year: 2011

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

Table of Contents · More Details Fulltext PDF. pp 8-16 General Article. IPv6: The Next Generation Internet Protocol - New Features in IPv6 · Harsha Srinath ... More Details Fulltext PDF. pp 66-68 Book Review. 500 Years of Tantrasangraha – A Landmark in the History of Astronomy · B S Shylaja · More Details Fulltext PDF.

Using computational models to relate structural and functional brain connectivity

Czech Academy of Sciences Publication Activity Database

Hlinka, Jaroslav; Coombes, S.

2012-01-01

Roč. 36, č. 2 (2012), s. 2137-2145 ISSN 0953-816X R&D Projects: GA MŠk 7E08027 EU Projects: European Commission(XE) 200728 - BRAINSYNC Institutional research plan: CEZ:AV0Z10300504 Keywords : brain disease * computational modelling * functional connectivity * graph theory * structural connectivity Subject RIV: FH - Neurology Impact factor: 3.753, year: 2012

77 FR 36125 - Airworthiness Directives; SOCATA Airplanes

Science.gov (United States)

2012-06-18

... FAA, call (816) 329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA...; fax: (816) 329-4090; email: albert.mercado@faa.gov . SUPPLEMENTARY INFORMATION: Discussion We issued a... information to ATTN: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301...

76 FR 50706 - Airworthiness Directives; SOCATA Airplanes

Science.gov (United States)

2011-08-16

... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; e-mail: albert.mercado@faa... Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri...

76 FR 67341 - Airworthiness Directives; SOCATA Airplanes

Science.gov (United States)

2011-11-01

... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa...: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City...

Forging evaluaion of 304L stainless steel

International Nuclear Information System (INIS)

Packard, C.L.; Edstrom, C.M.

1979-01-01

The objective of this project was to evaluate and characterize the effects of various forging parameters on the metallographic structure and mechanical properties of 304L stainless steel forgings. Upset and die forgings were produced by hammer and Dynapak forging with forging temperatures ranging from 760 to 1145 0 C, upset reductions ranging from 20 to 60%, and annealing times ranging from 0 to 25 minutes at 843 0 C. The carbide precipitation behavior observed was found to be a function of forging temperature and annealing time. Higher forging temperatures were beneficial in avoiding continuous carbide precipitation and annealing at 843 0 C promoted increased carbide precipitation. The yield strength of the unannealed forgings decreased with increasing forging temperature and, with the exception of the 1145 0 C upset forgings, was significantly lowered by annealing

Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging

International Nuclear Information System (INIS)

Oliveira, Nathalia Rodrigues; Baldan, Renato; Gabriel, Sinara Borborema

2014-01-01

Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

Influence of Solution Treatment Temperature on Microstructural Properties of an Industrially Forged UNS S32750/1.4410/F53 Super Duplex Stainless Steel (SDSS Alloy

Directory of Open Access Journals (Sweden)

Vasile Dănuț Cojocaru

2017-06-01

Full Text Available In this present study, the influence of solution annealing temperature on microstructural properties of a forged Super Duplex Stainless Steel (SDSS was investigated by SEM-BSE (Scanning Electron Microscopy-Backscattered Electrons and SEM-EBSD (Scanning Electron Microscopy-Electron Backscatter Diffraction techniques. A brief solution treatment was applied to the forged super duplex alloy, at different temperatures between 800 °C and 1100 °C, with a constant holding time of 0.6 ks (10 min. Microstructural characteristics such as nature, weight fraction, distribution and morphology of constituent phases, average grain-size and grain misorientation were analysed in relation to the solution annealing temperature. Experimental results have shown that the constituent phases in the SDSS alloy are δ-Fe, γ-Fe and σ (Cr-Fe and that their properties are influenced by the solution treatment temperature. SEM examinations revealed microstructural modifications induced by the Cr rich precipitates along the δ/γ and δ/δ grain boundaries, which may significantly affect the toughness and the corrosion resistance of the alloy. Solution annealing at 1100 °C led to complete dissolution of σ (Cr-Fe phase, the microstructure being formed of primary δ-Fe and γ-Fe. The orientation relationship between δ/δ, γ/γ and δ/γ grains was determined by electron back scattering diffraction (EBSD. Both primary constituent phase’s microhardness and global microhardness were determined.

75 FR 75882 - Airworthiness Directives; British Aerospace Regional Aircraft Models Jetstream Series 3101 and...

Science.gov (United States)

2010-12-07

... the FAA, call 816-329-4148. FOR FURTHER INFORMATION CONTACT: Taylor Martin, Aerospace Engineer, FAA...; fax: (816) 329-4090; e-mail: taylor[email protected] . SUPPLEMENTARY INFORMATION: Discussion We issued a... requires the application of safe life limits to these components. Actions and Compliance (f) Unless already...

78 FR 64894 - Airworthiness Directives; B-N Group Ltd. Airplanes

Science.gov (United States)

2013-10-30

... INFORMATION CONTACT: Taylor Martin, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4138; fax: (816) 329-4090; email: taylor[email protected] reduced engine control with consequent loss of control. (f) Actions and Compliance Unless already done, do...

78 FR 17865 - Airworthiness Directives; PILATUS AIRCRAFT LTD. Airplanes

Science.gov (United States)

2013-03-25

... limits for the pitch trim actuator and pitch trim actuator attachment parts. If these new limitations... Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090... the pitch trim actuator attachment had been established. These new limitations were incorporated into...

78 FR 69785 - Airworthiness Directives; Slingsby Aviation Ltd. Airplanes

Science.gov (United States)

2013-11-21

... cracked horizontal stabilizer attachment brackets, which could lead to separation of the [[Page 69786... Directorate, 901 Locust, Kansas City, Missouri 64106. For information on the availability of this material at..., Kansas City, Missouri 64106; telephone: (816) 329-4144; fax: (816) 329-4090; email: [email protected

75 FR 34953 - Airworthiness Directives; GA 8 Airvan (Pty) Ltd Models GA8 and GA8-TC320 Airplanes

Science.gov (United States)

2010-06-21

... Stabilizer rear pivot attachment. Additionally, failure of some attach bolts in service may be due to..., 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090... and inboard main ribs around the area of the Horizontal Stabilizer rear pivot attachment. Additionally...

75 FR 43807 - Airworthiness Directives; Zaklad Szybo wcowy “Jeżów” Henryk Mynarski Model PW-6U Sailplanes

Science.gov (United States)

2010-07-27

...: Cracks on the lug of the rear attachment fitting of the horizontal stabilizer have been detected during..., Kansas City, Missouri 64106; telephone: (816) 329-4130; fax: (816) 329-4090. SUPPLEMENTARY INFORMATION... lug of the rear attachment fitting of the horizontal stabilizer have been detected during the...

Patterns of Smoking and Unhealthy Alcohol Use Following Sexual Trauma Among U.S. Service Members.

Science.gov (United States)

Seelig, Amber D; Rivera, Anna C; Powell, Teresa M; Williams, Emily C; Peterson, Arthur V; Littman, Alyson J; Maynard, Charles; Street, Amy E; Bricker, Jonathan B; Boyko, Edward J

2017-10-01

In the first known longitudinal study of the topic, we examined whether experiencing sexual assault or sexual harassment while in the military was associated with increased risk for subsequent unhealthy alcohol use and smoking among U.S. service members in the Millennium Cohort Study (2001-2012). Adjusted complementary log-log models were fit to estimate the relative risk of (a) smoking relapse among former smokers (men: n = 4,610; women: n = 1,453); (b) initiation of unhealthy alcohol use (problem drinking and/or drinking over recommended limits) among those with no known history of unhealthy alcohol use (men: n = 8,459; women: n = 4,816); and (c) relapse among those previously reporting unhealthy alcohol use (men: n = 3,487; women: n = 1,318). Men who reported experiencing sexual assault while in the military had sixfold higher risk for smoking relapse: relative risk (RR) = 6.62; 95% confidence interval (CI) [2.34, 18.73], than men who did not. Women who reported experiencing sexual assault while in the military had almost twice the risk for alcohol relapse: RR = 1.73; 95% CI [1.06, 2.83]. There were no other significant associations. These findings suggest that men and women may respond differently following sexual trauma, and support future concerted policy efforts by military leadership to prevent, detect, and intervene on sexual assault. Published 2017. This article is a U.S. Government work and is in the public domain in the USA.

77 FR 2238 - Airworthiness Directives; Pilatus Aircraft Ltd. Airplanes

Science.gov (United States)

2012-01-17

... attachment. If not corrected, this failure could result in loss of control of the airplane. We are issuing... the referenced service information at the FAA, Small Airplane Directorate, 901 Locust, Kansas City..., Kansas City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090; email: [email protected

78 FR 14729 - Airworthiness Directives; Pilatus Aircraft Ltd. Airplanes

Science.gov (United States)

2013-03-07

... inspect and maintain stabilizer-trim attachment components and the flap actuator could result in loss of... Locust, Kansas City, Missouri 64106. For information on the availability of this material at the FAA... Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4059; fax: (816) 329-4090...

All’s [Not] Well: Female Service and ‘Vendible’ Virginity in Shakespeare’s Problem Play

Directory of Open Access Journals (Sweden)

Emily C. Gerstell

2015-03-01

Full Text Available The article examines the economics of female service in William Shakespeare’s All’s Well That Ends Well, paying particular attention to the role Helena plays as mistress to the Widow Capilet and Diana. Such a focus reveals that what lies at the heart of All’s Well is not only, as previous scholarship has suggested, a battle between the sexes but also an intense focus on class and money. By examining both the ties between women and the ties between men that Helena forges and strengthens, I demonstrate that issues of economics and self-interest govern not only male-female relationships but also those between women. In particular, such attention highlights the role that service – conceived of as both economic and sexual – plays in driving the action and the ‘problem’ of All’s Well.

Characterization of human embryonic stem cell lines by the International Stem Cell Initiative

Czech Academy of Sciences Publication Activity Database

Adewumi, O.; Aflatoonian, B.; Ahrlund-Richter, L.; Amit, M.; Andrews, P.W.; Beighton, G.; Bello, P.A.; Benvenisty, N.; Berry, L.S.; Bevan, S.; Blum, B.; Brooking, J.; Chen, K.G.; Choo, A.B.H.; Churchill, G.A.; Corbel, M.; Damjanov, I.; Draper, J.S.; Dvořák, Petr; Emanuelsson, K.; Fleck, R.A.; Ford, A.; Gertow, K.; Gertsenstein, M.; Gokhale, P.J.; Hamilton, R.S.; Hampl, Aleš; Healy, L.E.; Hovatta, O.; Hyllner, J.; Imreh, M.P.; Itskovitz-Eldor, J.; Jackson, J.; Johnson, J.L.; Jones, M.; Kee, K.; King, B.L.; Knowles, B.B.; Lako, M.; Lebrin, F.; Mallon, B.S.; Manning, D.; Mayshar, Y.; Mckay, D.G.; Michalska, A.E.; Mikkola, M.; Mileikovsky, M.; Minger, S.L.; Moore, H.D.; Mummery, Ch.L.; Nagy, A.; Nakutsuji, N.; O´Brien, C.M.; Oh, S.K.W.; Olsson, C.; Otonkoski, T.; Park, K.Y.; Passier, R.; Patel, H.; Patel, M.; Pedersen, R.; Pera, M.F.; Piekarczyk, M.S.; Pera, R.A.P.; Reubinoff, B.E.; Robins, A.J.; Rossant, J.; Rugg-Gunn, P.; Schulz, T.C.; Semb, H.; Sherrer, E.S.; Siemen, H.; Stacey, G.N.; Stojkovic, M.; Suemori, H.; Szatkiewicz, J.; Turetsky, T.; Tuuri, T.; Van den Brink, S.; Vintersten, K.; Vuoristo, S.; Ward, D.; Weaver, T.A.; Young, L.A.; Zhang, W.

2007-01-01

Roč. 25, č. 7 (2007), s. 803-816 ISSN 1087-0156 R&D Projects: GA MŠk 1M0538; GA ČR GA301/05/0463; GA ČR GA305/05/0434 Institutional research plan: CEZ:AV0Z50390512 Keywords : International Stem Cell Initiative Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 22.848, year: 2007

Influence of photoperiod duration and light–dark transitions on entrainment of Per1 and Per2 gene and protein expression in subdivisions of the mouse suprachiasmatic nucleus

Czech Academy of Sciences Publication Activity Database

Sosniyenko, Serhiy; Hut, R.A.; Daan, S.; Sumová, Alena

2009-01-01

Roč. 30, č. 9 (2009), s. 1802-1814 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LC554; GA ČR(CZ) GA309/08/0503 Grant - others:EC(XE) LSH-2004115-4-018741 Institutional research plan: CEZ:AV0Z50110509 Keywords : clock gene * suprachiasmatic nucleus * photoperiod Subject RIV: FH - Neuro logy Impact factor: 3.418, year: 2009

The applicability of the Pennsylvania Notch Test for a new generation of PE pipe grades

Czech Academy of Sciences Publication Activity Database

Nezbedová, E.; Hutař, Pavel; Zouhar, Michal; Knésl, Zdeněk; Sadílek, J.; Náhlík, Luboš

2013-01-01

Roč. 32, č. 1 (2013), s. 106-114 ISSN 0142-9418 R&D Projects: GA ČR(CZ) GAP108/12/1560; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : PENT test * Lifetime prediction * HDPE * Slow crack growth * Fracture mechanics Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.816, year: 2013

Intrahippocampal injection of endothelin-1 in immature rats results in neuronal death, development of epilepsy and behavioral abnormalities later in life

Czech Academy of Sciences Publication Activity Database

Máttéffyová, Adéla; Otáhal, Jakub; Tsenov, Grygoriy; Mareš, Pavel; Kubová, Hana

2006-01-01

Roč. 24, č. 2 (2006), s. 351-360 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA305/06/0713; GA ČR(CZ) GD305/03/H148; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : endothelin-1 * epilepsy * immature rats Subject RIV: ED - Physiology Impact factor: 3.709, year: 2006

Acoustical enrichment during early postnatal development changes response properties of inferior colliculus neurons in rats

Czech Academy of Sciences Publication Activity Database

Bureš, Zbyněk; Bartošová, Jolana; Lindovský, Jiří; Chumak, Tetyana; Popelář, Jiří; Syka, Josef

2014-01-01

Roč. 40, č. 11 (2014), s. 3674-3683 ISSN 0953-816X R&D Projects: GA ČR(CZ) GAP303/12/1347; GA ČR(CZ) GBP304/12/G069; GA MŠk EE2.3.30.0018 Institutional support: RVO:68378041 Keywords : attention-dependent plasticity * auditory system * critical period Subject RIV: FH - Neurology Impact factor: 3.181, year: 2014

Modelling of defects in ingot forging

DEFF Research Database (Denmark)

Christiansen, Peter

The present report presents an investigation of the ingot forging process with special emphasis on modelling the influence of die geometry on the soundness of the ingot after hot forging. An investigation on how to model damage is also performed. The influence of the lower die angle is quantified...... angle of 130o-140o giving rise to the largest centreline porosity closure regardless of material hardening behaviour applied. Friction was found only to have minor influence on the optimum. Multi stroke forging operations have also been modelled since the ingot forging process consists of many forging...... damage. It is found that when evaluating damage only by relative density; feed size and lower die angle does not influence whether the hot forging process is successful or not. This is in disagreement with the general understanding of the ingot forging process. When evaluating ductile damage...

Forging Industry Leadtimes: An Analysis of Causes for and Solutions to Long Leadtimes for Aerospace Forgings

Science.gov (United States)

1986-09-01

Pamplet . Forging Industry Association, Cleveland-MT, uncatea. 20. Forging Industry Association, and American Society for Metals. Forging Handbook, edited... Pamplet . The Harris-Thomas Drop Forge Compnyayto--n R, undated. 43. Theeck, Michael F., TECH MOD Program Mana.er. Personal interview. Industrial Base... Brochure . Worcester MA, 3, . 125 "’ VITA Captain Stephen F. O’Neill was born on 19 June 1957 in Pittsfield, Massachusetts. He graduated from high school

75 FR 34953 - Existence of Proposed Airworthiness Design Standards for Acceptance Under the Primary Category...

Science.gov (United States)

2010-06-21

... Locust Street, Room 301, Kansas City, MO 64106. FOR FURTHER INFORMATION CONTACT: Mr. Leslie B. Taylor..., FAA; telephone number (816) 329-4134, fax number (816) 329-4090, e-mail at leslie.b.taylor@faa.gov..., low performance personal aircraft. Section 21.17(f) provides a means for applicants to propose...

Application of Local Adsorbant From Southeast Sulawesi Clay Immobilized Saccharomyces Cerevisiae Bread’s Yeast Biomass for Adsorption Of Mn(Ii) Metal Ion

Science.gov (United States)

R, Halimahtussaddiyah; Mashuni; Budiarni

2017-05-01

Southeast Sulawesi has a great stock of clay. It is probably to use as a source of adsorbent. The adsorbent capacity of clay can be largered with teratment using bread’s yeast as biomass. At this research, study of analysis adsorption of Mn(II) metal ion on clay immobilized Saccharomyces cerevisiae bread’s yeast biomass adsorbent has been conducted. The aims of this research were to determine the effects of contact time, pH and concentration of Mn(II) metal ion and to determine the adsorption capacity of clay immobilized S. cerevisiae biomass for adsorbtion of Mn(II) metal ion. Activated clay was synthesized by reaction of clay with KMnO4, H2SO4 and HCl. S. cerevisiae biomass was result by bread’s yeast mashed. Immobilization of S. cerevisiae biomass into clay was done by mixing of ratio of S. cerevisiae bread’s yeast biomass and clay equal to 1:3 (mass of biomassa : mass of clay). The adsorption capacity was determined by using Freundlich and Langmuir adsorption isoterms. The results of FTIR spectrums showed that the functional groups of clay immobilized S. cerevisiae biomass were Si-OH (wave number 1643 cm-1), Si-O-Si (wave number 1033 cm-1), N-H (wave number 2337 cm-1), O-H (wave number 3441cm-1), and C-H (wave number 2931 cm-1). The result of adsorption capacity from Mn(II) metal ion of contact time optimum 120 minutes, pH optimun at 7 and concentration optimum 50 mg/L were 1,816 mg/g; 0,509 mg/g and 2,624mg/g respectively. The adsorption capacity of Mn(II) metal ion with ratio 1:3 (biomass : clay) was 0,1045 mg/g. Type of isothermal adsorption followed the Freunlich adsorption.

Anisotropy effects during dwell-fatigue caused by δ-phase orientation in forged Inconel 718

Energy Technology Data Exchange (ETDEWEB)

Saarimäki, Jonas, E-mail: jonas.saarimaki@liu.se [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden); Colliander, Magnus Hörnqvist [Department of Applied Physics, Chalmers University of Technology, SE-41296 Göteborg (Sweden); GKN Aerospace Engine Systems, R& T Centre, SE-46181 Trollhättan (Sweden); Moverare, Johan J. [Division of Engineering Materials, Department of Management and Engineering, Linköping University, SE-58183 Linköping (Sweden)

2017-04-24

Inconel 718 is a commonly used superalloy for turbine discs in the gas turbine industry. Turbine discs are often subjected to dwell-fatigue as a result of long constant load cycles. The effect of anisotropy on dwell-fatigue cracking in forged turbine discs have not yet been thoroughly investigated. Crack propagation behaviour was characterised using compact tension (CT) samples cut in different orientations from a real turbine disc forging. Samples were also cut in two different thicknesses in order to investigate the influence of plane strain and plane stress condition on the crack propagation rates. The samples were subjected to dwell-fatigue tests at 550 °C with 90 s or 2160 s dwell-times at maximum load. Microstructure characterisation was done using scanning electron microscopy (SEM) techniques such as electron channelling contrast imaging (ECCI), electron backscatter diffraction (EBSD), and light optical microscopy (LOM). The forged alloy exhibits strong anisotropic behaviour caused by the non-random δ-phase orientation. When δ-phases were oriented perpendicular compared to parallel to the loading direction, the crack growth rates were approximately ten times faster. Crack growth occurred preferably in the interface between the γ-matrix and the δ-phase.

75 FR 18256 - Petition for Exemption; Summary of Petition Received

Science.gov (United States)

2010-04-09

... Federal holidays. FOR FURTHER INFORMATION CONTACT: Mr. Leslie B. Taylor, phone (816) 329- 4134, fax (816) 320-4090, e-mail leslie.b.taylor@faa.gov . This notice is published pursuant to 14 CFR 11.85. Issued... Affected: 14 CFR 23.783(f)(1). Description of Relief Sought: Hawker Beechcraft Corporation (HBC) requests...

The influence of main parameters of the process of forging on the initial quality of forging for steel 35HM

International Nuclear Information System (INIS)

Banaszek, G.; Dyja, H.; Berski, S.

2001-01-01

The article discuss the effect of the main forging parameters and the selection of tools on improving the internal quality of forgings and closing up discontinuities of metallurgical origin during forging. As a result of investigations, the optimal values of the main technological parameters of forging have been determined and the application of an appropriate group of tools have been proposed for the flat die forging of forgings. (author)

Microstructure Evolution and Surface Cracking Behavior of Superheavy Forgings during Hot Forging

Directory of Open Access Journals (Sweden)

Zhenhua Wang

2018-01-01

Full Text Available In recent years, superheavy forgings that are manufactured from 600 t grade ingots have been applied in the latest generation of nuclear power plants to provide good safety. However, component production is pushing the limits of the current free-forging industry. Large initial grain sizes and a low strain rate are the main factors that contribute to the deformation of superheavy forgings during forging. In this study, 18Mn18Cr0.6N steel with a coarse grain structure was selected as a model material. Hot compression and hot tension tests were conducted at a strain rate of 10−4·s−1. The essential nucleation mechanism of the dynamic recrystallization involved low-angle grain boundary formation and subgrain rotation, which was independent of the original high-angle grain boundary bulging and the presence of twins. Twins were formed during the growth of dynamic recrystallization grains. The grain refinement was not obvious at 1150°C. A lowering of the deformation temperature to 1050°C resulted in a fine grain structure; however, the stress increased significantly. Crack-propagation paths included high-angle grain boundaries, twin boundaries, and the insides of grains, in that order. For superheavy forging, the ingot should have a larger height and a smaller diameter.

Strain-induced grain growth of cryomilled nanocrystalline Al in trimodal composites during forging

International Nuclear Information System (INIS)

Yao, B.; Simkin, B.; Majumdar, B.; Smith, C.; Bergh, M. van den; Cho, K.; Sohn, Y.H.

2012-01-01

Highlights: ► Grain growth of cryomilled nanocrystalline aluminum during hot forging. ► Use of hollow cone dark field imaging technique in TEM for grain size measurement. ► Grain growth model of strain, strain rate and temperature for forging optimization. - Abstract: Grain growth of nanocrystalline aluminum ( nc Al) in trimodal Al metal-matrix-composites (MMCs) during hot forging was investigated. The nc Al phase formed through cryomilling of inert gas-atomized powders in liquid nitrogen has an average grain size down to 21 nm, exhibits excellent thermal stability. However, substantial grain growth of nc Al up to 63 nm was observed when the Al MMCs were thermo-mechanically processed even at relatively low temperatures. Grain growth of the cryomilled nc Al phase in trimodal Al MMCs after hot forging was documented with respect to temperature ranging from 175 °C to 287 °C, true strain ranging from 0.4 to 1.35 and strain rate ranging from 0.1 to 0.5 s −1 . Hollow cone dark field imaging technique was employed to provide statistically confident measurements of nc Al grain size that ranged from 21 to 63 nm. An increase in forging temperature and an increase in true strain were correlated with an increase in grain size of nc Al. Results were correlated to devise a phenomenological grain growth model for forging that takes strain, strain rate and temperature into consideration. Activation energy for the grain growth during thermo-mechanical hot-forging was determined to be 35 kJ/mol, approximately a quarter of activation energy for bulk diffusion of Al and a half of activation energy for static recrystallization.

Microstructural and mechanical evolutions during the forging step of the COBAPRESS, a casting/forging process

Science.gov (United States)

Perrier, Frédéric; Desrayaud, Christophe; Bouvier, Véronique

Aluminum casting/forging processes are used to produce parts for the automotive industry. In this study, we examined the influence of the forging step on the microstructure and the mechanical properties of an A356 aluminum alloy modified with strontium. Firstly, a design of samples which allows us to test mechanically the alloy before and after forging was created. A finite element analysis with the ABAQUS software predicts a maximum of strain in the core of the specimens. Observations with the EBSD technique confirm a more intense sub-structuration of the dendrite cells in this zone. Yield strength, ultimate tensile strength, elongation and fatigue lives were then improved for the casting/forging samples compared to the only cast specimens. The closure of the porosities and the improvement of the surface quality during the forging step enhance also the fatigue resistance of the samples.

21 CFR 520.816 - Epsiprantel tablets.

Science.gov (United States)

2010-04-01

... pound of body weight. (ii) Indications for use. Removal of canine cestodes Dipylidium caninum and Taenia... of feline cestodes D. caninum and T. taeniaeformis. (3) Limitations. For oral use only as a single...

50 CFR 81.6 - Project Agreement.

Science.gov (United States)

2010-10-01

...) FINANCIAL ASSISTANCE-WILDLIFE SPORT FISH RESTORATION PROGRAM CONSERVATION OF ENDANGERED AND THREATENED..., the period of time necessary to accomplish the objectives, and both the Federal and State costs. All... Office of Management and Budget Circular No. A-95 (as revised). (d) The Project Agreement will follow...

Natural aggregate totally replacement by mechanically treated concrete waste

Directory of Open Access Journals (Sweden)

Junak Jozef

2015-06-01

Full Text Available This paper presents the results obtained from the research focused on the utilization of crushed concrete waste aggregates as a partial or full replacement of 4/8 and 8/16 mm natural aggregates fraction in concrete strength class C 16/20. Main concrete characteristics such as workability, density and compressive strength were studied. Compressive strength testing intervals for samples with recycled concrete aggregates were 2, 7, 14 and 28 days. The amount of water in the mixtures was indicative. For mixture resulting consistency required slump grade S3 was followed. Average density of all samples is in the range of 2250 kg/m3 to 2350 kg/m3. The highest compressive strength after 28 days of curing, 34.68 MPa, reached sample, which contained 100% of recycled material in 4/8 mm fraction and 60% of recycled aggregates in 8/16 mm fraction. This achieved value was only slightly different from the compressive strength 34.41 MPa of the reference sample.

New Trends in Forging Technologies

Science.gov (United States)

Behrens, B.-A.; Hagen, T.; Knigge, J.; Elgaly, I.; Hadifi, T.; Bouguecha, A.

2011-05-01

Limited natural resources increase the demand on highly efficient machinery and transportation means. New energy-saving mobility concepts call for design optimisation through downsizing of components and choice of corrosion resistant materials possessing high strength to density ratios. Component downsizing can be performed either by constructive structural optimisation or by substituting heavy materials with lighter high-strength ones. In this context, forging plays an important role in manufacturing load-optimised structural components. At the Institute of Metal Forming and Metal-Forming Machines (IFUM) various innovative forging technologies have been developed. With regard to structural optimisation, different strategies for localised reinforcement of components were investigated. Locally induced strain hardening by means of cold forging under a superimposed hydrostatic pressure could be realised. In addition, controlled martensitic zones could be created through forming induced phase conversion in metastable austenitic steels. Other research focused on the replacement of heavy steel parts with high-strength nonferrous alloys or hybrid material compounds. Several forging processes of magnesium, aluminium and titanium alloys for different aeronautical and automotive applications were developed. The whole process chain from material characterisation via simulation-based process design to the production of the parts has been considered. The feasibility of forging complex shaped geometries using these alloys was confirmed. In spite of the difficulties encountered due to machine noise and high temperature, acoustic emission (AE) technique has been successfully applied for online monitoring of forging defects. New AE analysis algorithm has been developed, so that different signal patterns due to various events such as product/die cracking or die wear could be detected and classified. Further, the feasibility of the mentioned forging technologies was proven by means

Forging process design for risk reduction

Science.gov (United States)

Mao, Yongning

In this dissertation, forging process design has been investigated with the primary concern on risk reduction. Different forged components have been studied, especially those ones that could cause catastrophic loss if failure occurs. As an effective modeling methodology, finite element analysis is applied extensively in this work. Three examples, titanium compressor disk, superalloy turbine disk, and titanium hip prosthesis, have been discussed to demonstrate this approach. Discrete defects such as hard alpha anomalies are known to cause disastrous failure if they are present in those stress critical components. In this research, hard-alpha inclusion movement during forging of titanium compressor disk is studied by finite element analysis. By combining the results from Finite Element Method (FEM), regression modeling and Monte Carlo simulation, it is shown that changing the forging path is able to mitigate the failure risk of the components during the service. The second example goes with a turbine disk made of superalloy IN 718. The effect of forging on microstructure is the main consideration in this study. Microstructure defines the as-forged disk properties. Considering specific forging conditions, preform has its own effect on the microstructure. Through a sensitivity study it is found that forging temperature and speed have significant influence on the microstructure. In order to choose the processing parameters to optimize the microstructure, the dependence of microstructure on die speed and temperature is thoroughly studied using design of numerical experiments. For various desired goals, optimal solutions are determined. The narrow processing window of titanium alloy makes the isothermal forging a preferred way to produce forged parts without forging defects. However, the cost of isothermal forging (dies at the same temperature as the workpiece) limits its wide application. In this research, it has been demonstrated that with proper process design, the die

Parallel Symmetric Eigenvalue Problem Solvers

Science.gov (United States)

2015-05-01

Research” and the use of copyright material. Approved by Major Professor(s): Approved by: Head of the Departmental Graduate Program Date Alicia Marie... matrix . . . . . . . . . . . . . . . . . 106 8.15 Sparsity patterns for the Nastran benchmark of order 1.5 million . . . . 108 8.16 Sparsity patterns...magnitude eigenvalues of a given matrix pencil (A,B) along with their associated eigenvectors. Computing the smallest eigenvalues is more difficult

Extra-pair fertilizations contribute to selection on secondary male ornamentation in a socially monogamous passerine

Czech Academy of Sciences Publication Activity Database

Albrecht, Tomáš; Vinkler, Michal; Schnitzer, J.; Poláková, Radka; Munclinger, P.; Bryja, Josef

2009-01-01

Roč. 22, č. 10 (2009), s. 2020-2030 ISSN 1010-061X R&D Projects: GA ČR GA206/06/0851; GA AV ČR IAA600930608; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : extra-pair paternity * sexual selection * variance in fitness * within-pair reproductive success Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.816, year: 2009

Classical and atypical agonists activate M1 muscarinic acetylcholine receptors through common mechanisms

Czech Academy of Sciences Publication Activity Database

Randáková, Alena; Dolejší, Eva; Rudajev, Vladimír; Zimčík, Pavel; Doležal, Vladimír; El-Fakahany, E. E.; Jakubík, Jan

2015-01-01

Roč. 97, Jul 2015 (2015), s. 27-39 ISSN 1043-6618 R&D Projects: GA ČR(CZ) GA305/09/0681; GA ČR(CZ) GBP304/12/G069; GA MŠk(CZ) EE2.3.30.0025 Institutional support: RVO:67985823 Keywords : muscarinic acetylcholine receptors * atypical agonists * xanomeline * activation mechanism Subject RIV: ED - Physiology Impact factor: 4.816, year: 2015

Temporal change in shallow subsurface P- and S-wave velocities and S-wave anisotropy inferred from coda wave interferometry

Science.gov (United States)

Yamamoto, M.; Nishida, K.; Takeda, T.

2012-12-01

Recent progresses in theoretical and observational researches on seismic interferometry reveal the possibility to detect subtle change in subsurface seismic structure. This high sensitivity of seismic interferometry to the medium properties may thus one of the most important ways to directly observe the time-lapse behavior of shallow crustal structure. Here, using the coda wave interferometry, we show the co-seismic and post-seismic changes in P- and S-wave velocities and S-wave anisotropy associated with the 2011 off the Pacific coast of Tohoku earthquake (M9.0). In this study, we use the acceleration data recorded at KiK-net stations operated by NIED, Japan. Each KiK-net station has a borehole whose typical depth is about 100m, and two three-component accelerometers are installed at the top and bottom of the borehole. To estimate the shallow subsurface P- and S-wave velocities and S-wave anisotropy between two sensors and their temporal change, we select about 1000 earthquakes that occurred between 2004 and 2012, and extract body waves propagating between borehole sensors by computing the cross-correlation functions (CCFs) of 3 x 3 component pairs. We use frequency bands of 2-4, 4-8, 8-16 Hz in our analysis. Each averaged CCF shows clear wave packets traveling between borehole sensors, and their travel times are almost consistent with those of P- and S-waves calculated from the borehole log data. Until the occurrence of the 2011 Tohoku earthquake, the estimated travel time at each station is rather stable with time except for weak seasonal/annual variation. On the other hand, the 2011 Tohoku earthquake and its aftershocks cause sudden decrease in the S-wave velocity at most of the KiK-net stations in eastern Japan. The typical value of S-wave velocity changes, which are measured by the time-stretching method, is about 5-15%. After this co-seismic change, the S-wave velocity gradually recovers with time, and the recovery continues for over one year following the

Design of the Driving and Clamp Rotation Hydraulic Control System for the Heavy Load Forging Manipulator

Directory of Open Access Journals (Sweden)

Li Geqiang

2015-01-01

Full Text Available The manipulator was equipped with full hydraulic drive. We designed the hydraulic systems for the driving and clamping rotation. We used a fuzzy PID control strategy to design the electro-hydraulic proportional control system. We built a united simulation model based on the co-simulation of MATLAB/Simulink and AMEsim. A mathematical model of the system was also established. We did separate simulations of the system’s dynamic characteristics for fast forging and normal forging working conditions. The parameters were optimized. The field test shows that the steady-state error of the hydraulic system is small and the system response is fast. The system’s rapid response speed, high precision, and stability under heavy load were realized.

Precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements)

International Nuclear Information System (INIS)

1975-05-01

A standard prescribing requirements for precipitation-hardening stainless steel bars, shapes, and forgings (ASME SA-564 with additional requirements) for nuclear and associated applications is presented. This standard supersedes RDT M 7-6T, dated January 1974. (U.S.)

Elevated-temperature tensile properties of three heats of commercially heat-treated Alloy 718

International Nuclear Information System (INIS)

Booker, M.K.; Booker, B.L.P.

1980-03-01

Three heats of commercially heat-treated alloy 718 were tensile tested over the temperature range from room temperature to 816 degree C and at nominal strain rates from 6.7 x 10 -6 to 6.7 x 10 -3 /s. We examined data for yield strength, ultimate tensile strength, uniform elongation, total elongation, and reduction in area and also inspected tensile stress-strain behavior. Yield and ultimate tensile strengths for commercially heat-treated alloy 718 decrease very gradually with temperature from room temperature up to about 600 degree C for a strain rate of 6.7 x 10 -5 /s or to about 700 degree C for a strain rate of 6.7 x 10 -4 /s. Above these temperatures the strength drops off fairly rapidly. Reduction in area and total elongation data show minimum around 700 degree C, with each ductility measure falling to 10% or less at the minimum. This minimum is more pranced and occurs at lower temperatures as strain rate decreases. Up to about 600 degree C the ductility is typically around 30%. As the temperature reaches 816 degree C the ductility again increases to perhaps 60%. The uniform elongation (plastic strain at peak load) decreases only slightly with temperature to about 500 degree C then drops off rapidly and monotonically with temperature, reaching values less than 1% at 816 degree C. At the highest test temperatures the load maximum may result, not from necking of the specimen, but from overaging of the precipitation-hardened microstructure. Stress-strain curves showed serrated deformations in the temperature range from 316 to 649 degree C, although they occur only for the faster strain rates at the supper end of this temperature range. The serrations can be quite large, involving load drops of perhaps 40 to 80 MPa. The serrations typically begin within the first 2% of deformation and continue until fracture, although exceptions were noted. 16 refs., 14 figs., 3 tabs

29 CFR 1910.218 - Forging machines.

Science.gov (United States)

2010-07-01

... 29 Labor 5 2010-07-01 2010-07-01 false Forging machines. 1910.218 Section 1910.218 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.218 Forging machines. (a... other identifier, for the forging machine which was inspected. (ii) Scheduling and recording the...

Wear Analysis of Die Inserts in the Hot Forging Process of a Forked Type Forging Using Reverse Scanning Techniques

Directory of Open Access Journals (Sweden)

Łukasz Dworzak

2017-12-01

Full Text Available This article presents a wear analysis of die inserts used in the hot forging process of a forked forging (yoke, an element applied in steering systems of passenger vehicles. Studies involved the application of an original reverse scanning method intended for rapid and reliable wear analysis of forging tools (with complicated shape affording easy assessment without the need to dismount tools from the forging unit. The developed method involves analysis of progressive wear of forging tools based on measurements (scanning of forgings periodically collected from the process and constitutes a useful tool for measurement and testing. As the authors’ earlier works have demonstrated, the proposed new approach to analysis of tool wear with the application of reverse 3D scanning has proven successful in multiple instances in the case of axially symmetrical objects. The presented results of studies indicate that it is possible to utilize the expanded method to analyze the lifetime of forging tools, including tools with complex geometry. Application of the reverse scanning method allows for continuous and practical monitoring of the condition of forging tools over the course of the forging process and should have a positive impact on improving production output and reducing production costs.

48 CFR 225.7102 - Forgings.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forgings. 225.7102 Section 225.7102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Forgings. ...

Molecular detection and in vitro antioxidant activity of S-allyl-L-cysteine (SAC) extracted from Allium sativum.

Science.gov (United States)

Sun, Y-E; Wang, W-D

2016-06-30

It is well known that Allium sativum has potential applications to clinical treatment of various cancers due to its remarkable ability in eliminating free radicals and increasing metabolism. An allyl-substituted cysteine derivative - S-allyl-L-cysteine (SAC) was separated and identified from Allium sativum. The extracted SAC was reacted with 1-pyrenemethanol to obtain pyrene-labelled SAC (Py-SAC) to give SAC fluorescence properties. Molecular detection of Py-SAC was conducted by steady-state fluorescence spectroscopy and time-resolved fluorescence method to quantitatively measure concentrations of Py-SAC solutions. The ability of removing 1,1-diphenyl-2-picrylhydrazyl (DPPH) and hydroxyl radical using Py-SAC was determined through oxygen radical absorbance capacity (ORAC). Results showed the activity of Py-SAC and Vitamin C (VC) with ORAC as index, the concentrations of Py-SAC and VC were 58.43 mg/L and 5.72 mg/L respectively to scavenge DPPH, and 8.16 mg/L and 1.67 mg/L to scavenge •OH respectively. Compared with VC, the clearance rates of Py-SAC to scavenge DPPH were much higher, Py-SAC could inhibit hydroxyl radical. The ability of removing radical showed a dose-dependent relationship within the scope of the drug concentration.

What history reveals about Forge River pollution on Long Island, New York's south shore.

Science.gov (United States)

Swanson, R Lawrence; Brownawell, B; Wilson, Robert E; O'Connell, Christine

2010-06-01

Fifty years ago, the Forge River and Moriches Bay, of Long Island's south shore lagoonal system, achieved notoriety when their polluted conditions were alluded to in a report of the US President's Science Advisory Committee (1965). The Woods Hole Oceanographic Institution investigated the bay throughout the 1950s, identifying duck farming as the cause of "objectionable", "highly contaminated" conditions of these waters. Much has changed: duck farming declined; the river was dredged to remove polluted sediments, improve navigation; and barrier island inlets stabilized. Yet, the river remains seasonally eutrophic. Why? This paper reviews what occurred in the Forge River watershed. While governments aggressively curtailed the impacts of duck pollution, they failed to manage development and sewage pollution. The Forge experience indicates that watershed management is a continuing governmental responsibility as development accelerates. Otherwise, we will always be looking for that instantaneous remediation that is usually not affordable and is socially contentious.

EL TECHO DE CRISTAL EN LAS PEQUEÑAS Y MEDIANAS EMPRESAS

Directory of Open Access Journals (Sweden)

Fernando Fernández Palacín

2010-07-01

Full Text Available In spite of social and political changes throughout in the last decades, it’s still evident the low presence of women in managerial positions. In the pursuit of contribute with the equal opportunities principle, this paper analyzes the glass ceiling in 816 SMEs of different activity areas from Andalusia. It shows that the ruling culture of labor market is still causing clear vertical gender segregation.

Neuronal coding and spiking randomness

Czech Academy of Sciences Publication Activity Database

Košťál, Lubomír; Lánský, Petr; Rospars, J. P.

2007-01-01

Roč. 26, č. 10 (2007), s. 2693-2988 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LC554; GA AV ČR(CZ) 1ET400110401; GA AV ČR(CZ) KJB100110701 Grant - others:ECO-NET(FR) 112644PF Institutional research plan: CEZ:AV0Z50110509 Keywords : spike train * variability * neurovědy Subject RIV: FH - Neurology Impact factor: 3.673, year: 2007

Cloning and Molecular Analysis of HlbZip1 and HlbZip2 Transcription Factors Putatively Involved in the Regulation of the Lupulin Metabolome in Hop (Humulus lupulus L.)

Czech Academy of Sciences Publication Activity Database

Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Stehlík, Jan; Füssy, Zoltán; Krofta, K.; Heyerick, A.; Roldán-Ruiz, I.; Maloukh, L.; De Keukeleire, D.

2010-01-01

Roč. 58, č. 2 (2010), s. 902-912 ISSN 0021-8561 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052; GA MŠk ME 940 Institutional research plan: CEZ:AV0Z50510513 Keywords : secondary metabolites transcriptional regulation * cDNA-AFLP analysis * hop cDNA library screening * Nicotiana benthamiana * Petunia hybrida Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.816, year: 2010

Application of Colloidal Palladium Nanoparticles for Labeling in Electron Microscopy

Czech Academy of Sciences Publication Activity Database

Vancová, Marie; Šlouf, Miroslav; Langhans, Jan; Pavlová, Eva; Nebesářová, Jana

2011-01-01

Roč. 17, č. 5 (2011), s. 810-816 ISSN 1431-9276 R&D Projects: GA AV ČR KAN200520704; GA AV ČR KJB600960906; GA ČR GAP205/10/0348 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40500505 Keywords : electron microscopy * colloidal palladium * nanoparticles * labeling * salivary glands * Ixodes ricinus Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.007, year: 2011

Daily Magnetograms for 1978 from the AFGL (Air Force Geophysics Laboratory) Network.

Science.gov (United States)

1985-01-08

rj4TE Y rCCE#i~nT * 9 vEflEL(6-1"i( LI"ISI( td HEUs 813 7..8... ... .... M 5 3 ... . .. .. .... .. . .. ... .. .. ... .... .. .. .. . .. .. I?’ a 7...Y LS 7 .. .. . .. . . . .. . . . . . . . . .. . - ’ - S U E . . ... . . . .. . . . .. . . . . . . .. . .. . . 534S 4349QO L.~ El jIjI -2 td [w1.2...8M) iHQ ’~LTP FLMAfEOEO EUR FLUNG.ATE X CLVRC8ET 40 HIfMO1SLAM’TVUOR DIVISION 18S33 172707 81%6 TPA 2595 .’g 977 FL-ttTY-C4FLVA()T 40 tbMTES-LAS#1’VUOR

Optimization of Thixoforging Parameters for C70S6 Steel Connecting Rods

Science.gov (United States)

Özkara, İsa Metin; Baydoğan, Murat

2016-11-01

A microalloyed steel, C70S6, with a solidification interval of 1390-1479 °C, was thixoforged in the semisolid state in a closed die at temperatures in the range 1400-1475 °C to form a 1/7 scaled-down model of a passenger vehicle connecting rod. Die design and an optimized thixoforging temperature eliminated the excessive flash and other problems during forging. Tension test samples from connecting rods thixoforged at the optimum temperature of 1440 °C exhibited nearly the same hardness, yield strength, and ultimate tensile strength as conventional hot forged samples but ductility decreased by about 45% due to grain boundary ferrite network formed during cooling from the thixoforging temperature. Thus, C70S6-grade steel can be thixoforged at 1440 °C to form flash-free connecting rods. This conclusion was also validated using FEA analysis.

Forging of Advanced Disk Alloy LSHR

Science.gov (United States)

Gabb, Timothy P.; Gayda, John; Falsey, John

2005-01-01

The powder metallurgy disk alloy LSHR was designed with a relatively low gamma precipitate solvus temperature and high refractory element content to allow versatile heat treatment processing combined with high tensile, creep and fatigue properties. Grain size can be chiefly controlled through proper selection of solution heat treatment temperatures relative to the gamma precipitate solvus temperature. However, forging process conditions can also significantly influence solution heat treatment-grain size response. Therefore, it is necessary to understand the relationships between forging process conditions and the eventual grain size of solution heat treated material. A series of forging experiments were performed with subsequent subsolvus and supersolvus heat treatments, in search of suitable forging conditions for producing uniform fine grain and coarse grain microstructures. Subsolvus, supersolvus, and combined subsolvus plus supersolvus heat treatments were then applied. Forging and subsequent heat treatment conditions were identified allowing uniform fine and coarse grain microstructures.

Role of forgings in powder metallurgy industry

International Nuclear Information System (INIS)

Hayes, A.F.; DeRidder, A.J.

1975-01-01

Forging of powder metallurgy materials is discussed. Information and data are included on forging powder metallurgy W, Mo, In 100, Rene 95, Astroloy, Be, and Ti. It is noted that the combination of powder metallurgy and forging work provides the best product from standpoints of reproducibility, freedom from segregation, low scrap rate, and uniform mechanical properties. Experience is being used to develop contour forging from hot isostatic pressed billets or preforms. The quality of this product is under evaluation. Results show steady improvement and it is anticipated that continued effort will soon produce a reliable, less costly product. Forging can continue to be relied upon to correct subtle defects present in powder metallurgy material

Forging loads, deformation modes and fracture in axi-symmetrric closed die cold forging of sintered aluminium powder compacts

International Nuclear Information System (INIS)

Butt, M.A.; Ali, L.

2003-01-01

An experimental investigation into closed-die cold forging of sintered aluminium powder rod- shaped compacts was carried out. Axi-symmetric components were forged from sintered powder preforms with different initial diameter to height ratios. Different compaction pressures, sintering and lubrication conditions were used as variables during the investigations. Detailed observations were made on green/sintered density, compaction defects, forging loads, deformation modes and on the onset of fracture during progressive forging of sintered powder compacts. Experimental results obtained during the investigations have been presented and discussed in detail. (author)

On the quench sensitivity of 7010 aluminum alloy forgings in the overaged condition

Energy Technology Data Exchange (ETDEWEB)

Tiryakioğlu, Murat, E-mail: m.tiryakioglu@unf.edu [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States); Robinson, Jeremy S. [Department of Mechanical, Aeronautical and Biomedical Engineering, University of Limerick, Limerick (Ireland); Eason, Paul D. [School of Engineering, University of North Florida, Jacksonville, FL 32224 (United States)

2014-11-17

The quench sensitivity of an overaged 7010 alloy forging was characterized by tensile and Vickers hardness tests, as well as scanning electron microscopy. Longitudinal tensile specimens, excised from a rectilinear open die forging were cooled from the solution treatment temperature following thirty-two different cooling paths including interrupted and delayed quenches. SEM analysis of the microstructure showed that quench precipitates were (i) Al{sub 2}CuMg (S) which nucleated heterogeneously on grain boundaries and (ii) Mg(Zn,Cu,Al){sub 2} (η) on grain boundaries, dispersoid bands, subgrain boundaries as well as in the aluminum matrix. The quench sensitivity of the alloy's yield strength and Vickers hardness was modeled simultaneously by quadruple-C curves, using an improved methodology for Quench Factor Analysis. The four C-curves used in the model represented loss of solute by (i) precipitation of S on grain boundaries, and precipitation of η (ii) on grain boundaries and dispersoid bands, (iii) on subgrain boundaries and (iv) in the matrix. The model yielded coefficient of determination (R{sup 2}) values of 0.967 and 0.974 for yield strength and Vickers hardness, respectively. The model and the implications of the results are discussed in this paper.

Material Behavior Based Hybrid Process for Sheet Draw-Forging Thin Walled Magnesium Alloys

International Nuclear Information System (INIS)

Sheng, Z.Q.; Shivpuri, R.

2005-01-01

Magnesium alloys are conventionally formed at the elevated temperatures. The thermally improved formability is sensitive to the temperature and strain rate. Due to limitations in forming speeds, tooling strength and narrow processing windows, complex thin walled parts cannot be made by traditional warm drawing or hot forging processes. A hybrid process, which is based on the deformation mechanism of magnesium alloys at the elevated temperature, is proposed that combines warm drawing and hot forging modes to produce an aggressive geometry at acceptable forming speed. The process parameters, such as temperatures, forming speeds etc. are determined by the FEM modeling and simulation. Sensitivity analysis under the constraint of forming limits of Mg alloy sheet material and strength of tooling material is carried out. The proposed approach is demonstrated on a conical geometry with thin walls and with bottom features. Results show that designed geometry can be formed in about 8 seconds, this cannot be formed by conventional forging while around 1000s is required for warm drawing. This process is being further investigated through controlled experiments

Recent technological developments in forging; Recentes avancos tecnologicos no forjamento

Energy Technology Data Exchange (ETDEWEB)

Schaeffer, Lirio [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Programa de Pos-graduacao em Engenharia Metalurgica e dos Materiais

1987-12-31

Recent advances in the area of open and closed die forging are summarized and discussed. The use of computer and alternatives such as incremental forging, sinter forging, liquid forging and precision forging are the main items reviewed 11 refs., 10 figs.

Heavy forgings for reactor pressure vessels

International Nuclear Information System (INIS)

Cerjak, H.; Papouschek, F.

1979-01-01

The importance of forgings for an optimal design of nuclear components is described. Problems concerning the correlation of requirements, material behavior, fabrication and testing of forgings are discussed. (orig.) [de

Development of the light sensitivity of the clock genes Period1 and Period2, and immediate-early gene c-fos within the rat suprachiasmatic nucleus

Czech Academy of Sciences Publication Activity Database

Matějů, Kristýna; Bendová, Zdena; El-Hennamy, Rehab; Sládek, Martin; Sosniyenko, Serhiy; Sumová, Alena

2009-01-01

Roč. 29, č. 3 (2009), s. 490-501 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA309/08/0503; GA MŠk(CZ) LC554 Grant - others:GA ČR(CZ) GD309/08/H079; EC(XE) LSH-2004-115-4-018741 Institutional research plan: CEZ:AV0Z50110509 Keywords : circadian clock * ontogenesis * photic entrainment Subject RIV: FH - Neuro logy Impact factor: 3.418, year: 2009

Descriptions of two new species of the family oribotritiidae (Acari: Oribatida: Euphthiracaroidea)

Czech Academy of Sciences Publication Activity Database

Liu, D.; Niedbala, W.; Starý, Josef

2011-01-01

Roč. 61, č. 4 (2011), s. 811-816 ISSN 0003-4541 Grant - others:National Natural Science Foundation of China(CN) 31101617; Chinese Academy of Sciences(CN) KSCX2-EW-Z-8; National Natural Science Foundation of China(CN) 31093430; MNiSW(PL) N N303 201935 Institutional research plan: CEZ:AV0Z60660521 Keywords : oribatid mite * Oribotritiidae * new species Subject RIV: EH - Ecology, Behaviour Impact factor: 0.482, year: 2011

Campobello’s Cartuchos and Cisneros’s Molotovs: Transborder Revolutionary Feminist Narratives

Directory of Open Access Journals (Sweden)

Geneva M. Gano

2015-03-01

Full Text Available Though “revolutionary” acts and attitudes were frequently claimed in various civil rights–era movements in the US, this article considers the specific meaning of the term in a Mexican-Chicano context through a simultaneous examination of Sandra Cisneros’s The House on Mango Street (1984 and Nellie Campobello’s Cartucho: relatos de la lucha en el norte de México (1931.  By way of a formal allusion to Campobello’s revolutionary text, Cisneros forces her readers to reconsider Mango Street from a hemispheric perspective, prompting new readings of her work. Most broadly, it resituates the text within a broader Latino tradition of the modern testimonio, which demands recognition of its sociopolitical significance. More specifically, the formal connection Cisneros forges insists on a similarity between the violent spaces of the post-WWII barrio and revolutionary Durango. Thus Cisneros collapses national and temporal distinctions that would assure US readers (Cisneros’s main audience that poverty, violence, and revolution cannot happen here. To Gano, this radical use of form threatens not just literary conventions (this is not simply an assertion of “revolutionary style” but also contains the suggestive threat that the barrio is a potential site of revolution, inseparable from violent acts. That this is a woman-centered story is significant: Cisneros’s kindling world is comprised largely of women and children who are inundated with daily episodes of violence. Often dismissed as political actors, these individuals are transformed in Cisneros’s work into potential revolutionaries.

Backward can extrusion with conical,rotating punch as a cold forging tribology test

DEFF Research Database (Denmark)

Ceron, Ermanno; Bay, Niels; Tetsuo, A.

2011-01-01

with an analysis of the sliding velocity distribution along the punch nose. The latter is determined by FE analysis of the test. Results show friction stress for unalloyed low C-steel provided with different types of lubricants, e.g. phosphate coating plus soap, phosphate coating plus MoS2 and single bathe...... lubrication with PULS. The new test is so severe, that it is possible to break down the best lubrication systems for cold forging, such as phosphate coating plus soap and MoS2....

Forging technology for large nuclear pressure vessel parts

International Nuclear Information System (INIS)

Kakimoto, Hideki; Ikegami, Tomonori

2014-01-01

The increasing output of nuclear power generation calls for larger vessels for next-generation nuclear power plants. A vessel with an increased diameter requires increased load for its forging, which can make it difficult to use a conventional solid die. In order to reduce the forging load, a rotary incremental forging method has been applied to hot forging. This method includes pressing and rotating a material in an incremental manner such that a target shape is obtained. This study aimed at improving the accuracy of numerical simulation for the rotary incremental forging to reduce the load when forging large vessels. This has enabled the temperature of the material and flow stress to be precisely predicted; an example of this is reported in the paper. Specifically, the heat transfer coefficient to be used for the numerical simulation had been determined experimentally from a small-scale hot-forging. The reduction of the flow stress associated with incremental forging, had been deduced from a compression test, and the value was applied to the numerical simulation. A preform was designed on the basis of the above simulation to perform a 1/1 size scale experiment. A precision of better than 5% has been confirmed for the shape prediction. (author)

Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

OpenAIRE

Abdullah K. Shehabat

2016-01-01

This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

Numerical simulation and experimental verification of microstructure evolution in large forged pipe used for AP1000 nuclear power plants

International Nuclear Information System (INIS)

Wang, Shenglong; Yang, Bin; Zhang, Mingxian; Wu, Huanchun; Peng, Jintao; Gao, Yang

2016-01-01

Highlights: • Establish systematically the database of 316LN stainless steel for Deform-3D. • Simulate the microstructure evolution during forging of AP1000 primary coolant pipe. • Carry out full-scale forging experiment for verification in engineering practice. • Get desirable grain size in simulation and experiment. • The variation trends of grain sizes in simulation and experiment are consistent. - Abstract: AP1000 primary coolant pipe is a large special-shaped forged pipe made of 316LN stainless steel. Due to the non-uniform temperature and deformation during its forging, coarse and fine grains usually coexist in the forged pipe, resulting in the heterogeneous microstructure and anisotropic performance. To investigate the microstructure evolution during the entire forging process, in the present research, the database of the 316LN stainless steel was established and a numerical simulation was performed. The results indicate that the middle body section of the forged pipe has an extremely uniform average grain size with the value smaller than 30 μm. The grain sizes in the ends of body sections were ranged from 30 μm to 60 μm. Boss sections have relatively homogeneous microstructure with the average grain size 30 μm to 44 μm. Furthermore, a full-scale hot forging was carried out for verification. Comparison of theoretical and experimental results showed good agreement and hence demonstrated the capabilities of the numerical simulation presented here. It is noteworthy that all grains in the workpiece were confirmed less than 180 μm, which meets the designer’s demands.

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

1999-01-01

Results 8151 - 8160 of 8490 ... Marketing Information Products and Services: A Primer for Librarians and Information Professionals. Library and information sciences are experiencing a period of radical change. Publication Date. January 1, 1999. Books.

30 CFR 816.41 - Hydrologic-balance protection.

Science.gov (United States)

2010-07-01

... waste disposal areas and fills, so as to allow the movement of water to the ground-water system. (c...) Coal processing waste; (iii) Fly ash from a coal-fired facility; (iv) Sludge from an acid-mine-drainage... protection or replacement of water rights, and to support approved postmining land uses in accordance with...

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 8151 - 8160 of 8491 ... For Hunger-proof Cities: Sustainable Urban Food Systems ... Marketing Information Products and Services: A Primer for Librarians and ... on the world stage, as does its new and developing market economy. ... Transnational Social Policies: The New Development Challenges of Globalization.

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 8151 - 8160 of 8491 ... Marketing Information Products and Services: A Primer for Librarians and Information Professionals. Library and ... Viet Nam at the Crossroads: The Role of Science and Technology. Viet Nam continues ... The literature in this area, however, examines these issues strictly within national contexts.

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2015-03-16

Results 8151 - 8160 of 9604 ... That was the message delivered by women's rights lawyer Flavia Agnes ... lecturer at the IDRC Asia Regional Office in New Delhi on March 16, 2015. ... and Latino Studies at a May 2015 event in Washington, DC.​.

34 CFR 300.816 - Allocations to LEAs.

Science.gov (United States)

2010-07-01

... year of operation, the SEA must adjust the base payment for the first fiscal year after the first... with their relative numbers of children living in poverty, as determined by the SEA. (d) Use of best data. For the purpose of making grants under this section, States must apply on a uniform basis across...

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 8151 - 8160 of 8492 ... HEALTH FINANCING HEALTH ECONOMICS HEALTH EQUITY TAX ... TAX REVENUES CORPORATE SOCIAL RESPONSIBILITY ... PRINCIPLE TOBACCO CONTROL RESOURCE ALLOCATION TAX REVENUES ...

30 CFR 816.133 - Postmining land use.

Science.gov (United States)

2010-07-01

... PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING ACTIVITIES... which the postmining land use is compared shall be those uses which the land previously supported, if..., residential, or public use (including recreational facilities). (10) Federal, State, and local government...

International cooperation in cold forging technology

DEFF Research Database (Denmark)

Bay, Niels; Lange, K

1992-01-01

International cooperation in the field of cold forging technology started in 1961 by formation of the OECD Group of Experts on Metal Forming. In 1967 this group was transformed into the International Cold Forging Group, ICFG, an independent body which has now been operative for 25 years. Members...... of the ICFG are personally elected by the Plenary as experts within the field, often representing national groups within cold forging. The main work within the ICFG is carried out in its subgroups which are established by the Plenary to collect, compile and evaluate data and eventually also produce data...... by cooperative activities or by instigating national research. These subgroups have produced 9 data sheets and 7 guidelines on subjects such as materials, tool design and construction, calculation methods for cold forging tools, manufacture of slugs, lubrication aspects and small quantity production. Plenary...

Manufacturing of ultra-large diameter 20 MnMoNi 5 5 steel forgings for reactor pressure vessels and their properties

International Nuclear Information System (INIS)

Onodera, S.; Kawaguchi, S.; Tsukada, H.; Moritani, H.; Suzuki, K.; Sato, I.

1985-01-01

As the structural material for RPV typical of increased dimensions, as set of ultra-large diameter steel forgings for a PHWR RPV is presented as outlined below. (1) Material designation: 20 MnMoNi 5 5 (similar to SA508, Cl.3) (2) Size of the forgings: flanges, 8.440 mm OD, a weight of 238 tons for shell flange; shells and torus, 7,920 mm OD, with large height, cover dome, 6,800 mm OD in chord and 460 mm thick; blank before formed to dome is ca. 8,000 mm OD. (3) Chemical composition: particular effort was made for minimizing the tramp elements as P, S, As, Sn, Sb, Cu. (4) Manufacturing, key points: steel making - combined refining and degassing in ladle; ingot making - largest size ingots, including 570 ton and 500 ton ingots; forging - special ''outside-the-press'' forging and forming techniques; heat treatment - prevention of H 2 flaking in normalizing and tempering and handling of the extra-large forgings at water quenching. (5) Metallurgical properties: sufficiently uniform carbon distributions in the forgings; a lowest possible content of hydrogen, non-metallic inclusions and oxygen. Mechanical properties: uniformity in tensile and toughness properties; flaws - only limited number of spots of UT indications under 2 mm EFG (EFS). (orig.)

Racial and ethnic minority nurses' job satisfaction in the U.S.

Science.gov (United States)

Xue, Ying

2015-01-01

Understanding minority nurses' job satisfaction is a critical first step to inform strategies designed to retain minority nurses and improve institutional climate to ensure sustained diversity. Yet, empirical evidence is limited in this regard, especially comparisons across racial and ethnic groups in a national sample in the U.S. To determine minority nurses' job satisfaction across racial and ethnic groups relative to White nurses using a national representative sample. A retrospective cross-sectional analysis was conducted using the 2008 National Sample Survey of Registered Nurses. The sample includes registered nurses who were primarily employed in nursing in the U.S. Job satisfaction was measured by a single survey item. Racial and ethnic minority status was defined as self-identified membership in a group other than White non-Hispanic, including Hispanic and non-Hispanic Black, Asian, Native Hawaiian/Pacific Islander, American Indian/Alaska Native, and Multiracial. Multinomial logistic regression was performed to compare job satisfaction across racial and ethnic groups while adjusting for individual and job-related characteristics. The majority of nurses were satisfied with their job. The nurse group that had the highest proportion of being satisfied with their job was Native Hawaiian/Pacific Islander (88.8%), followed by White (81.6%), Asian (81%), Hispanic (78.9%), Black (76%), Multiracial (75.7%), and American Indian/Alaska Native (74.3%). Adjusting for individual and job-related characteristics, evidence indicated the potential for lower job satisfaction among Black, American Indian/Alaska Native, and Multiracial nurses compared to White nurses. Asian nurses reported the highest levels of neutral (versus dissatisfaction) compared to White nurses. There was no evidence indicating a clear difference in job satisfaction between Hispanic, Native Hawaiian/Pacific Islander, and White nurses. Moderate differences in job satisfaction were observed across racial

Profiles of the Caribbean Basin in 1960/1980: Changing Geopolitical and Geostrategic Dimensions.

Science.gov (United States)

1983-12-01

8.816.000 (SI = I quetzal ) ARM1Y: 8,400 regs 2 bns 18 60mm (US). 99 80mm (Ger), 8 81mm (US), 2 lnchr (flare) mor; 17 3. 5 -in rkt lnchr (US), 8 57mm rclss...service: conscription; 2 years Total armed forces: 15,050 Estimated GNP 1979: S6.9 bn Defense excpenditure 1980: 76.8 m quetzal ’S69.S m) S51 1.1 quetzal ...1980), 1.0 quetzal (1979) ARMY: 14,000 4 bde H{Q 1 Presidential Guard bde 9 jnf bps 1 Para bn 1 engr bn I armd car co 13 arty btys 7 M-3 Sruart It tks

Hot forging of roll-cast high aluminum content magnesium alloys

Science.gov (United States)

Kishi, Tomohiro; Watari, Hisaki; Suzuki, Mayumi; Haga, Toshio

2017-10-01

This paper reports on hot forging of high aluminum content magnesium alloy sheets manufactured using horizontal twin-roll casting. AZ111 and AZ131 were applied for twin-roll casting, and a hot-forging test was performed to manufacture high-strength magnesium alloy components economically. For twin-roll casting, the casting conditions of a thick sheet for hot forging were investigated. It was found that twin-roll casting of a 10mm-thick magnesium alloy sheet was possible at a roll speed of 2.5m/min. The grain size of the cast strip was 50 to 70µm. In the hot-forging test, blank material was obtained from as-cast strip. A servo press machine with a servo die cushion was used to investigate appropriate forging conditions (e.g., temperature, forging load, and back pressure) for twin-roll casts (TRCs) AZ111 and AZ131. It was determined that high aluminum content magnesium alloy sheets manufactured using twin-roll casting could be forged with a forging load of 150t and a back pressure of 3t at 420 to 430°C. Applying back pressure during hot forging effectively forged a pin-shaped product.

Effect of Mg.sup.2+./sup. ions co-doping on timing performance and radiation tolerance of Cerium doped Gd.sub.3./sub.Al.sub.2./sub.Ga.sub.3./sub.O.sub.12./sub. crystals

Czech Academy of Sciences Publication Activity Database

Lucchini, M.T.; Babin, Vladimir; Boháček, Pavel; Gundacker, S.; Kamada, K.; Nikl, Martin; Petrosyan, A.; Yoshikawa, A.; Auffray, E.

2016-01-01

Roč. 816, Apr (2016), s. 176-183 ISSN 0168-9002 R&D Projects: GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 644260 - INTELUM; European Commission(XE) 690599 - ASCIMAT Grant - others:EU COST Fast advanced Scintillator Timing (FAST)(XE) TD COST Action TD1401 Institutional support: RVO:68378271 Keywords : inorganic scintillators * medical imaging * calorimeters * time-of-flight * radiation tolerance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.362, year: 2016

Chlorine Dioxide Disinfection in the Use of Individual Water Purification Devices

Science.gov (United States)

2006-03-01

CTs ranging from 1.7-17.6 mg-min/L necessary for 2-log Giardia muris cyst inactivation (reference 23). The SWTR provides the following CT values...reference 3). A comparison of CTs required for a 2-log inactivation for E. Coli bacteria, Poliovirus 1, and Giardia cysts showed Giardia cysts were 2-5...Cryptosporidium oocysts are the most resistant, being 8-16 times more resistant than Giardia cysts (reference 5). Chlorine dioxide’s general disinfection

Insight on Mutation-Induced Resistance from Molecular Dynamics Simulations of the Native and Mutated CSF-1R and KIT.

Directory of Open Access Journals (Sweden)

Priscila Da Silva Figueiredo Celestino Gomes

Full Text Available The receptors tyrosine kinases (RTKs for the colony stimulating factor-1, CSF-1R, and for the stem cell factor, SCFR or KIT, are important mediators of signal transduction. The abnormal function of these receptors, promoted by gain-of-function mutations, leads to their constitutive activation, associated with cancer or other proliferative diseases. A secondary effect of the mutations is the alteration of receptors' sensitivity to tyrosine kinase inhibitors, compromising effectiveness of these molecules in clinical treatment. In particular, the mutation V560G in KIT increases its sensitivity to Imatinib, while the D816V in KIT, and D802V in CSF-1R, triggers resistance to the drug. We analyzed the Imatinib binding affinity to the native and mutated KIT (mutations V560G, S628N and D816V and CSF-1R (mutation D802V by using molecular dynamics simulations and energy calculations of Imatinib•target complexes. Further, we evaluated the sensitivity of the studied KIT receptors to Imatinib by measuring the inhibition of KIT phosphorylation. Our study showed that (i the binding free energy of Imatinib to the targets is highly correlated with their experimentally measured sensitivity; (ii the electrostatic interactions are a decisive factor affecting the binding energy; (iii the most deleterious impact to the Imatinib sensitivity is promoted by D802V (CSF-1R and D816V (KIT mutations; (iv the role of the juxtamembrane region, JMR, in the imatinib binding is accessory. These findings contribute to a better description of the mutation-induced effects alternating the targets sensitivity to Imatinib.

Press forging and optical properties of lithium fluoride

Science.gov (United States)

Ready, J. F.; Vora, H.

1980-07-01

Lithium fluoride is an important candidate material for windows on high power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals were press forged in one step over the temperature range 300 to 600 C to obtain fine grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40 percent at 400 C to 65 percent at 600 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 C, to total deformations of 69 to 76 percent, with intermediate annealing at 700 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one step forging. The results of characterization of various optical and mechanical properties of single crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described.

Press forging and optical properties of lithium fluoride

International Nuclear Information System (INIS)

Ready, J.F.; Vora, H.

1979-01-01

Lithium fluoride is an important candidate material for windows on high-power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals have been press forged in one step over the temperature range 300 to 600 0 c to obtain fine-grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40% at 400 0 C to 65% at 600 0 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 0 C, to total deformations of 69-76%, with intermediate annealing at 700 0 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one-step forging. The results of characterization of various optical and mechanical properties of single-crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described

Diasporic Authenticity Assertions: Analysis of Amy Tan’s The Bonesetter’s Daughter

Directory of Open Access Journals (Sweden)

Naeimeh Tabatabaei Lotfi

2015-07-01

Full Text Available This essay is an attempt to examine the active interaction of history and memory, in formulation of a diasporic authentic picture of past, in Amy Tan’s The Bonesetter’s Daughter (2001. Amongst discursive disciplines, memory and history perform vitally, in picturing past; both attempt to reproduce events, by emblematic narrative acts. However, their erratic quality endorses the existence of counter- stories that endangers displaying a homogeneous past. Among miscellaneous categories of memories, autobiographical memory asserts to obtain an authentic presentation, but as any other forms of accounts, it exhibits an imprecise fictional image. This psychological alleviation ensures the future mental integrity of trauma victims. In memory narratives, the contingent temperament of power network and continual formulation of resisting frameworks might be explored. Tan’s diasporic assertion of authenticity, as a migrant writer, amalgamated with employment of fantasy is to obtain a shared diasporic identity, among her characters, although personal accounts of characters undergo an extensive amount of contingency. The newly forged identity is collective in nature and defies the geographical and temporal borders and grants a humane picture rather than a diasporic one; an identity that is established to venerate the cardinal role of personal memory, in endowing legitimate truth.

Societal Implications of Health Insurance Coverage for Medically Necessary Services in the U.S. Transgender Population: A Cost-Effectiveness Analysis.

Science.gov (United States)

Padula, William V; Heru, Shiona; Campbell, Jonathan D

2016-04-01

Recently, the Massachusetts Group Insurance Commission (GIC) prioritized research on the implications of a clause expressly prohibiting the denial of health insurance coverage for transgender-related services. These medically necessary services include primary and preventive care as well as transitional therapy. To analyze the cost-effectiveness of insurance coverage for medically necessary transgender-related services. Markov model with 5- and 10-year time horizons from a U.S. societal perspective, discounted at 3% (USD 2013). Data on outcomes were abstracted from the 2011 National Transgender Discrimination Survey (NTDS). U.S. transgender population starting before transitional therapy. No health benefits compared to health insurance coverage for medically necessary services. This coverage can lead to hormone replacement therapy, sex reassignment surgery, or both. Cost per quality-adjusted life year (QALY) for successful transition or negative outcomes (e.g. HIV, depression, suicidality, drug abuse, mortality) dependent on insurance coverage or no health benefit at a willingness-to-pay threshold of $100,000/QALY. Budget impact interpreted as the U.S. per-member-per-month cost. Compared to no health benefits for transgender patients ($23,619; 6.49 QALYs), insurance coverage for medically necessary services came at a greater cost and effectiveness ($31,816; 7.37 QALYs), with an incremental cost-effectiveness ratio (ICER) of $9314/QALY. The budget impact of this coverage is approximately $0.016 per member per month. Although the cost for transitions is $10,000-22,000 and the cost of provider coverage is $2175/year, these additional expenses hold good value for reducing the risk of negative endpoints--HIV, depression, suicidality, and drug abuse. Results were robust to uncertainty. The probabilistic sensitivity analysis showed that provider coverage was cost-effective in 85% of simulations. Health insurance coverage for the U.S. transgender population is affordable

Quality assurance for hammer forgings

International Nuclear Information System (INIS)

Potthast, E.

1984-01-01

The quality assurance program introduced by Arbed Saarstahl and laid down in a quality assurance manual is described. A particular attention is attached thereby both to quality practice proper and to a reliable flow of information amongst all the persons involved. The production and test sequence schedules of the hammer forging plant are illustrated by the example of a forged valve housing for nuclear power plants. These schedules specify not only the forging process in the individual production stages but also the workpiece contour after each working operation, the heat treatment, the furnace charging, and the inspection of finished parts. The formalization of the tests is designed both to promote the customer's trust towards the supplier and to prevent the formal operations involved from hindering further technical development. (orig.) [de

Co-Operative Training in the Sheffield Forging Industry

Science.gov (United States)

Duncan, R.

2008-01-01

Purpose: The purpose of this paper is to give details of an operation carried out in Sheffield to increase the recruitment of young men into the steel forging industry. Design/methodology/approach: The Sheffield Forges Co-operative Training Scheme was designed to encourage boys to enter the forging industry and to provide them with training and…

Self-adaptive multimethod optimization applied to a tailored heating forging process

Science.gov (United States)

Baldan, M.; Steinberg, T.; Baake, E.

2018-05-01

The presented paper describes an innovative self-adaptive multi-objective optimization code. Investigation goals concern proving the superiority of this code compared to NGSA-II and applying it to an inductor’s design case study addressed to a “tailored” heating forging application. The choice of the frequency and the heating time are followed by the determination of the turns number and their positions. Finally, a straightforward optimization is performed in order to minimize energy consumption using “optimal control”.

Antioxidant activity by a synergy of redox-sensitive mitochondrial phospholipase A2 and uncoupling protein-2 in lung and spleen

Czech Academy of Sciences Publication Activity Database

Jabůrek, Martin; Ježek, Jan; Zelenka, Jaroslav; Ježek, Petr

2013-01-01

Roč. 45, č. 4 (2013), s. 816-825 ISSN 1357-2725 R&D Projects: GA ČR(CZ) GAP302/10/0346; GA ČR(CZ) GPP303/11/P320; GA MŠk(CZ) ME09018 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : mitochondrial uncoupling protein UCP2 * mitochondrial phospholipase A(2) isoform gamma * mitochondrial oxidative stress attenuation * fatty acid * antioxidant mechanism Subject RIV: ED - Physiology Impact factor: 4.240, year: 2013

Sidelining Democracy : Explaining the United States Response to Thailand’s 2006 and 2014 Coups D’etat

Science.gov (United States)

2016-06-01

force against extreme political corruption and unrest. A strong U.S. government pushback to the coups can result in Thailand pursuing an already...despite setbacks in Thailand’s democratization process , suggesting that the U.S. government values having a reliable, stable ally over a democratic...In the process , Thailand ceded territorial rights, forged alliances with great powers, and played alliances with great powers for its survival

Estufas climatizadas para experimentos ambientais com rãs, em gaiolas Acclimatized incubators for environmental experiments with frogs, in cages

Directory of Open Access Journals (Sweden)

Mario Roberto Chim Figueiredo

2001-07-01

Full Text Available Foram construídas seis estufas climatizadas, instaladas inicialmente no Ranário Experimental da Universidade Federal de Viçosa e, posteriormente, no Ranário Experimental da Fundação Universidade Federal do Rio Grande, com o objetivo de realizar experimentos para avaliar os efeitos do ambiente sobre o desempenho de rãs em gaiolas de fibra de vidro. Ambientes com temperaturas de 25ºC e fotoperíodo de 12/12 horas de luz/horas de escuridão (h L/E serviram para adaptação das rãs por 15 dias antes de cada experimento. Os tratamentos consistiram em simular ambientes com temperaturas variando de 20 a 35ºC e fotoperíodos de 8/16, 12/12 e 16/8 h L/E. Foram realizados experimentos com rã-touro (Rana catesbeiana Shaw, 1802 e rã-manteiga (Leptodactylus ocellatus Linnaeus, 1758. Nessas estufas foi possível estimar que: a os maiores ganhos de peso de rã-touro foram obtidos entre 27,6 e 29,7ºC, com melhor crescimento entre 28,2 e 30,1ºC; para rã-manteiga os melhores ganhos e conversão alimentar foram observados a 28,6 e 28ºC, respectivamente; b a temperatura interage com fotoperíodo sobre o desempenho das rãs e seu desenvolvimento gonadal; c a 27,7ºC (temperatura de conforto térmico haverá menos rãs dentro d'água; d a maior temperatura cloacal de rã-touro, 32,1ºC no seco e 33,8ºC dentro d'água, a 35ºC, evidenciou que as rãs se termorregulam; e os níveis de tetraiodotironina (T4 no plasma decrescem na temperatura de conforto térmico; f rã-manteiga condiciona-se ao manejo de rotina, reunindo-se ao redor do cocho na hora da alimentação.Six acclimatized incubators were initially installed in the Experimental Frog Farm of the Federal University of Viçosa and later in Experimental Frog Farm of the Federal University of Rio Grande, with the objective of accomplishing experiments to evaluate the effects of the environment on frogs performance in cages of fiber glass. Environments with temperatures of 25ºC and photoperiod of

Forged HITEMAL: Al-based MMCs strengthened with nanometric thick Al{sub 2}O{sub 3} skeleton

Energy Technology Data Exchange (ETDEWEB)

Balog, Martin, E-mail: ummsbama@savba.sk [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Krizik, Peter; Nosko, Martin; Hajovska, Zuzana [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia); Victoria Castro Riglos, Maria [Centro Atómico Bariloche, Av. Bustillo 9.500, 8400 Bariloche, Río Negro (Argentina); Rajner, Walter [New Materials Development GmbH, Römerstrasse 28, 83410 Laufen, Leobendorf (Germany); Liu, De-Shin [National Chung Cheng University, 168 University Rd., Min-Hsiung, 62102 Chia-Yi, Taiwan (China); Simancik, Frantisek [Institute of Materials and Machine Mechanics, Slovak Academy of Sciences, Racianska 75, 83102 Bratislava (Slovakia)

2014-09-08

Bulk Al–Al{sub 2}O{sub 3} metal matrix composites (MMCs) named HITEMAL (high temperature aluminum) were fabricated in situ by forging compaction of five different types of gas-atomized commercial purity Al powders with a mean particle size in the range of 1–9 µm. As-forged HITEMAL consisted of (sub)micrometric Al grains (matrix) decorated with nanometric thick amorphous Al{sub 2}O{sub 3} (a-Al{sub 2}O{sub 3}) skeleton. Low-angle grain boundaries (LAGBs) free of Al{sub 2}O{sub 3} were located in the Al grain interior. The Al grain size and the portion of LAGBs increased with the increase in the relative powder surface area. As-forged HITEMAL shows excellent thermal stability up to 400 °C for 24 h. Annealing at temperatures ≥450 °C led to crystallization and morphological transformation from a-Al{sub 2}O{sub 3} skeleton to nanometric γ-Al{sub 2}O{sub 3} particles. Owing to the pinning effect of Al{sub 2}O{sub 3} phase, no Al grain growth took place during annealing up to 500 °C. HITEMAL showed attractive mechanical properties especially when tested at 300 °C (yield strength up to 220 MPa, Young's modulus up to 58 GPa). Despite the presence of a nearly continuous a-Al{sub 2}O{sub 3} skeleton along adjacent Al grains, forged HITEMAL materials had reasonable room temperature elongation of 7–26%. HITEMAL's elongation decreased as the Al grain size decreased and with increased testing temperature. The loss in elongation (uniform and total) was attributed to the inhomogeneous flow, which occurred due to high densities of high angle grain boundaries (dislocation sinks) and small content of LAGBs. The strength of HITEMAL stemmed from grain boundary mediated strengthening mechanisms. The results showed a positive deviation from the Hall–Petch plot, which is typical behavior of ultrafine-grained metals. Transformation of a-Al{sub 2}O{sub 3} skeleton to γ-Al{sub 2}O{sub 3} particles led to deterioration of the HITEMAL strength and Young's modulus.

Phased Array Ultrasonic Inspection of Titanium Forgings

International Nuclear Information System (INIS)

Howard, P.; Klaassen, R.; Kurkcu, N.; Barshinger, J.; Chalek, C.; Nieters, E.; Sun, Zongqi; Fromont, F. de

2007-01-01

Aerospace forging inspections typically use multiple, subsurface-focused sound beams in combination with digital C-scan image acquisition and display. Traditionally, forging inspections have been implemented using multiple single element, fixed focused transducers. Recent advances in phased array technology have made it possible to perform an equivalent inspection using a single phased array transducer. General Electric has developed a system to perform titanium forging inspection based on medical phased array technology and advanced image processing techniques. The components of that system and system performance for titanium inspection will be discussed

Evolution of A-Type Macrosegregation in Large Size Steel Ingot After Multistep Forging and Heat Treatment

Science.gov (United States)

Loucif, Abdelhalim; Ben Fredj, Emna; Harris, Nathan; Shahriari, Davood; Jahazi, Mohammad; Lapierre-Boire, Louis-Philippe

2018-06-01

A-type macrosegregation refers to the channel chemical heterogeneities that can be formed during solidification in large size steel ingots. In this research, a combination of experiment and simulation was used to study the influence of open die forging parameters on the evolution of A-type macrosegregation patterns during a multistep forging of a 40 metric ton (MT) cast, high-strength steel ingot. Macrosegregation patterns were determined experimentally by macroetch along the longitudinal axis of the forged and heat-treated ingot. Mass spectroscopy, on more than 900 samples, was used to determine the chemical composition map of the entire longitudinal sectioned surface. FORGE NxT 1.1 finite element modeling code was used to predict the effect of forging sequences on the morphology evolution of A-type macrosegregation patterns. For this purpose, grain flow variables were defined and implemented in a large scale finite element modeling code to describe oriented grains and A-type segregation patterns. Examination of the A-type macrosegregation showed four to five parallel continuous channels located nearly symmetrical to the axis of the forged ingot. In some regions, the A-type patterns became curved or obtained a wavy form in contrast to their straight shape in the as-cast state. Mass spectrometry analysis of the main alloying elements (C, Mn, Ni, Cr, Mo, Cu, P, and S) revealed that carbon, manganese, and chromium were the most segregated alloying elements in A-type macrosegregation patterns. The observed differences were analyzed using thermodynamic calculations, which indicated that changes in the chemical composition of the liquid metal can affect the primary solidification mode and the segregation intensity of the alloying elements. Finite element modeling simulation results showed very good agreement with the experimental observations, thereby allowing for the quantification of the influence of temperature and deformation on the evolution of the shape of the

Kinematics at the Main Mechanism of a Railbound Forging Manipulator

Directory of Open Access Journals (Sweden)

Florian Ion Tiberiu Petrescu

2015-09-01

Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 Heavy payload forging manipulators are mainly characterized by large load output and large capacitive load input. The relationship between outputs and inputs will greatly influence the control and the reliability. Forging manipulators have become more prevalent in the industry today. They are used to manipulate objects to be forged. The most common forging manipulators are moving on a railway to have a greater precision and stability. They have been called the railbound forging manipulators. In this paper we analyze the general kinematics of the main mechanism from a such manipulator. Kinematic scheme shows a typical forging manipulator, with the basic motions in operation process: walking, motion of the tong and buffering. The lifting mechanism consists of several parts including linkages, hydraulic drives and motion pairs. The principle of type design from the viewpoints of the relationship between output characteristics and actuator inputs is discussed. An idea of establishing the incidence relationship between output characteristics and actuator inputs is proposed. These novel forging manipulators which satisfy certain functional requirements provide an effective help for the design of forging manipulators.

Study on the isothermal forging process of MB26 magnesium alloy adaptor

Directory of Open Access Journals (Sweden)

Xu Wenchen

2015-01-01

Full Text Available The isothermal forging process is an effective method to manufacture complex-shaped components of hard-to-work materials, such as magnesium alloys. This study investigates the isothermal forging process of an MB26 magnesium alloy adaptor with three branches. The results show that two-step forging process is appropriate to form the adaptor forging, which not only improves the filling quality but also reduces the forging load compared with one-step forging process. Moreover, the flow line is distributed along the contour of the complex-shaped adaptor forging.

Influence of the coating process on the tribological conditions during cold forging with a MoS2 based lubricant

Science.gov (United States)

Lorenz, Robby; Hagenah, Hinnerk; Merklein, Marion

2018-05-01

Cold forging processes such as forward rod extrusion can be used to produce high quality components like connection rods, shafts and gears. The main advantages of these extruded components are sufficient surface quality, work hardening, compressive residual stresses and fatigue strength. Since one technical disadvantage of extruded components lies in the achievable tolerance classes, the improvement of these should be of crucial importance. For instance, the attainable workpiece accuracy and component quality can be influenced by adapting the tribological system in such a way that the resulting friction is specifically controlled in order to improve component forming. Lubricant modification is one practical way of adapting the tribological system to the requirements of the forming process. An industrial established and highly efficient lubricant system is the application of a zinc-phosphate conversion layer with a molybdenum disulfide-based lubricant. While offering many advantages, its tribological conditions seem to depend strongly on the layer weight and the application strategy. These parameters and the respective interdependencies have not been sufficiently investigated yet. In order to examine this, the tribological conditions depending on the layer weight are analyzed in greater detail using the Ring-Compression-Test (RCT). This tribometer provides a comparative representation of the forming conditions during cold forging. Furthermore, a potential dependency between the tribological conditions and two different coating techniques is analyzed. The latter are represented by the industrial standards dipping and dip-drumming.

Near-Net Forging Technology Demonstration Program

Science.gov (United States)

Hall, I. Keith

1996-01-01

Significant advantages in specific mechanical properties, when compared to conventional aluminum (Al) alloys, make aluminum-lithium (Al-Li) alloys attractive candidate materials for use in cryogenic propellant tanks and dry bay structures. However, the cost of Al-Li alloys is typically five times that of 2219 aluminum. If conventional fabrication processes are employed to fabricate launch vehicle structure, the material costs will restrict their utilization. In order to fully exploit the potential cost and performance benefits of Al-Li alloys, it is necessary that near-net manufacturing methods be developed to off-set or reduce raw material costs. Near-net forging is an advanced manufacturing method that uses elevated temperature metal movement (forging) to fabricate a single piece, near-net shape, structure. This process is termed 'near-net' because only a minimal amount of post-forge machining is required. The near-net forging process was developed to reduce the material scrap rate (buy-to-fly ratio) and fabrication costs associated with conventional manufacturing methods. The goal for the near-net forging process, when mature, is to achieve an overall cost reduction of approximately 50 percent compared with conventional manufacturing options for producing structures fabricated from Al-Li alloys. This NASA Marshall Space Flight Center (MSFC) sponsored program has been a part of a unique government / industry partnership, coordinated to develop and demonstrate near-net forging technology. The objective of this program was to demonstrate scale-up of the near-net forging process. This objective was successfully achieved by fabricating four integrally stiffened, 170- inch diameter by 20-inch tall, Al-Li alloy 2195, Y-ring adapters. Initially, two 2195 Al-Li ingots were converted and back extruded to produce four cylindrical blockers. Conventional ring rolling of the blockers was performed to produce ring preforms, which were then contour ring rolled to produce

Fluidized Bed Gasification of Coal-Oil and Coal-Water-Oil Slurries by Oxygen –Steam and Oxygen-CO2 Mixtures

Czech Academy of Sciences Publication Activity Database

Svoboda, Karel; Pohořelý, Michael; Jeremiáš, Michal; Kameníková, Petra; Hartman, Miloslav; Skoblia, S.; Šyc, Michal

2012-01-01

Roč. 95, č. 1 (2012), s. 16-26 ISSN 0378-3820 R&D Projects: GA MŠk 2B08048; GA MŠk 7C08034 Grant - others:RFCR(XE) CT-2010-00009 Institutional research plan: CEZ:AV0Z40720504 Keywords : fluidized bed * gasification * coal slurries Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 2.816, year: 2012 http://www.scopus.com/record/display.url?eid=2-s2.0-82455175439&origin=resultslist&sort=plf-f&src=s&st1=svoboda%2ck&sid=ikNGw6d45E-yyuMoDwlGiWn%3a420&sot=b&sdt=b&sl=22&s=AUTHOR-NAME%28svoboda%2ck%29&relpos=1&relpos=1&searchTerm=AUTHOR-NAME(svoboda,k)

The Forging of a White Gay Aesthetic at the Saint, 1980–84

Directory of Open Access Journals (Sweden)

Tim Lawrence

2011-06-01

Full Text Available Based on original interviews with key protagonists and documentary research, the article examines the way in which the DJs who worked at the Saint forged a white gay aesthetic across the first half of the 1980s. A private party located in the East Village, New York, the Saint attracted a privileged white male crowd, and this group's position within the emerging culture of neoliberalism, along with the deepening impact of the AIDS epidemic, encouraged its spinners to sever their ties with sounds that were associated with blackness. However, if Saint DJs rejected a high proportion of records that were being released by New York's independents, and also snubbed Chicago house when it broke in 1985, their forging of an aesthetic that emphasised seamless transitions, often between records that contained similar sonic qualities, preempted the style of mixing that would be popularised in house music culture.

Instant forgedUI starter

CERN Document Server

Luiz, Joseandro

2013-01-01

Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.The book is a Starter guide to learning ForgedUI. This book will start by unfolding the installation and creating a simple application using Titanium and ForgedUI, followed by taking you through the features to model an engaging UI and generate multi-platform code with Titanium, while covering the best design practice for Apple and Android application development. Last but not least, you will also come across the available resources where you can

An empirical model for friction in cold forging

DEFF Research Database (Denmark)

Bay, Niels; Eriksen, Morten; Tan, Xincai

2002-01-01

With a system of simulative tribology tests for cold forging the friction stress for aluminum, steel and stainless steel provided with typical lubricants for cold forging has been determined for varying normal pressure, surface expansion, sliding length and tool/work piece interface temperature...... of normal pressure and tool/work piece interface temperature. The model is verified by process testing measuring friction at varying reductions in cold forward rod extrusion. KEY WORDS: empirical friction model, cold forging, simulative friction tests....

40 CFR 467.40 - Applicability; description of the forging subcategory.

Science.gov (United States)

2010-07-01

... forging subcategory. 467.40 Section 467.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ALUMINUM FORMING POINT SOURCE CATEGORY Forging Subcategory § 467.40 Applicability; description of the forging subcategory. This subpart applies to discharges of...

Die forging of the alloys Az80 and Zk60

NARCIS (Netherlands)

Kurz, G.; Clauw, B.; Sillekens, W.H.; Letzig, D.

2009-01-01

Overall goal of the MagForge project is to provide tailored and cost-effective technologies for the industrial manufacturing of magnesium forged components. Scientific and technological aspects are new alloys/feedstock materials with improved performance, forging process modeling and design tools

Sintering and densification; new techniques: sinter forging

International Nuclear Information System (INIS)

Winnubst, A.J.A.

1998-01-01

In this chapter pressure assisted sintering methods will be described. Attention will mainly be paid to sinter forging as a die-wall free uniaxial pressure sintering technique, where large creep strains are possible. Sinter forging is an effective tool to reduce sintering temperature and time and to obtain a nearly theoretically dense ceramic. In this way grain size in tetragonal zirconia ceramics can be reduced down to 100 nm. Another important phenomenon is the reduction of the number density and size of cracks and flaws resulting in higher strength and improved reliability, which is of utmost importance for engineering ceramics. The creep deformation during sinter forging causes a rearrangement of the grains resulting in a reduction of interatomic spaces between grains, while grain boundary (glassy) phases can be removed. The toughness and in some cases the wear resistance is enhanced after sinter forging as a result of the grain-boundary-morphology improvement. (orig.)

A-508 class 3 forgings for pressure vessels

International Nuclear Information System (INIS)

Comon, J.

1977-01-01

The manufacture of the forged parts of the first PWR nuclear pressure vessel installed in France started in the Creusot-Loire's Forge Plant in 1961. Since this date, more than 300 forgings of this type were delivered (flanges, rings, zones, and nozzles). The major part of these forgings were made of Mn, Ni, Mo steel (SA 508 class 3). They represent a population large and homogeneous enough to attempt a statistical analysis of chemical and mechanical test results. The aim of this analysis was double: (1) a better knowledge of the scattering of the results and a better estimate of what can be introduced or accepted in a specification, and (2) the setting up of correlations existing between these results, particularly between chemical analysis and mechanical test results. In addition to this statistical analysis concerning industrial results, several laboratory studies are presented, giving a more complete characterization of SA 508 class 3. All these results form a very complete documentation showing that SA 508 class 3 steel is suitable for the manufacture of large forged vessels requiring a high degree of reliability

Measurement of the suppression and azimuthal anisotropy of heavy flavor muons

CERN Document Server

Cole, Brian; The ATLAS collaboration

2017-01-01

Results are presented for measurements of single muon suppression and azimuthal anisotropy in $\\sqrt{s_{NN}} = 2.76$ TeV Pb+Pb collisions and for hadron-muon correlations in $\\sqrt{s_{NN}} = 8.16$ TeV p+Pb collisions. Also shown are some results for di-hadron correlations in the p+Pb data which are needed to measure the single-muon $v_2$. Presented results include $R_{AA}$ and $v_{2}$ as a function of centrality and $p_{T}$ in the Pb+Pb data and hadron and muon $v_2$ as a function of charged particle multiplicity and $p_{T}$ in the p+Pb data.

A retrotransposon-driven Dicer isoform directs endogenous small interfering RNA production in mouse oocytes

Czech Academy of Sciences Publication Activity Database

Flemr, Matyáš; Malík, Radek; Franke, V.; Nejepínská, Jana; Sedláček, Radislav; Vlahovicek, K.; Svoboda, Petr

2013-01-01

Roč. 155, č. 4 (2013), s. 807-816 ISSN 0092-8674 R&D Projects: GA ČR GAP305/10/2215; GA ČR(CZ) GBP305/12/G034; GA ČR GA204/09/0085; GA MŠk(CZ) LM2011032; GA MŠk ED1.1.00/02.0109 Grant - others:AV ČR(CZ) M200521202 Institutional support: RVO:68378050 Keywords : Dicer * miRNA * RNAi * mouse oocytes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 33.116, year: 2013

Mast Cell Leukaemia: c-KIT Mutations Are Not Always Positive

Directory of Open Access Journals (Sweden)

Magalie Joris

2012-01-01

Full Text Available Mast cell leukemia (MCL is a rare and aggressive disease with poor prognosis and short survival time. D816V c-KIT mutation is the most frequent molecular abnormality and plays a crucial role in the pathogenesis and development of the disease. Thus, comprehensive diagnostic investigations and molecular studies should be carefully carried out to facilitate the therapeutic choice. A MCL patient’s case with rare phenotypic and genotypic characteristics is described with review of major clinical biological and therapeutic approaches in MCL.

Effect of Laser Preheating AISI 4140 Specimens for Micro-Forging

Directory of Open Access Journals (Sweden)

Jung C.

2017-06-01

Full Text Available Many high performance and permanent service parts require suitable material characteristics-high fatigue strength is one of the most important characteristics. For this reason, surface treatment processes are essential to increase the material performance and avoid the use of costly ineffective material. There exist various surface treatment processes for various applications. Each process has advantages and disadvantages and hybridization can solve various problems. The micro-forging process delivers a controlled and uniform surface hardness, but the depth of the forged surface is limited. On the other hand, laser heat treatment can increase the hardness drastically, but the surface may become brittle, which reduces the fatigue life. Laser-assisted micro-forging is a novel hybrid process of laser heat treatment and micro-forging that has the potential to increase the forging depth and relax the stress caused by the high temperature of the forging process.

Search for collectivity with azimuthal J/ψ-hadron correlations in high multiplicity p-Pb collisions at √{sNN } = 5.02 and 8.16 TeV

Science.gov (United States)

Acharya, S.; Adamová, D.; Adolfsson, J.; Aggarwal, M. M.; Aglieri Rinella, G.; Agnello, M.; Agrawal, N.; Ahammed, Z.; Ahn, S. U.; Aiola, S.; Akindinov, A.; Al-Turany, M.; Alam, S. N.; Albuquerque, D. S. D.; Aleksandrov, D.; Alessandro, B.; Alfaro Molina, R.; Ali, Y.; Alici, A.; Alkin, A.; Alme, J.; Alt, T.; Altenkamper, L.; Altsybeev, I.; Alves Garcia Prado, C.; Andrei, C.; Andreou, D.; Andrews, H. A.; Andronic, A.; Anguelov, V.; Anson, C.; Antičić, T.; Antinori, F.; Antonioli, P.; Aphecetche, L.; Appelshäuser, H.; Arcelli, S.; Arnaldi, R.; Arnold, O. W.; Arsene, I. C.; Arslandok, M.; Audurier, B.; Augustinus, A.; Averbeck, R.; Azmi, M. D.; Badalà, A.; Baek, Y. W.; Bagnasco, S.; Bailhache, R.; Bala, R.; Baldisseri, A.; Ball, M.; Baral, R. C.; Barbano, A. M.; Barbera, R.; Barile, F.; Barioglio, L.; Barnaföldi, G. G.; Barnby, L. S.; Barret, V.; Bartalini, P.; Barth, K.; Bartsch, E.; Bastid, N.; Basu, S.; Batigne, G.; Batyunya, B.; Batzing, P. C.; Bazo Alba, J. L.; Bearden, I. G.; Beck, H.; Bedda, C.; Behera, N. K.; Belikov, I.; Bellini, F.; Bello Martinez, H.; Bellwied, R.; Beltran, L. G. E.; Belyaev, V.; Bencedi, G.; Beole, S.; Bercuci, A.; Berdnikov, Y.; Berenyi, D.; Bertens, R. A.; Berzano, D.; Betev, L.; Bhasin, A.; Bhat, I. R.; Bhattacharjee, B.; Bhom, J.; Bianchi, A.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielčík, J.; Bielčíková, J.; Bilandzic, A.; Biro, G.; Biswas, R.; Biswas, S.; Blair, J. T.; Blau, D.; Blume, C.; Boca, G.; Bock, F.; Bogdanov, A.; Boldizsár, L.; Bombara, M.; Bonomi, G.; Bonora, M.; Book, J.; Borel, H.; Borissov, A.; Borri, M.; Botta, E.; Bourjau, C.; Bratrud, L.; Braun-Munzinger, P.; Bregant, M.; Broker, T. A.; Broz, M.; Brucken, E. J.; Bruna, E.; Bruno, G. E.; Budnikov, D.; Buesching, H.; Bufalino, S.; Buhler, P.; Buncic, P.; Busch, O.; Buthelezi, Z.; Butt, J. B.; Buxton, J. T.; Cabala, J.; Caffarri, D.; Caines, H.; Caliva, A.; Calvo Villar, E.; Camerini, P.; Capon, A. A.; Carena, F.; Carena, W.; Carnesecchi, F.; Castillo Castellanos, J.; Castro, A. J.; Casula, E. A. R.; Ceballos Sanchez, C.; Chandra, S.; Chang, B.; Chang, W.; Chapeland, S.; Chartier, M.; Chattopadhyay, S.; Chattopadhyay, S.; Chauvin, A.; Cheshkov, C.; Cheynis, B.; Chibante Barroso, V.; Chinellato, D. D.; Cho, S.; Chochula, P.; Chojnacki, M.; Choudhury, S.; Chowdhury, T.; Christakoglou, P.; Christensen, C. H.; Christiansen, P.; Chujo, T.; Chung, S. U.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Colamaria, F.; Colella, D.; Collu, A.; Colocci, M.; Concas, M.; Conesa Balbastre, G.; Conesa Del Valle, Z.; Contreras, J. G.; Cormier, T. M.; Corrales Morales, Y.; Cortés Maldonado, I.; Cortese, P.; Cosentino, M. R.; Costa, F.; Costanza, S.; Crkovská, J.; Crochet, P.; Cuautle, E.; Cunqueiro, L.; Dahms, T.; Dainese, A.; Danisch, M. C.; Danu, A.; Das, D.; Das, I.; Das, S.; Dash, A.; Dash, S.; de, S.; de Caro, A.; de Cataldo, G.; de Conti, C.; de Cuveland, J.; de Falco, A.; de Gruttola, D.; De Marco, N.; de Pasquale, S.; de Souza, R. D.; Degenhardt, H. F.; Deisting, A.; Deloff, A.; Deplano, C.; Dhankher, P.; di Bari, D.; di Mauro, A.; di Nezza, P.; di Ruzza, B.; Diaz Corchero, M. A.; Dietel, T.; Dillenseger, P.; Ding, Y.; Divià, R.; Djuvsland, Ø.; Dobrin, A.; Domenicis Gimenez, D.; Dönigus, B.; Dordic, O.; Doremalen, L. V. R.; Dubey, A. K.; Dubla, A.; Ducroux, L.; Dudi, S.; Duggal, A. K.; Dukhishyam, M.; Dupieux, P.; Ehlers, R. J.; Elia, D.; Endress, E.; Engel, H.; Epple, E.; Erazmus, B.; Erhardt, F.; Espagnon, B.; Eulisse, G.; Eum, J.; Evans, D.; Evdokimov, S.; Fabbietti, L.; Faivre, J.; Fantoni, A.; Fasel, M.; Feldkamp, L.; Feliciello, A.; Feofilov, G.; Fernández Téllez, A.; Ferreiro, E. G.; Ferretti, A.; Festanti, A.; Feuillard, V. J. G.; Figiel, J.; Figueredo, M. A. S.; Filchagin, S.; Finogeev, D.; Fionda, F. M.; Floris, M.; Foertsch, S.; Foka, P.; Fokin, S.; Fragiacomo, E.; Francescon, A.; Francisco, A.; Frankenfeld, U.; Fronze, G. G.; Fuchs, U.; Furget, C.; Furs, A.; Fusco Girard, M.; Gaardhøje, J. J.; Gagliardi, M.; Gago, A. M.; Gajdosova, K.; Gallio, M.; Galvan, C. D.; Ganoti, P.; Garabatos, C.; Garcia-Solis, E.; Garg, K.; Gargiulo, C.; Gasik, P.; Gauger, E. F.; Gay Ducati, M. B.; Germain, M.; Ghosh, J.; Ghosh, P.; Ghosh, S. K.; Gianotti, P.; Giubellino, P.; Giubilato, P.; Gladysz-Dziadus, E.; Glässel, P.; Goméz Coral, D. M.; Gomez Ramirez, A.; Gonzalez, A. S.; Gonzalez, V.; González-Zamora, P.; Gorbunov, S.; Görlich, L.; Gotovac, S.; Grabski, V.; Graczykowski, L. K.; Graham, K. L.; Greiner, L.; Grelli, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Gronefeld, J. M.; Grosa, F.; Grosse-Oetringhaus, J. F.; Grosso, R.; Guber, F.; Guernane, R.; Guerzoni, B.; Gulbrandsen, K.; Gunji, T.; Gupta, A.; Gupta, R.; Guzman, I. B.; Haake, R.; Hadjidakis, C.; Hamagaki, H.; Hamar, G.; Hamon, J. C.; Haque, M. R.; Harris, J. W.; Harton, A.; Hassan, H.; Hatzifotiadou, D.; Hayashi, S.; Heckel, S. T.; Hellbär, E.; Helstrup, H.; Herghelegiu, A.; Hernandez, E. G.; Herrera Corral, G.; Herrmann, F.; Hess, B. A.; Hetland, K. F.; Hillemanns, H.; Hills, C.; Hippolyte, B.; Hohlweger, B.; Horak, D.; Hornung, S.; Hosokawa, R.; Hristov, P.; Hughes, C.; Humanic, T. J.; Hussain, N.; Hussain, T.; Hutter, D.; Hwang, D. S.; Iga Buitron, S. A.; Ilkaev, R.; Inaba, M.; Ippolitov, M.; Islam, M. S.; Ivanov, M.; Ivanov, V.; Izucheev, V.; Jacak, B.; Jacazio, N.; Jacobs, P. M.; Jadhav, M. B.; Jadlovska, S.; Jadlovsky, J.; Jaelani, S.; Jahnke, C.; Jakubowska, M. J.; Janik, M. A.; Jayarathna, P. H. S. Y.; Jena, C.; Jercic, M.; Jimenez Bustamante, R. T.; Jones, P. G.; Jusko, A.; Kalinak, P.; Kalweit, A.; Kang, J. H.; Kaplin, V.; Kar, S.; Karasu Uysal, A.; Karavichev, O.; Karavicheva, T.; Karayan, L.; Karczmarczyk, P.; Karpechev, E.; Kebschull, U.; Keidel, R.; Keijdener, D. L. D.; Keil, M.; Ketzer, B.; Khabanova, Z.; Khan, P.; Khan, S. A.; Khanzadeev, A.; Kharlov, Y.; Khatun, A.; Khuntia, A.; Kielbowicz, M. M.; Kileng, B.; Kim, B.; Kim, D.; Kim, D. J.; Kim, H.; Kim, J. S.; Kim, J.; Kim, M.; Kim, S.; Kim, T.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Kiss, G.; Klay, J. L.; Klein, C.; Klein, J.; Klein-Bösing, C.; Klewin, S.; Kluge, A.; Knichel, M. L.; Knospe, A. G.; Kobdaj, C.; Kofarago, M.; Köhler, M. K.; Kollegger, T.; Kondratiev, V.; Kondratyeva, N.; Kondratyuk, E.; Konevskikh, A.; Konyushikhin, M.; Kopcik, M.; Kour, M.; Kouzinopoulos, C.; Kovalenko, O.; Kovalenko, V.; Kowalski, M.; Koyithatta Meethaleveedu, G.; Králik, I.; Kravčáková, A.; Kreis, L.; Krivda, M.; Krizek, F.; Kryshen, E.; Krzewicki, M.; Kubera, A. M.; Kučera, V.; Kuhn, C.; Kuijer, P. G.; Kumar, A.; Kumar, J.; Kumar, L.; Kumar, S.; Kundu, S.; Kurashvili, P.; Kurepin, A.; Kurepin, A. B.; Kuryakin, A.; Kushpil, S.; Kweon, M. J.; Kwon, Y.; La Pointe, S. L.; La Rocca, P.; Lagana Fernandes, C.; Lai, Y. S.; Lakomov, I.; Langoy, R.; Lapidus, K.; Lara, C.; Lardeux, A.; Lattuca, A.; Laudi, E.; Lavicka, R.; Lea, R.; Leardini, L.; Lee, S.; Lehas, F.; Lehner, S.; Lehrbach, J.; Lemmon, R. C.; Leogrande, E.; León Monzón, I.; Lévai, P.; Li, X.; Lien, J.; Lietava, R.; Lim, B.; Lindal, S.; Lindenstruth, V.; Lindsay, S. W.; Lippmann, C.; Lisa, M. A.; Litichevskyi, V.; Llope, W. J.; Lodato, D. F.; Loenne, P. I.; Loginov, V.; Loizides, C.; Loncar, P.; Lopez, X.; López Torres, E.; Lowe, A.; Luettig, P.; Luhder, J. R.; Lunardon, M.; Luparello, G.; Lupi, M.; Lutz, T. H.; Maevskaya, A.; Mager, M.; Mahmood, S. M.; Maire, A.; Majka, R. D.; Malaev, M.; Malinina, L.; Mal'Kevich, D.; Malzacher, P.; Mamonov, A.; Manko, V.; Manso, F.; Manzari, V.; Mao, Y.; Marchisone, M.; Mareš, J.; Margagliotti, G. V.; Margotti, A.; Margutti, J.; Marín, A.; Markert, C.; Marquard, M.; Martin, N. A.; Martinengo, P.; Martinez, J. A. L.; Martínez, M. I.; Martínez García, G.; Martinez Pedreira, M.; Masciocchi, S.; Masera, M.; Masoni, A.; Masson, E.; Mastroserio, A.; Mathis, A. M.; Matuoka, P. F. T.; Matyja, A.; Mayer, C.; Mazer, J.; Mazzilli, M.; Mazzoni, M. A.; Meddi, F.; Melikyan, Y.; Menchaca-Rocha, A.; Meninno, E.; Mercado Pérez, J.; Meres, M.; Mhlanga, S.; Miake, Y.; Mieskolainen, M. M.; Mihaylov, D. L.; Mikhaylov, K.; Mischke, A.; Mishra, A. N.; Miśkowiec, D.; Mitra, J.; Mitu, C. M.; Mohammadi, N.; Mohanty, A. P.; Mohanty, B.; Mohisin Khan, M.; Montes, E.; Moreira de Godoy, D. A.; Moreno, L. A. P.; Moretto, S.; Morreale, A.; Morsch, A.; Muccifora, V.; Mudnic, E.; Mühlheim, D.; Muhuri, S.; Mulligan, J. D.; Munhoz, M. G.; Münning, K.; Munzer, R. H.; Murakami, H.; Murray, S.; Musa, L.; Musinsky, J.; Myers, C. J.; Myrcha, J. W.; Nag, D.; Naik, B.; Nair, R.; Nandi, B. K.; Nania, R.; Nappi, E.; Narayan, A.; Naru, M. U.; Natal da Luz, H.; Nattrass, C.; Navarro, S. R.; Nayak, K.; Nayak, R.; Nayak, T. K.; Nazarenko, S.; Negrao de Oliveira, R. A.; Nellen, L.; Nesbo, S. V.; Ng, F.; Nicassio, M.; Niculescu, M.; Niedziela, J.; Nielsen, B. S.; Nikolaev, S.; Nikulin, S.; Nikulin, V.; Noferini, F.; Nomokonov, P.; Nooren, G.; Noris, J. C. C.; Norman, J.; Nyanin, A.; Nystrand, J.; Oeschler, H.; Oh, H.; Ohlson, A.; Okubo, T.; Olah, L.; Oleniacz, J.; Oliveira da Silva, A. C.; Oliver, M. H.; Onderwaater, J.; Oppedisano, C.; Orava, R.; Oravec, M.; Ortiz Velasquez, A.; Oskarsson, A.; Otwinowski, J.; Oyama, K.; Pachmayer, Y.; Pacik, V.; Pagano, D.; Paić, G.; Palni, P.; Pan, J.; Pandey, A. K.; Panebianco, S.; Papikyan, V.; Pareek, P.; Park, J.; Parmar, S.; Passfeld, A.; Pathak, S. P.; Patra, R. N.; Paul, B.; Pei, H.; Peitzmann, T.; Peng, X.; Pereira, L. G.; Pereira da Costa, H.; Peresunko, D.; Perez Lezama, E.; Peskov, V.; Pestov, Y.; Petráček, V.; Petrov, V.; Petrovici, M.; Petta, C.; Pezzi, R. P.; Piano, S.; Pikna, M.; Pillot, P.; Pimentel, L. O. D. L.; Pinazza, O.; Pinsky, L.; Piyarathna, D. B.; Płoskoń, M.; Planinic, M.; Pliquett, F.; Pluta, J.; Pochybova, S.; Podesta-Lerma, P. L. M.; Poghosyan, M. G.; Polichtchouk, B.; Poljak, N.; Poonsawat, W.; Pop, A.; Poppenborg, H.; Porteboeuf-Houssais, S.; Pozdniakov, V.; Prasad, S. K.; Preghenella, R.; Prino, F.; Pruneau, C. A.; Pshenichnov, I.; Puccio, M.; Punin, V.; Putschke, J.; Raha, S.; Rajput, S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Rami, F.; Rana, D. B.; Raniwala, R.; Raniwala, S.; Räsänen, S. S.; Rascanu, B. T.; Rathee, D.; Ratza, V.; Ravasenga, I.; Read, K. F.; Redlich, K.; Rehman, A.; Reichelt, P.; Reidt, F.; Ren, X.; Renfordt, R.; Reshetin, A.; Reygers, K.; Riabov, V.; Richert, T.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Ristea, C.; Rodríguez Cahuantzi, M.; Røed, K.; Rogochaya, E.; Rohr, D.; Röhrich, D.; Rokita, P. S.; Ronchetti, F.; Rosas, E. D.; Rosnet, P.; Rossi, A.; Rotondi, A.; Roukoutakis, F.; Roy, C.; Roy, P.; Rubio Montero, A. J.; Rueda, O. V.; Rui, R.; Rumyantsev, B.; Rustamov, A.; Ryabinkin, E.; Ryabov, Y.; Rybicki, A.; Saarinen, S.; Sadhu, S.; Sadovsky, S.; Šafařík, K.; Saha, S. K.; Sahlmuller, B.; Sahoo, B.; Sahoo, P.; Sahoo, R.; Sahoo, S.; Sahu, P. K.; Saini, J.; Sakai, S.; Saleh, M. A.; Salzwedel, J.; Sambyal, S.; Samsonov, V.; Sandoval, A.; Sarkar, A.; Sarkar, D.; Sarkar, N.; Sarma, P.; Sas, M. H. P.; Scapparone, E.; Scarlassara, F.; Schaefer, B.; Scheid, H. S.; Schiaua, C.; Schicker, R.; Schmidt, C.; Schmidt, H. R.; Schmidt, M. O.; Schmidt, M.; Schmidt, N. V.; Schukraft, J.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Šefčík, M.; Seger, J. E.; Sekiguchi, Y.; Sekihata, D.; Selyuzhenkov, I.; Senosi, K.; Senyukov, S.; Serradilla, E.; Sett, P.; Sevcenco, A.; Shabanov, A.; Shabetai, A.; Shahoyan, R.; Shaikh, W.; Shangaraev, A.; Sharma, A.; Sharma, A.; Sharma, M.; Sharma, M.; Sharma, N.; Sheikh, A. I.; Shigaki, K.; Shirinkin, S.; Shou, Q.; Shtejer, K.; Sibiriak, Y.; Siddhanta, S.; Sielewicz, K. M.; Siemiarczuk, T.; Silaeva, S.; Silvermyr, D.; Simatovic, G.; Simonetti, G.; Singaraju, R.; Singh, R.; Singhal, V.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T. B.; Slupecki, M.; Smirnov, N.; Snellings, R. J. M.; Snellman, T. W.; Song, J.; Song, M.; Soramel, F.; Sorensen, S.; Sozzi, F.; Sputowska, I.; Stachel, J.; Stan, I.; Stankus, P.; Stenlund, E.; Stocco, D.; Storetvedt, M. M.; Strmen, P.; Suaide, A. A. P.; Sugitate, T.; Suire, C.; Suleymanov, M.; Suljic, M.; Sultanov, R.; Šumbera, M.; Sumowidagdo, S.; Suzuki, K.; Swain, S.; Szabo, A.; Szarka, I.; Tabassam, U.; Takahashi, J.; Tambave, G. J.; Tanaka, N.; Tarhini, M.; Tariq, M.; Tarzila, M. G.; Tauro, A.; Tejeda Muñoz, G.; Telesca, A.; Terasaki, K.; Terrevoli, C.; Teyssier, B.; Thakur, D.; Thakur, S.; Thomas, D.; Thoresen, F.; Tieulent, R.; Tikhonov, A.; Timmins, A. R.; Toia, A.; Toppi, M.; Torres, S. R.; Tripathy, S.; Trogolo, S.; Trombetta, G.; Tropp, L.; Trubnikov, V.; Trzaska, W. H.; Trzeciak, B. A.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Tveter, T. S.; Ullaland, K.; Umaka, E. N.; Uras, A.; Usai, G. L.; Utrobicic, A.; Vala, M.; van der Maarel, J.; van Hoorne, J. W.; van Leeuwen, M.; Vanat, T.; Vande Vyvre, P.; Varga, D.; Vargas, A.; Vargyas, M.; Varma, R.; Vasileiou, M.; Vasiliev, A.; Vauthier, A.; Vázquez Doce, O.; Vechernin, V.; Veen, A. M.; Velure, A.; Vercellin, E.; Vergara Limón, S.; Vernet, R.; Vértesi, R.; Vickovic, L.; Vigolo, S.; Viinikainen, J.; Vilakazi, Z.; Villalobos Baillie, O.; Villatoro Tello, A.; Vinogradov, A.; Vinogradov, L.; Virgili, T.; Vislavicius, V.; Vodopyanov, A.; Völkl, M. A.; Voloshin, K.; Voloshin, S. A.; Volpe, G.; von Haller, B.; Vorobyev, I.; Voscek, D.; Vranic, D.; Vrláková, J.; Wagner, B.; Wang, H.; Wang, M.; Watanabe, D.; Watanabe, Y.; Weber, M.; Weber, S. G.; Weiser, D. F.; Wenzel, S. C.; Wessels, J. P.; Westerhoff, U.; Whitehead, A. M.; Wiechula, J.; Wikne, J.; Wilk, G.; Wilkinson, J.; Willems, G. A.; Williams, M. C. S.; Willsher, E.; Windelband, B.; Witt, W. E.; Xu, R.; Yalcin, S.; Yamakawa, K.; Yang, P.; Yano, S.; Yin, Z.; Yokoyama, H.; Yoo, I.-K.; Yoon, J. H.; Yun, E.; Yurchenko, V.; Zaccolo, V.; Zaman, A.; Zampolli, C.; Zanoli, H. J. C.; Zardoshti, N.; Zarochentsev, A.; Závada, P.; Zaviyalov, N.; Zbroszczyk, H.; Zhalov, M.; Zhang, H.; Zhang, X.; Zhang, Y.; Zhang, C.; Zhang, Z.; Zhao, C.; Zhigareva, N.; Zhou, D.; Zhou, Y.; Zhou, Z.; Zhu, H.; Zhu, J.; Zhu, Y.; Zichichi, A.; Zimmermann, M. B.; Zinovjev, G.; Zmeskal, J.; Zou, S.; Alice Collaboration

2018-05-01

We present a measurement of azimuthal correlations between inclusive J/ψ and charged hadrons in p-Pb collisions recorded with the ALICE detector at the CERN LHC. The J/ψ are reconstructed at forward (p-going, 2.03 < y < 3.53) and backward (Pb-going, - 4.46 < y < - 2.96) rapidity via their μ+μ- decay channel, while the charged hadrons are reconstructed at mid-rapidity (| η | < 1.8). The correlations are expressed in terms of associated charged-hadron yields per J/ψ trigger. A rapidity gap of at least 1.5 units is required between the trigger J/ψ and the associated charged hadrons. Possible correlations due to collective effects are assessed by subtracting the associated per-trigger yields in the low-multiplicity collisions from those in the high-multiplicity collisions. After the subtraction, we observe a strong indication of remaining symmetric structures at Δφ ≈ 0 and Δφ ≈ π, similar to those previously found in two-particle correlations at middle and forward rapidity. The corresponding second-order Fourier coefficient (v2) in the transverse momentum interval between 3 and 6 GeV/c is found to be positive with a significance of about 5σ. The obtained results are similar to the J/ψv2 coefficients measured in Pb-Pb collisions at √{sNN } = 5.02 TeV, suggesting a common mechanism at the origin of the J/ψv2.

The evolution of microtexture and macrotexture during subtransus forging of Ti-10V-2Fe-3Al

International Nuclear Information System (INIS)

Raghunathan, S.L.; Dashwood, R.J.; Jackson, M.; Vogel, S.C.; Dye, D.

2008-01-01

The macrotextures and microtextures produced during α+β forging of Ti-10V-2Fe-3Al were characterised using neutron, in situ synchrotron X-ray and ex situ electron backscatter diffraction (EBSD). The EBSD analysis showed that the measured misorientation distributions at a strain of 0.8 and strain rates of 0.1 and 0.01s -1 were similar, with an average misorientation of 2.2 deg. During forging, the moderate cube macrotexture inherited from the parent material was converted into a moderate fibre texture, with the major change occurring between strains of 0.4 and 0.6. The synchrotron diffraction studies allowed the orientation evolution of individual grains to be characterised. At the highest strain rate of 0.1s -1 , this indicated a change in behaviour from dispersion of the crystal mosaic (peak angular spread) at low strains, to convergence of the crystal mosaic at larger strains. At lower strain rates, only convergence of the crystal mosaic was observed. It is suggested that these results indicate a change in mechanism between deformation-controlled behaviour during the early stages of deformation and a strain rate of 0.1s -1 and diffusional, recovery-controlled behaviour at lower strain rates and higher strains

Impulse control disorders and related behaviours (ICD-RBs in Parkinson′s disease patients: Assessment using “Questionnaire for impulsive-compulsive disorders in Parkinson′s disease” (QUIP

Directory of Open Access Journals (Sweden)

Ashish Sharma

2015-01-01

Full Text Available Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs in Indian patients with Parkinson′s Disease (PD. In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Compulsive Disorders in Parkinson′s disease (QUIP” and to examine their association with Dopamine replacement therapy (DRT. Materials and Methods: This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Results: Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%, at least one Impulse control disorder (ICD was present in 74 (24.75% and at least one Impulse control related compulsive behaviour (ICRB was present in 93 (31.1% patients. Punding was the most frequent (12.4% followed by hyper sexuality (11.04%, compulsive hobbyism (9.4%, compulsive shopping (8.4%, compulsive medication use (7.7%, compulsive eating (5.35%, walkabout (4% and pathological gambling (3.3%. ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Conclusions: Our study revealed a relatively higher

48 CFR 252.225-7025 - Restriction on acquisition of forgings.

Science.gov (United States)

2010-10-01

... of forgings. 252.225-7025 Section 252.225-7025 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.225-7025 Restriction on acquisition of forgings. As prescribed in 225.7102-4, use the following clause: Restriction on Acquisition of Forgings (DEC 2009) (a...

Generation of a U.S. national urban land use product

Science.gov (United States)

Falcone, James A.; Homer, Collin G.

2012-01-01

Characterization of urban land uses is essential for many applications. However, differentiating among thematically-detailed urban land uses (residential, commercial, industrial, institutional, recreational, etc.) over broad areas is challenging, in part because image-based solutions are not ideal for establishing the contextual basis for identifying economic function and use. At present no current United States national-scale mapping exists for urban land uses similar to the classical Anderson Level II classification. This paper describes a product that maps urban land uses, and is linked to and corresponds with the National Land Cover Database (NLCD) 2006. In this product, NLCD urban pixels, in addition to their current imperviousness intensity classification, are assigned one of nine urban use classes based on information drawn from multiple data sources. These sources include detailed infrastructure information, population characteristics, and historical land use. The result is a method for creating a 30 m national-scale grid providing thematically-detailed urban land use information which complements the NLCD. Initial results for 10 major metropolitan areas are provided as an on-line link. Accuracy assessment of initial products yielded an overall accuracy of 81.6 percent.

Analysis of reforming process of large distorted ring in final enlarging forging

International Nuclear Information System (INIS)

Miyazawa, Takeshi; Murai, Etsuo

2002-01-01

In the construction of reactors or pressure vessels for oil chemical plants and nuclear power stations, mono block open-die forging rings are often utilized. Generally, a large forged ring is manufactured by means of enlarging forging with reductions of the wall thickness. During the enlarging process the circular ring is often distorted and becomes an ellipse in shape. However the shape control of the ring is a complicated work. This phenomenon makes the matter still worse in forging of larger rings. In order to make precision forging of large rings, we have developed the forging method using a v-shape anvil. The v-shape anvil is geometrically adjusted to fit the distorted ring in the final circle and reform automatically the shape of the ring during enlarging forging. This paper has analyzed the reforming process of distorted ring by computer program based on F.E.M. and examined the effect on the precision of ring forging. (author)

Dicty_cDB: AFH816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ingle read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration Library Tortula ruralis cDNA, m...4 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA, mRNA sequence. 70 5e-08 1 CK0301

MET overexpression, gene amplification and relevant clinicopathological features in gastric adenocarcinoma.

Science.gov (United States)

Zhang, Jing; Guo, Lei; Liu, Xiuyun; Li, Wenbin; Ying, Jianming

2017-02-07

This study was conducted to investigate the expression of MET in Chinese gastric adenocarcinoma cohort, the correlation between MET overexpression and clinical pathological features, HER2 expression and MET gene amplification. A total of 816 gastric adenocarcinoma patients were included and MET and HER2 immunohistochemical (IHC) staining were performed. IHC and dual-color silver in situ hybridization analysis were performed in the tissue microarrays, constructed from the 240 patients who were randomly selected. MET overexpression (IHC 3+) was observed in 6.0% (49/816) of the cohort. MET overexpression rate was higher in patients with poor prognostic factors, such as clinical stages III/IV (p =0.012) and pathologic stages T3/T4 (p =0.027). The HER2 overexpression (IHC 3+) rate was 8.8% (72/816) and MET overexpression rate was higher in HER2 positive patients (9.7%, 7/72). A high concordance rate (94.6%) between MET overexpression and gene amplification was demonstrated. Therefore, MET overexpression could serve as a prognostic biomarker and a potential therapeutic target for gastric cancer.

Electro sinter forging of titanium disks

DEFF Research Database (Denmark)

Cannella, Emanuele; Nielsen, Chris Valentin; Bay, Niels Oluf

by measuring the electrical resistance during the sintering process [5], since low electrical resistance corresponds to high density. It is, however, necessary to be aware that increased temperature, on the other hand, increases the resistance. SEM micrographs and Computed Tomography (CT) are carried out......Electro sinter forging (ESF) is a new sintering process based on the principle of electrical Joule heating. In the present work, middle frequency direct current (MFDC) was flowing through the powder compact, which was under mechanical pressure. The main parameters are the high electrical current......, up to 10 kA, and the low voltage, 1-2 V, resulting in heat generation in the powder. Figure 1 shows the experimental setup. The punches were made of a conductive material; namely a copper alloy. The die, which has to be electrically insulating, was made of alumina. The ESF process takes 3-4s...

Geologic setting of the proposed Fallon FORGE Site, Nevada: Suitability for EGS research and development

Science.gov (United States)

Faulds, James E.; Blankenship, Douglas; Hinz, Nicholas H.; Sabin, Andrew; Nordquist, Josh; Hickman, Stephen H.; Glen, Jonathan; Kennedy, Mack; Siler, Drew; Robinson-Tait, Ann; Williams, Colin F.; Drakos, Peter; Calvin, Wendy M.

2015-01-01

The proposed Fallon FORGE site lies within and adjacent to the Naval Air Station Fallon (NASF) directly southeast of the town of Fallon, Nevada, within the large basin of the Carson Sink in west-central Nevada. The site is located on two parcels that include land owned by the NASF and leased and owned by Ormat Nevada, Inc. The Carson Sink in the vicinity of the Fallon site is covered by Quaternary deposits, including alluvial fan, eolian, and lacustrine sediments. Four wells penetrate the entire Neogene section and bottom in Mesozoic basement. Late Miocene to Quaternary basin-fill sediments are 0.5 to >1 km thick and overlie Oligocene-Miocene volcanic and lesser sedimentary rocks. The volcanic section is 0.5 to 1.0 km thick and dominated by Miocene mafic lavas. The Neogene section rests nonconformably on heterogeneous Mesozoic basement, which consists of Triassic-Jurassic metamorphic rocks intruded by Cretaceous granitic plutons. The structural framework is dominated by a gently west-tilted half graben cut by moderately to steeply dipping N- to NNEstriking normal faults that dip both east and west. Quaternary faults have not been observed within the proposed FORGE site. Fallon was selected for a potential FORGE site due to its extensional tectonic setting, abundance of available data, existing infrastructure, and documented temperatures, permeability, and lithologic composition of potential reservoirs that fall within the ranges specified by DOE for FORGE. Since the early 1970s, more than 45 wells have been drilled for geothermal exploration within the area. Four exploration wells within the FORGE site are available for use in the project. Several additional wells are available for monitoring outside the central FORGE site within the NASF and Ormat lease area, including numerous temperature gradient holes. There is an existing, ten-station micro-seismic earthquake (MEQ) array that has been collecting data since 2001; the MEQ array can be expanded to encompass the

ON WOMEN’S CULTURAL PATRIMONY IN THE ARGENTINE REPUBLIC: THEORETICAL PERSPECTIVES AND METHODOLOGICAL APPROACHES

Directory of Open Access Journals (Sweden)

Cecilia Lagunas

2014-08-01

Full Text Available This paper analyses the process of development of gender and women’s studies in public universities in Argentina, from their inception in the 1970s to their expansion throughout the 1980s and beginning of the 1990s. This accounts for more than 20 years of research and other contributions from the perspective of feminist theory to forge a more equal and just society, in which men and women rethink their roles within their private lives and in the exercise of their professional lives. This includes thinking about new identities – gender diversity – according to their felt and practiced sexuality, so as to include difference in the universe of heterosexual human practices.

Avaliação de bactérias extremófilas facultativas na produção de fitomassa do híbrido "urograndis" de eucalipto, a partir de sementes

OpenAIRE

Marques,Eder; Uesugi,Carlos Hidemi

2013-01-01

Atualmente, a árvore mais plantada no Brasil é o Eucalyptus spp., ocupando 81,6% das florestas plantadas. Sua produtividade em 2009 foi de 44,2 m³ de eucalipto com casca/ha, gerando aproximadamente 46.850 empregos diretos. Estudos de bactérias benéficas, como as Rizobactérias Promotoras de Crescimento de Plantas (RPCPs), vêm sendo desenvolvidos há mais de um século. Este trabalho objetivou avaliar estirpes de bactérias extremófilas facultativas que possuam potencial na promoção de crescimento...

Avaliação de bactérias extremófilas facultativas na produção de fitomassa do híbrido "urograndis" de eucalipto, a partir de sementes Evaluation of facultative extremophile bacteria in the phytomass production of the hybrid "urograndis" of eucalyptus from seeds

OpenAIRE

Eder Marques; Carlos Hidemi Uesugi

2013-01-01

Atualmente, a árvore mais plantada no Brasil é o Eucalyptus spp., ocupando 81,6% das florestas plantadas. Sua produtividade em 2009 foi de 44,2 m3 de eucalipto com casca/ha, gerando aproximadamente 46.850 empregos diretos. Estudos de bactérias benéficas, como as Rizobactérias Promotoras de Crescimento de Plantas (RPCPs), vêm sendo desenvolvidos há mais de um século. Este trabalho objetivou avaliar estirpes de bactérias extremófilas facultativas que possuam potencial na promoção de crescimento...

W17_geowave “3D full waveform geophysical models”

Energy Technology Data Exchange (ETDEWEB)

Larmat, Carene [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maceira, Monica [Univ. of Tennessee, Knoxville, TN (United States); Roy, Corinna [Univ. of California, Berkeley, CA (United States)

2018-02-12

Performance of the MCMC inversion according to the number of cores for the computation. A) 64 cores. B) 480 cores. C) 816 cores. The true model is represented by the black line. Vsv is the wave speed of S waves polarized in the vertical plane, ξ is an anisotropy parameter. The Earth is highly anisotropics; the wavespeed of seismic waves depends on the polarization of the wave. Seismic inversion of the elastic structure is usually limited to isotropic information such as Vsv. Our research looked at the inversion of Earth anisotropy.

Medium carbon vanadium steels for closed die forging

International Nuclear Information System (INIS)

Jeszensky, Gabor; Plaut, Ronald Lesley

1993-01-01

This work analyses the medium carbon micro alloyed vanadium potential for closed die forged production. The steels reach the mechanical resistance requests during cooling after forging, eliminating the subsequent thermal treatment. Those steels also present good fatigue resistance and machinability. The industrial scale experiments are also reported

The FORGE (Fate Of Repository Gases) pan European project

International Nuclear Information System (INIS)

Shaw, Richard

2010-01-01

-scaling allowing the optimisation of concepts through detailed scenario analysis. The FORGE partners are committed to training and CPD through a broad portfolio of training opportunities and initiatives which form a significant part of the project. The FORGE project is divided into five work packages. - WP 1 Treatment of gas in performance assessment; - WP 2 Gas generation; - WP 3 Engineered barrier systems; - WP 4 Disturbed host rock formations; - WP 5 Undisturbed host rock formations. There are modelling activities in all of these work packages and a Modelling Co-ordinator specifically to overview all aspects of this work thus ensuring appropriate focus, facilitating the cross-flow of ideas and concepts between WP's is an integral part of the project. This will also ensure best practice is shared between all participants and teams. Further details on the FORGE project and its outcomes can be accessed at www.FORGEproject.org. (author)

Gear hot forging process robust design based on finite element method

International Nuclear Information System (INIS)

Xuewen, Chen; Won, Jung Dong

2008-01-01

During the hot forging process, the shaping property and forging quality will fluctuate because of die wear, manufacturing tolerance, dimensional variation caused by temperature and the different friction conditions, etc. In order to control this variation in performance and to optimize the process parameters, a robust design method is proposed in this paper, based on the finite element method for the hot forging process. During the robust design process, the Taguchi method is the basic robust theory. The finite element analysis is incorporated in order to simulate the hot forging process. In addition, in order to calculate the objective function value, an orthogonal design method is selected to arrange experiments and collect sample points. The ANOVA method is employed to analyze the relationships of the design parameters and design objectives and to find the best parameters. Finally, a case study for the gear hot forging process is conducted. With the objective to reduce the forging force and its variation, the robust design mathematical model is established. The optimal design parameters obtained from this study indicate that the forging force has been reduced and its variation has been controlled

Optimum design of forging process parameters and preform shape under uncertainties

International Nuclear Information System (INIS)

Repalle, Jalaja; Grandhi, Ramana V.

2004-01-01

Forging is a highly complex non-linear process that is vulnerable to various uncertainties, such as variations in billet geometry, die temperature, material properties, workpiece and forging equipment positional errors and process parameters. A combination of these uncertainties could induce heavy manufacturing losses through premature die failure, final part geometric distortion and production risk. Identifying the sources of uncertainties, quantifying and controlling them will reduce risk in the manufacturing environment, which will minimize the overall cost of production. In this paper, various uncertainties that affect forging tool life and preform design are identified, and their cumulative effect on the forging process is evaluated. Since the forging process simulation is computationally intensive, the response surface approach is used to reduce time by establishing a relationship between the system performance and the critical process design parameters. Variability in system performance due to randomness in the parameters is computed by applying Monte Carlo Simulations (MCS) on generated Response Surface Models (RSM). Finally, a Robust Methodology is developed to optimize forging process parameters and preform shape. The developed method is demonstrated by applying it to an axisymmetric H-cross section disk forging to improve the product quality and robustness

First Results of Energy Saving at Process Redesign of Die Forging Al-Alloys

International Nuclear Information System (INIS)

Pepelnjak, Tomaz; Kuzman, Karl; Kokol, Anton

2011-01-01

The contribution deals with eco-friendly solutions for shortened production chains of forging light alloys. During the die forging operations a remarkable amount of material goes into the flash and later on into chips during finish machining. These low value side products are rich with embedded energy therefore recycling or reprocessing could be very energy saving procedure.In cooperation with a die forging company a shortened reprocessing cycle has been studied starting from re-melting the forging flash and without additional heating to cast preforms for subsequent die forging. As such preforms have not as good formability characteristics as those done from extruded billets the isothermal forging process has been adopted. First results showed that without cracks and other defects the formability is sufficient for a broad spectrum of forgings.To improve the formability a homogenization process of cast preforms has been implemented. As the process started immediately after casting, amount of additional energy for heating was minimized. To reduce voids forging process was redesigned in a way to assure greater hydrostatic pressures in parts during forging. First results were promising therefore research is going towards improving processes without adding significantly more energy as it is needed for casting with homogenization and die forging.

Ultra-large size austenitic stainless steel forgings for fast breeder reactor 'Monju'

International Nuclear Information System (INIS)

Tsukada, Hisashi; Suzuki, Komei; Sato, Ikuo; Miura, Ritsu.

1988-01-01

The large SUS 304 austenitic stainless steel forgings for the reactor vessel of the prototype FBR 'Monju' of 280 MWe output were successfully manufactured. The reactor vessel contains the heart of the reactor and sodium coolant at 530 deg C, and its inside diameter is about 7 m, and height is about 18 m. It is composed of 12 large forgings, that is, very thick flanges and shalls made by ring forging and an end plate made by disk forging and hot forming, using a special press machine. The manufacture of these large forgings utilized the results of the basic test on the material properties in high temperature environment and the effect that the manufacturing factors exert on the material properties and the results of the development of manufacturing techniques for superlarge forgings. The problems were the manufacturing techniques for the large ingots of 250 t class of high purity, the hot working techniques for stainless steel of fine grain size, the forging techniques for superlarge rings and disks, and the machining techniques of high precision for particularly large diameter, thin wall rings. The manufacture of these large stainless steel forgings is reported. (Kako, I.)

Mechanical properties of Zr-2.5Nb pressure tube material manufactured employing forging routes for PHWR700 - Part 1: tensile behavior

International Nuclear Information System (INIS)

Bind, A.K.; Singh, R.N.; Sunil, Saurav; Chakravartty, J.K.; Ghosh, Agnish; Dhandharia, Priyesh; More, Nitin S.; Vijayakumar, S.; Chhatre, A.G.

2012-01-01

Tensile properties of Zr-2.5Nb alloy tubes produced employing forging to break the cast structure were evaluated by carrying out uni-axial tension test at temperatures between 25 and 325 degC and under strain-rate of 1.075 x 10 -4 /s for both longitudinal and transverse specimens. Both strength and elongation values were comparable for the samples obtained from front and back end of the tube. Transverse samples showed higher strength and lower uniform elongation values as compared to longitudinal samples. The yield strength of double forged material at 25 degC is higher than the PHWR700 specification of a maximum value of 586 MPa. (author)

77 FR 14445 - Application for a License To Export Steel Forging

Science.gov (United States)

2012-03-09

... NUCLEAR REGULATORY COMMISSION Application for a License To Export Steel Forging Pursuant to 10 CFR 110.70(b) ``Public Notice of Receipt of an Application,'' please take notice that the Nuclear... head steel February 7, 2012 forging. forging will be XR175 machined into the 11005983 finished vessel...

Mannes of Forging and Perspectives of Knuckle Joint Presses Modernization

Directory of Open Access Journals (Sweden)

A. A. Antsifirov

2014-01-01

Full Text Available The article raises an issue to enhance technological forging capabilities on the known knuckle joint presses. It provides an illustrated overview of main design types of presses with crank-knuckle, toggle-knuckle, and knuckle joint mechanisms. The article also shows the advantages of the modernization way and improvement just of the active press equipment in terms of quality-to-price ratio, for example, as compared to the similar new foreign press equipment.It gives an overview of features, which provide forging processes owing to kinetic energy accumulated with the moving parts of the known designs of the knuckle joint presses depending on the drive actuating mechanism. Focused attention is drawn to forging on the knuckle joint presses for a time of contact with a work piece to be comparable with the duration of the work piece deformation process on hydraulic forging hammers. This allows us to forge thin-wall products with process automation compared to the forging hammers.Analysis of accumulating processes of kinetic energy by the moving parts of the knuckle joint presses has shown that presses driven by hydraulic cylinders or two screw hydraulic cylinder are the most optimal for technological operations as evidenced by references to domestic and foreign invention certificates and patents. The article presents disadvantages of forging on presses with hydraulic or pneumatic drive. It is a dependence of the deformation force, caused, mainly, by a force of the drive cylinder. The article gives linear movement rate quantities of press moving members depending on the drives of the actuating mechanism. Based on the above analysis of the features to manufacture work pieces on the knuckle joint presses, the article gives the rationale for the relevance of forging in a short period of time, provided that the moving parts of the press accumulate the required kinetic energy. This can be achieved only through modernization and improvement of forging

Optical Forging of Graphene into Three-Dimensional Shapes.

Science.gov (United States)

Johansson, Andreas; Myllyperkiö, Pasi; Koskinen, Pekka; Aumanen, Jukka; Koivistoinen, Juha; Tsai, Hung-Chieh; Chen, Chia-Hao; Chang, Lo-Yueh; Hiltunen, Vesa-Matti; Manninen, Jyrki J; Woon, Wei Yen; Pettersson, Mika

2017-10-11

Atomically thin materials, such as graphene, are the ultimate building blocks for nanoscale devices. But although their synthesis and handling today are routine, all efforts thus far have been restricted to flat natural geometries, since the means to control their three-dimensional (3D) morphology has remained elusive. Here we show that, just as a blacksmith uses a hammer to forge a metal sheet into 3D shapes, a pulsed laser beam can forge a graphene sheet into controlled 3D shapes in the nanoscale. The forging mechanism is based on laser-induced local expansion of graphene, as confirmed by computer simulations using thin sheet elasticity theory.

Identifying multiple influential spreaders in term of the distance-based coloring

Energy Technology Data Exchange (ETDEWEB)

Guo, Lei; Lin, Jian-Hong; Guo, Qiang [Research Center of Complex Systems Science, University of Shanghai for Science and Technology, Shanghai 200093 (China); Liu, Jian-Guo, E-mail: liujg004@ustc.edu.cn [Research Center of Complex Systems Science, University of Shanghai for Science and Technology, Shanghai 200093 (China); Data Science and Cloud Service Research Centre, Shanghai University of Finance and Economics, Shanghai 200433 (China)

2016-02-22

Identifying influential nodes is of significance for understanding the dynamics of information diffusion process in complex networks. In this paper, we present an improved distance-based coloring method to identify the multiple influential spreaders. In our method, each node is colored by a kind of color with the rule that the distance between initial nodes is close to the average distance of a network. When all nodes are colored, nodes with the same color are sorted into an independent set. Then we choose the nodes at the top positions of the ranking list according to their centralities. The experimental results for an artificial network and three empirical networks show that, comparing with the performance of traditional coloring method, the improvement ratio of our distance-based coloring method could reach 12.82%, 8.16%, 4.45%, 2.93% for the ER, Erdős, Polblogs and Routers networks respectively. - Highlights: • We present an improved distance-based coloring method to identify the multiple influential spreaders. • Each node is colored by a kind of color where the distance between initial nodes is close to the average distance. • For three empirical networks show that the improvement ratio of our distance-based coloring method could reach 8.16% for the Erdos network.

Identifying multiple influential spreaders in term of the distance-based coloring

International Nuclear Information System (INIS)

Guo, Lei; Lin, Jian-Hong; Guo, Qiang; Liu, Jian-Guo

2016-01-01

Identifying influential nodes is of significance for understanding the dynamics of information diffusion process in complex networks. In this paper, we present an improved distance-based coloring method to identify the multiple influential spreaders. In our method, each node is colored by a kind of color with the rule that the distance between initial nodes is close to the average distance of a network. When all nodes are colored, nodes with the same color are sorted into an independent set. Then we choose the nodes at the top positions of the ranking list according to their centralities. The experimental results for an artificial network and three empirical networks show that, comparing with the performance of traditional coloring method, the improvement ratio of our distance-based coloring method could reach 12.82%, 8.16%, 4.45%, 2.93% for the ER, Erdős, Polblogs and Routers networks respectively. - Highlights: • We present an improved distance-based coloring method to identify the multiple influential spreaders. • Each node is colored by a kind of color where the distance between initial nodes is close to the average distance. • For three empirical networks show that the improvement ratio of our distance-based coloring method could reach 8.16% for the Erdos network.

Decomposition of [14C]lignocelluloses of Spartina alterniflora and a comparison with field experiments

International Nuclear Information System (INIS)

Wilson, J.O.

1985-01-01

Decomposition of lignocelluloses from Spartina alterniflora in salt-marsh sediments was measured by using 14 C-labeled compounds. Rates of decomposition were fastest in the first 4 days of incubation and declined later. Lignins labeled in side chains were mineralized slightly faster than uniformly labeled lignins; 12% of the [side chain- 14 C]lignin-labeled lignocellulose was mineralized after 816 h of incubation, whereas only 8% of the [U- 14 C]lignin-labeled lignocelluloses were degraded during this period. The carbohydrate moiety within the lignocellulose complex was degraded about four times faster than the lignin moiety; after 816 h of incubation, 29 to 37% of the carbohydrate moiety had been mineralized. Changes in concentration of lignin and cellulose in litter of S. alterniflora were followed over 2 years of decay. Cellulose disappeared from litter more rapidly than lignin; 50% of the initial content of cellulose was lost after 130 days, whereas lignin required 330 to 380 days for 50% loss. The slow loss of lignin compared with other litter components resulted in a progressive enrichment of litter in lignin content. The rates of mineralization of [ 14 C]lignocelluloses in marsh sediments were similar to the rates of lignocellulose decomposition in litter on the marsh

Development of high purity large forgings for nuclear power plants

International Nuclear Information System (INIS)

Tanaka, Yasuhiko; Sato, Ikuo

2011-01-01

The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.

Development of high purity large forgings for nuclear power plants

Science.gov (United States)

Tanaka, Yasuhiko; Sato, Ikuo

2011-10-01

The recent increase in the size of energy plants has been supported by the development of manufacturing technology for high purity large forgings for the key components of the plant. To assure the reliability and performance of the large forgings, refining technology to make high purity steels, casting technology for gigantic ingots, forging technology to homogenize the material and consolidate porosity are essential, together with the required heat treatment and machining technologies. To meet these needs, the double degassing method to reduce impurities, multi-pouring methods to cast the gigantic ingots, vacuum carbon deoxidization, the warm forging process and related technologies have been developed and further improved. Furthermore, melting facilities including vacuum induction melting and electro slag re-melting furnaces have been installed. By using these technologies and equipment, large forgings have been manufactured and shipped to customers. These technologies have also been applied to the manufacture of austenitic steel vessel components of the fast breeder reactors and components for fusion experiments.

Development of Oxide Dispersion Strengthened (ODS) Ferritic Steel Through Powder Forging

Science.gov (United States)

Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

2017-04-01

Oxide dispersion strengthened (ODS) ferritic steels are candidates for cladding tubes in fast breeder nuclear reactors. In this study, an 18%Cr ODS ferritic steel was prepared through powder forging route. Elemental powders with a nominal composition of Fe-18Cr-2 W-0.2Ti (composition in wt.%) with 0 and 0.35% yttria were prepared by mechanical alloying in a Simoloyer attritor under argon atmosphere. The alloyed powders were heated in a mild steel can to 1473 K under flowing hydrogen atmosphere. The can was then hot forged. Steps of sealing, degassing and evacuation are eliminated by using powder forging. Heating ODS powder in hydrogen atmosphere ensures good bonding between alloy powders. A dense ODS alloy with an attractive combination of strength and ductility was obtained after re-forging. On testing at 973 K, a loss in ductility was observed in yttria-containing alloy. The strength and ductility increased with increase in strain rate at 973 K. Reasons for this are discussed. The ODS alloy exhibited a recrystallized microstructure which is difficult to achieve by extrusion. No prior particle boundaries were observed after forging. The forged compacts exhibited isotropic mechanical properties. It is suggested that powder forging may offer several advantages over the traditional extrusion/HIP routes for fabrication of ODS alloys.

« With what face can you look up, thou shame of heaven and man?». The monologue to one’s penis from the Satyricon to Fellini Satyricon

Directory of Open Access Journals (Sweden)

Emanuele Canzaniello

2016-11-01

Full Text Available Questo lavoro muove dal puntuale riferimento al frammento 132, 8-16 del Satyricon antico, porzione di testo che mette in scena un disinvolto e superbo monologo al proprio membro, presa in giro di ogni impasse sessuale, calco parodico dell’Odissea. Se ne precisa la peculiare posizione all’interno della scala delle temperatura della parodia. Il focus del saggio è poi rivolto alla riscrittura e alla rilettura messa in opera filmica nel Fellini Satyricon (1969. Vengono prese in esame le varianti e le tecniche messe a punto per tradurre quello stesso grado di parodia, se ne indagano le continuità e le perdite calcolabili nella mutazione e nel mutamento del mezzo espressivo.

Medium carbon vanadium micro alloyed steels for drop forging

International Nuclear Information System (INIS)

Jeszensky, Gabor; Plaut, Ronald Lesley

1992-01-01

Growing competitiveness of alternative manufacturing routes requires cost minimization in the production of drop forged components. The authors analyse the potential of medium carbon, vanadium microalloyed steels for drop forging. Laboratory and industrial experiments have been carried out emphasizing deformation and temperature cycles, strain rates and dwell times showing a typical processing path, associated mechanical properties and corresponding microstructures. The steels the required levels of mechanical properties on cooling after forging, eliminating subsequent heat treatment. The machinability of V-microalloyed steels is also improved when compared with plain medium carbon steels. (author)

Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

International Nuclear Information System (INIS)

Kwon, Yong Chul; Kang, Jong Hun; Kim, Sang Sik

2016-01-01

The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts

Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

Energy Technology Data Exchange (ETDEWEB)

Kwon, Yong Chul [Gyeongnam Technopark, Changwon (Korea, Republic of); Kang, Jong Hun [Jungwon Univ., Goisan (Korea, Republic of); Kim, Sang Sik [Gyeongsang Natiional Univ., Jinju (Korea, Republic of)

2016-02-15

The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts.

Microstructure evolution of superalloy for large exhaust valve during hot forging

International Nuclear Information System (INIS)

Jeong, H.S.; Cho, J.R.; Park, H.C.

2004-01-01

The nickel-based alloy Nimonic 80A possesses strength, and corrosion, creep and oxidation resistance at high temperature. These products are used for aerospace, marine engineering and power generation, etc. The control of forging parameters such as strain, strain rate, temperature and holding time is important because the microstructure change in hot working affects the mechanical properties. It is necessary to understand the microstructure variation evolution. The microstructure change evolution occurs by recovery, recrystallization and grain growth phenomena. The dynamic recrystallization evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05-5s-1 using hot compression tests. The metadynamic recrystallization and grain growth evolution has been studied in the temperature range 950-1250 deg. C and strain rate range 0.05, 5s-1, holding time range 5, 10, 100, 600 sec using hot compression tests. Modeling equations are developed to represent the flow curve, recrystallized grain size, recrystallized fraction and grain growth phenomena by various tests. Parameters of modeling equation are expressed as a function of the Zener-Hollomon parameter. The modeling equation for grain growth is expressed as a function of initial grain size and holding time. The developed modeling equation was combined with thermo-viscoplastic finite element modeling to predict various microstructure change evolution during thermo mechanical processing. The predicted grain size in developed FE simulation results is compared with results obtained in various tests. In order to obtain a final microstructure and good mechanical properties in forging, the FEM would become a useful tool in the simulation of the microstructure development

Optimising mechanical properties of hot forged nickel superalloy 625 components

Science.gov (United States)

Singo, Nthambe; Coles, John; Rosochowska, Malgorzata; Lalvani, Himanshu; Hernandez, Jose; Ion, William

2018-05-01

Hot forging and subsequent heat treatment were resulting in substandard mechanical properties of nickel superalloy, Alloy 625, components. The low strength was found to be due to inadequate deformation during forging, excessive grain growth and precipitation of carbides during subsequent heat treatment. Experimentation in a drop forging company and heat treatment facility led to the establishment of optimal parameters to minimise grain size and mitigate the adverse effects of carbide precipitation, leading to successful fulfilment of mechanical property specifications. This was achieved by reducing the number of operations, maximising the extent of deformation by changing the slug dimensions and its orientation in the die, and minimising the time of exposure to elevated temperatures in both the forging and subsequent heat treatment processes to avoid grain growth.

Fuzzy Modeling to Evaluate the Effect of Temperature on Batch Transesterification of Jatropha Curcas for Biodiesel Production

Directory of Open Access Journals (Sweden)

Vipan Kumar Sohpal

2011-05-01

Full Text Available Biodiesel is an alternative source of fuel that can be synthesized from edible, non-edible and waste oils through transesterification. Firstly Transesterification reaction of Jatropha Curcas oil with butanol in the ratio of 1:25 investigated by using of sodium hydroxide catalyst with mixing intensity of 250 rpm in isothermal batch reactor. Secondly the fuzzy model of the temperature is developed. Performance was evaluated by comparing fuzzy model with the batch kinetic data. Fuzzy models were developed using adaptive neurofuzzy inference system (ANFIS. © 2011 BCREC UNDIP. All rights reserved(Received: 27th January 2011, Revised: 13rd February 2011; Accepted: 16th February 2011[How to Cite: V.K. Sohpal, A. Singh, A. Dey. (2011. Fuzzy Modeling to Evaluate the Effect of Temperature on Batch Transesterification of Jatropha Curcas for Biodiesel Production. Bulletin of Chemical Reaction Engineering and Catalysis, 6(1: 31-38. doi:10.9767/bcrec.6.1.816.31-38][How to Link / DOI: http://dx.doi.org/10.9767/bcrec.6.1.816.31-38 || or local:  http://ejournal.undip.ac.id/index.php/bcrec/article/view/816 ] | View in 

Protein (Cyanobacteria): 652392000 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available WP_026787847.1 ... 1117:3748 ... 1150:52103 1301283:73282 ... 54304:1962 59512:816 ... NUDIX hydrolase Plankt...othrix rubescens MNKTLILEDFKVGVDNVIFSVDTEQNRLLVLLVKRKEEPFINTWSLPGTLVQKGESLENAAYRILAEKILVE

EFEITO DO FRIO NA BROTAÇÃO DE GEMAS DE PEREIRA (Pyrus communis L. cv. Carrick, EM PELOTAS, RS EFFECT OF CHILLING ON THE BUD BREAKING OF PEAR CV. CARRICK, IN PELOTAS, RS

Directory of Open Access Journals (Sweden)

FLÁVIO GILBERTO HERTER

2001-08-01

Full Text Available Objetivou-se, no presente trabalho, identificar a profundidade de dormência e a velocidade de brotação em gemas de pereira, submetidas a diferentes períodos de frio à temperatura de 4ºC ±1. O experimento foi conduzido na Embrapa-Clima Temperado, em Pelotas, em 1999. Em 1º de junho, foram coletados 50 ramos, na cultivar Carrick, com aproximadamente 30 cm de comprimento. Após, foram divididos em 5 lotes de 10 ramos, sendo 4 mantidos a 4ºC± 1, e um em condições ambiente, constituindo, assim, 5 tratamentos: 0 (Testemunha; 272; 544; 816 e 1088 horas de frio (HF. No final de cada tratamento, os ramos foram divididos em pequenas estacas, contendo apenas uma única gema, sendo, após, armazenados em câmara climática a 25ºC ± 1. Avaliou-se a brotação, considerando-se o estádio de ponta verde. A partir destes dados, calculou-se o tempo médio de brotação (TMB, bem como a percentagem de gemas brotadas, em cada um dos tratamentos. Utilizou-se o índice de velocidade de brotação (IVB, para determinar a eficiência da temperatura na brotação das gemas. A profundidade de dormência, das gemas terminais, diminuiu à medida que se aumentou o período de frio. As gemas axilares não foram influenciadas pelo tempo de exposição ao frio. Com base nos dados do IVB e dos coeficientes angulares, as gemas terminais da cv. Carrick necessitam de 800 horas de frio para completar a brotação, nas condições que foram conduzidos os experimentos.The objective for this work was to identify the dormancy depth and the bud-sprouting rate of pear trees kept at chilling conditions (4ºC±1 for different periods. The experiment was carried out using buds of twigs of the previous growth season from a pear orchard of the Embrapa Clima Temperado Research Center. The twigs were collected on June 1, 1999. The treatments were five period of chilling: 0 (control; 272; 544; 816; or 1088 hours at 4ºC±1. At the end of each treatment, the twigs were cut into

Study on isothermal precision forging process of rare earth intensifying magnesium alloy

International Nuclear Information System (INIS)

Shan, Debin; Xu, Wenchen; Han, Xiuzhu; Huang, Xiaolei

2012-01-01

A three dimensional rigid-plastic finite element model is established to simulate the isothermal precision forging process of the magnesium alloy bracket based on DEFORM 3D in order to analyze the material flow rule and determine the forging process scheme. Some problems such as underfilling and too large forging pressure are predicted and resolved through optimizing the shapes of the billet successfully. Compared to the initial microstructure, the isothermal-forged microstructure of the alloy refines obviously and amounts of secondary phases precipitate on the matrix during isothermal forging process. In subsequent ageing process, large quantities of secondary phases precipitate from α-Mg matrix with increasing ageing time. The optimal comprehensive mechanical properties of the alloy have been obtained after aged at 473 K, 63 h with the ultimate tensile strength, tensile yield strength and elongation 380 MPa, 243 MPa and 4.07% respectively, which shows good potential for application of isothermal forging process of rare earth intensifying magnesium alloy.

Near net shape forging of titanium alloy turbine blade

International Nuclear Information System (INIS)

Morita, Akiyasu; Hattori, Shigeo; Tani, Kazuhito; Takemura, Atsushi; Ashida, Yoshio

1991-01-01

The isothermal forging process has been developed to produce turbine blades made of near β Ti-alloy Ti-10V-2Fe-3Al. It is important to set the preform at the optimum position of the die in order to get a high precision product. The deformation analysis by using FEM is effective to determine the optimum position. And also it is necessary to avoid buckling induced by the restriction of axial elongation of the material. As a result, Ti-10V-2Fe-3Al blades could be formed precisely by using only one stage of forging, and machining was needed only at the root. The thickness of the oxide layer induced on the surface of the forged blade was only 70μm. The mechanical properties of Ti-10V-2Fe-3Al blades after forging and annealing were superior to those of Ti-6Al-4V blades and were nearly uniform across the length of the blades. (author)

Sensitivity analysis and optimization algorithms for 3D forging process design

International Nuclear Information System (INIS)

Do, T.T.; Fourment, L.; Laroussi, M.

2004-01-01

This paper presents several approaches for preform shape optimization in 3D forging. The process simulation is carried out using the FORGE3 registered finite element software, and the optimization problem regards the shape of initial axisymmetrical preforms. Several objective functions are considered, like the forging energy, the forging force or a surface defect criterion. Both deterministic and stochastic optimization algorithms are tested for 3D applications. The deterministic approach uses the sensitivity analysis that provides the gradient of the objective function. It is obtained by the adjoint-state method and semi-analytical differentiation. The study of stochastic approaches aims at comparing genetic algorithms and evolution strategies. Numerical results show the feasibility of such approaches, i.e. the achieving of satisfactory solutions within a limited number of 3D simulations, less than fifty. For a more industrial problem, the forging of a gear, encouraging optimization results are obtained

Renegotiating Cultural Authority: Imperial Culture and the New Zealand Primary School Curriculum in the 1930s

Science.gov (United States)

Soler, Janet

2006-01-01

The dominant influences that forged curriculum policy in relation to the literacy curriculum in New Zealand during the 1930s can be seen to be enmeshed in the politics of the wider context of what de Castell and Luke have identified as the "literacy ideologies of the British Empire". It was these literacy ideologies and concerns over the…

Transmission electron microscopy of Ti-12Mo-13Nb Alloy aged after heat forging; Microscopia eletronica de transmissao da liga Ti-12Mo-13Nb envelhecida apos forjamento a quente

Energy Technology Data Exchange (ETDEWEB)

Oliveira, Nathalia Rodrigues [Centro Universitario de Volta Redonda (UNIFOA), Volta Redonda, RJ (Brazil); Baldan, Renato [Universidade de Sao Paulo (USP), Lorena, SP (Brazil). Escola de Engenharia; Nunes, Carlos Angelo; Mei, Paulo Roberto [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil); Gabriel, Sinara Borborema [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil)

2014-06-15

Metastable β-Ti alloys possess mechanical properties, in particular a elastic modulus that depends not only on its composition but also the applied thermomechanical treatments. These alloys require high mechanical strength and a low Young’s modulus to avoid stress shielding. Preliminary studies on the development of Ti- 13Nb-12Mo alloy showed than the better properties were obtained at aged at 500 ° C / 24 h after cold forging , whose microstructure consisted of bimodal α phase in the β matrix. In this work, Ti-12Mo-13Nb alloy was heat forged and aged at 500 deg C for 24h and the microstructure was analyzed by employing X-ray diffraction and transmission electron microscopy. According to the results, while the cold forging resulted in bimodal α phase in the β matrix, hot forging resulted in a fine and homogeneous α phase in the β matrix. (author)

High yttria ferritic ODS steels through powder forging

Energy Technology Data Exchange (ETDEWEB)

Kumar, Deepak [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Prakash, Ujjwal, E-mail: ujwalfmt@iitr.ac.in [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Dabhade, Vikram V. [Department of Metallurgical and Materials Engineering, I.I.T-Roorkee, Uttarakhand 247667 (India); Laha, K.; Sakthivel, T. [Mechanical Metallurgy Group, IGCAR, Kalpakkam, Tamilnadu 603102 (India)

2017-05-15

Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y{sub 2}O{sub 3} (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility. - Highlights: •ODS steels with yttria contents beyond the conventional limit of 0.5 wt% were fabricated by powder forging in a hydrogen atmosphere. •All the alloys exhibited significant ductility. •This may be attributed to improved inter-particle bonding due to reduction of surface oxides by hydrogen. •Strength in excess of 300 MPa was obtained at 973 K for 0.5%, 1% and 1.5% yttria ODS alloys. •Powder forging is a promising route to fabricate ODS steels and permits development of compositions with up to 1.5% yttria.

Close toleranoe forging of chromium steel blades for powerful steam turbines

International Nuclear Information System (INIS)

Shastin, Eh.G.; Kositskij, Yu.N.; Lyubchits, G.A.

1989-01-01

Work on simulating technological process on die-forging hammer was performed in order to reduce the preparation period bringing technology of close tolerance forging of turbine blades to a commercial level. A special attention was paid to development of accurate forming of forgings of 20Kh13Sh, 12Kh13 and 15Kh11MFSh steels on screw presses with nominal effort equal to 80 and 144 MN

The Design of E-Traveler’s Check with Efficiency and Mutual Authentication

OpenAIRE

Chin-Chen Chang; Shih-Chang Chang

2010-01-01

Nowadays, traveling has become a popular leisure activity in our daily lives. Travelers can either use cash or credit cards to pay their bills. However, there is risk of cash being robbed or credit cards being copied. The traveler’s check, which is a third choice, comes in to get travelers around such risks and to protect their rights. Nevertheless, traditional travelers’ checks cannot keep imposters from forging and cashing them illegally. Hence, we propose a new type of check, called the e-...

Temperature dependent I-V characteristics of an Au/n-GaAs Schottky diode analyzed using Tung’s model

Science.gov (United States)

Korucu, Demet; Turut, Abdulmecit; Efeoglu, Hasan

2013-04-01

The current-voltage (I-V) characteristics of Au/n-GaAs contacts prepared with photolithography technique have been measured in the temperature range of 80-320 K. The ideality factor and barrier height (BH) values have remained almost unchanged between 1.04 and 1.10 and at a value of about 0.79 eV at temperatures above 200 K, respectively. Therefore, the ideality factor values near unity say that the experimental I-V data are almost independent of the sample temperature, that is, contacts have shown excellent Schottky diode behavior above 200 K. An abnormal decrease in the experimental BH Φb and an increase in the ideality factor with a decrease in temperature have been observed below 200 K. This behavior has been attributed to the barrier inhomogeneity by assuming a Gaussian distribution of nanometer-sized patches with low BH at the metal-semiconductor interface. The barrier inhomogeneity assumption is also confirmed by the linear relationship between the BH and the ideality factor. According to Tung’s barrier inhomogeneity model, it has been seen that the value of σT=7.41×10-5 cm2/3 V1/3from ideality factor versus (kT)-1 curve is in close agreement with σT=7.95×10-5 cm2/3 V1/3 value from the Φeff versus (2kT)-1 curve in the range of 80-200 K. The modified Richardson ln(J0/T2)-(qσT)2(Vb/η)2/3/[2(kT)2] versus (kT)-1 plot, from Tung’s Model, has given a Richardson constant value of 8.47 A cm-2 K-2which is in very close agreement with the known value of 8.16 A cm-2 K-2 for n-type GaAs; considering the effective patch area which is significantly lower than the entire geometric area of the Schottky contact, in temperature range of 80-200 K. Thus, it has been concluded that the use of Tung’s lateral inhomogeneity model is more appropriate to interpret the temperature-dependent I-V characteristics in the Schottky contacts.

American Labor in U.S. History Textbooks: How Labor's Story Is Distorted in High School History Textbooks

Science.gov (United States)

Cole, Paul F.; Megivern, Lori; Hilgert, Jeff

2011-01-01

Imagine opening a high school U.S. history textbook and finding no mention of--or at most a passing sentence about--Valley Forge, the Missouri Compromise, or the League of Nations. Imagine not finding a word about Benjamin Franklin, Lewis and Clark, Sitting Bull, Andrew Carnegie, or Rosa Parks. Imagine if these key events and people just…

Integral forged pump casing for the primary coolant circuit of a nuclear reactor: Development in design, forging technology, and material

International Nuclear Information System (INIS)

Austel, W.; Korbe, H.

1986-01-01

Developments in the forging of large casings for primary circuit coolant pumps for light water reactors in Germany are demonstrated beginning with the multiple forging fabricated version and ending with the integral forged type. This version is the result of the joint efforts of the pump manufacturer and the forgemaster after a cost-gain evaluation and represents an optimum solution in view of its functional and economical performance and also considering the high requirements for mechanical-technological properties, including homogeneity of the material. The development from 22 NiMoCr 3 7/A 508 Class 2 to 20 MnMoNi 5 5/A 508 Class 3 and their optimization will be demonstrated. This development is based mainly on minimizing the sulfur content and on vacuum carbon deoxidation (VCD), which results in a reduction of the A-segregations, in improving fracture toughness and isotropy, and in the desired fine-grain structure

Floating venous thrombi: diagnosis with spiral-CT-venography; Diagnose flottierender venoeser Thromben mittels Phlebo-Spiral-CT

Energy Technology Data Exchange (ETDEWEB)

Gartenschlaeger, M. [Mainz Univ. (Germany). Klinik fuer Radiologie; Klose, K.J. [Univ. Marburg, Medizinisches Zentrum fuer Innere Medizin, Abt. Poliklinik (Germany); Schmidt, J.A. [Univ. Marburg, Medizinisches Zentrum fuer Radiologie, Abt. fuer Strahlendiagnostik (Germany)

1996-05-01

Local application of contrast agent into an ipsilateral dorsal foot vein and spiral CT were used to examine 16 consecutive cases with deep venous thrombosis proven at conventional venography; in addition, colour Doppler flow imaging was performed. At conventional venography, 8/16 thrombi appeared to be floating and the remaining 8/16 were adherent to the vessel wall. Spiral-CT showed 15/16 thrombi to be adherent to the vessel wall; the floating thrombus correlated with findings in conventional venography. At colour Doppler flow imaging 3/16 thrombi were considered floating, one of them was discordant to conventional venography. The comparison of conventional venography to spiral-CT demonstrates complete agreement for adherence to vessel wall seen in conventional venography (p=1,0) and significant discordance in cases with free-floating appearance in conventional venography. Adherence of thrombi to the wall of the vessel at conventional venography is in agreement with computed tomography. Conventional venography probably overestimates the prevalence of free floating thrombi. (orig./MG) [Deutsch] Mittels lokaler Kontrastmittelapplikation in eine ipsilaterale Fussrueckenvene und Spiral-CT wurden 16 konsekutive Faelle konventionell phlebographisch gesicherter Phlebothrombose untersucht, zusaetzlich wurde die farbkodierte Doppler-Ultraschalluntersuchung durchgefuehrt. In der konventionellen Phlebographie waren 8/16 Thromben flottierend, die uebrigen 8/16 wandadhaerent. In der Spiral-CT zeigten sich Wandadhaerenzen in 15/16 Faellen; der nachgewiesene flottierende Thrombus stimmte mit der konventionellen Phlebographie ueberein. Im farbkodierten Doppler-Ultraschall erschienen die Thromben in 3/16 Faellen flottierend, darunter ein von der konventionellen Phlebographie abweichender Befund. Der Vergleich von konventioneller und CT-Phlebographie ergab eine komplette Uebereinstimmung fuer konventionell phlebographisch nachgewiesene Wandadhaerenz und eine signifikante Abweichung

Enhancing Pharmacist’s Role and Tuberculosis Patient Outcomes Through Training-Education-Monitoring-Adherence-Networking (TEMAN Pharmacist Model Intervention

Directory of Open Access Journals (Sweden)

Nanang M. Yasin

2017-12-01

Full Text Available Training-Education-Monitoring-Adherence-Networking (TEMAN Pharmacist model provides opportunities for trained pharmacist to intervene through education of tuberculosis (TB patient, therapy monitoring, assessment of patient’s adherence, and collaboration with other health professionals. The study aimed to determine the impact of TEMAN Pharmacist model intervention against the role of pharmacist and TB patient outcomes. The study design was a quasi-experimental study with one group pretest-posttest consisted of two phases: training and pharmacist intervention. After training, pharmacists intervene during regular visits TB patients in primary health care and Special Hospital Lung Respira in Yogyakarta. The research subjects were TB officer (pharmacist and TB programmers and patients with newly TB diagnostic who met the inclusion criteria, i.e. patients aged 15 years or older, receiving antituberculosis therapy, and willing to fill out given questionnaires and signing a letter of approval for the study (informed consent. Meanwhile, the exclusion criteria were patients with multi-drug resistance (MDR TB; have hepatic disease, psychiatry (mental, and cognitive dysfunction. The instrument developed was a questionnaire to measure the level of knowledge of TB officers and questionnaires to measure the level of knowledge and adherence of TB patients. The data were analyzed descriptively and by using Wilcoxon test. The training effectively improved the knowledge of participants significantly (p=0,000 on average 11.3±3.00 (intermediate category to 16.3±2.31 (high category. A total of 40 (81.6% TB patients increased their knowledge significantly (p=0,000 and 5 (10.2% increased their adherence significantly (p=0,034 after the pharmacist’s intervention. Additionally, out of 49 patients, 29 (59.2% patients increased body weight, 100% sputum smear conversion, 33 (67.3% incidence of ADR, and 8 (16.3% potential drug interactions were documented by the

30 CFR 942.816 - Performance standards-Surface mining activities.

Science.gov (United States)

2010-07-01

...: (1) Channel lining shall be designed using standard engineering practices to pass safely the design... specified in the approved reclamation plan. To minimize competition with woody plants, herbaceous ground... compacted fill to a minimum depth of one foot. (2) Ancillary Roads. (i) Field design methods may be utilized...

30 CFR 905.816 - Performance standards-Surface mining activities.

Science.gov (United States)

2010-07-01

... Hazardous Waste Control Law, Cal. Health & Safety Code section 25100 et seq.; the State Underground Storage of Hazardous Substances Law, Cal. Health & Safety Code section 25280 et seq.; the Solid Waste Management and Resource Recovery Act of 1972, Cal. Gov. Code section 66770 et seq.; the California...

30 CFR 816.84 - Coal mine waste: Impounding structures.

Science.gov (United States)

2010-07-01

... control, the probable maximum precipitation of a 6-hour precipitation event, or greater event as specified.... Runoff from areas above the disposal facility or runoff from surface of the facility that may cause...-hour design precipitation event. (e) Impounding structures constructed of or impounding coal mine waste...

30 CFR 816.89 - Disposal of noncoal mine wastes.

Science.gov (United States)

2010-07-01

... surface runoff do not degrade surface or ground water, that fires are prevented, and that the area remains... underground water. Wastes shall be routinely compacted and covered to prevent combustion and wind-borne waste...

30 CFR 816.45 - Hydrologic balance: Sediment control measures.

Science.gov (United States)

2010-07-01

... carried out within and adjacent to the disturbed area. The sedimentation storage capacity of practices in... protected channels or pipes through disturbed areas so as not to cause additional erosion; (6) Using straw...

Laser-fusion 40Ar/39Ar Ages of Darwin Impact Glass

Science.gov (United States)

Lo, Ching-Hua; Howard, Kieren T.; Chung, Sun-Lin; Meffre, Sebastien

2002-11-01

Three samples of Darwin Glass, an impact glass found in Tasmania, Australia at the edge of the Australasian tektite strewn field were dated using the 40Ar/39Ar single-grain laser fusion technique, yielding isochron ages of 796-815 ka with an overall weighted mean of 816 ± 7 ka. These data are statistically indistinguishable from those recently reported for the Australasian tektites from Southeast Asia and Australia (761-816 ka; with a mean weighted age of 803 ± 3 ka). However, considering the compositional and textural differences and the disparity from the presumed impact crater area for Australasian tektites, Darwin Glass is more likely to have resulted from a distinct impact during the same period of time.

Influence of sulphur and phosphorus impurities on ductility of 25Kh2NMFA steel during forging

International Nuclear Information System (INIS)

Onishchenko, A.K.

1989-01-01

Using cylindrical samples of the 25Kh2NMFA steel with sulfur and phosphorus content in the range of 0.001-0.030%, tensile test with the rate of deformation 10 -3 s -1 at the temperatures of 800-1200 deg C has been conducted. Analysis of fracture foci and plasticity diagrams has shown, that to ensure ductility during forging and high mechanical properties, the content of sulfur and phosphorus impurities in the 25Kh2NMFA steel must not exceed 0.015%

Application of CAD/CAE/CAM in forging process: a review

International Nuclear Information System (INIS)

Ahmad Baharuddin Abdullah; Hamouda, A.M.S.

2005-01-01

Forging can be described as the process in which metal is plastically deformed with application of huge pressure. The process not only changes the shape but also improves the properties of the forged parts due to grain size refinement. Conventionally, the empirical trial and error method has been applied, but recently there are various tools are employed to improved product quality and economic of the process. For example, Computer Aided Design (CAD) is widely used in modeling of the process, while Computer Aided Engineering (CAE) tools have been utilized in analyzing the process. To physically demonstrate the process, Computer Aided Manufacturing (CAM) such as CNC machine has been exploited. In order to improve forging process efficiency, an integrated system that combines all advantages of CAD, CAM and CAE need to be developed. This paper presents an overview of computer aided simulation such as CAD, CAE and CAM application in forging process. (Author)

Examples on cold forged aluminium components in automotive industry

DEFF Research Database (Denmark)

Bay, Niels; Kolsgaard, A.

2000-01-01

The present paper describes the possibilites of applying cold forging for manufacturing of light weight components in aluminium. A short description of the basic cold forming processes forms the basis for describing the great variety in design of cold forged components. Examples are mainly taken ...... from automotive industry but in a few cases also from other industrial sectors to show the possibilities....

Calculation of recovery plasticity in multistage hot forging under isothermal conditions.

Science.gov (United States)

Zhbankov, Iaroslav G; Perig, Alexander V; Aliieva, Leila I

2016-01-01

A widely used method for hot forming steels and alloys, especially heavy forging, is the process of multistage forging with pauses between stages. The well-known effect which accompanies multistage hot forging is metal plasticity recovery in comparison with monotonic deformation. A method which takes into consideration the recovery of plasticity in pauses between hot deformations of a billet under isothermal conditions is proposed. This method allows the prediction of billet forming limits as a function of deformation during the forging stage and the duration of the pause between the stages. This method takes into account the duration of pauses between deformations and the magnitude of subdivided deformations. A hot isothermal upsetting process with pauses was calculated by the proposed method. Results of the calculations have been confirmed with experimental data.

Assessing the risk of foliar injury from ozone on vegetation in parks in the U.S. National Park Service's Vital Signs Network

Energy Technology Data Exchange (ETDEWEB)

Kohut, Robert [Boyce Thompson Institute for Plant Research, Cornell University, Ithaca, NY 14853 (United States)], E-mail: rjk9@cornell.edu

2007-10-15

The risk of ozone injury to plants was assessed in support of the National Park Service's Vital Signs Monitoring Network program. The assessment examined bioindicator species, evaluated levels of ozone exposure, and investigated soil moisture conditions during periods of exposure for a 5-year period in each park. The assessment assigned each park a risk rating of high, moderate, or low. For the 244 parks for which assessments were conducted, the risk of foliar injury was high in 65 parks, moderate in 46 parks, and low in 131 parks. Among the well-known parks with a high risk of ozone injury are Gettysburg, Valley Forge, Delaware Water Gap, Cape Cod, Fire Island, Antietam, Harpers Ferry, Manassas, Wolf Trap Farm Park, Mammoth Cave, Shiloh, Sleeping Bear Dunes, Great Smoky Mountains, Joshua Tree, Sequoia and Kings Canyon, and Yosemite. - An assessment of the risk of foliar ozone injury on plants was conducted for 269 parks in support of the U.S. National Park Service's Vital Signs Monitoring Network Program.

Effect of Cold Forging on Microstructure and MechanicalProperties of Al/SiC Composites

Science.gov (United States)

Hanamantraygouda, M. B.; Shivakumar, B. P., Dr; Siddappa, P. N.; Sampathkumar, L.; Prashanth, L.

2018-02-01

The objective of this work was to investigate the effect of cold forging on mechanical properties and microstructural study of Al MMCs, at different wt% of SiC and forging cycle. The Al-SiC composite material was fabricated by stir casting method at different weight percentage of SiC such as 2.5, 5, 7.5 and 10%. Further, the deformation characteristics during open-die forging of Al-SiC composite at cold conditions was investigated. Cast and forged composite material was subjected to hardness test, tensile test and impact test. The grain size, microstructure behaviour was investigated using optical microscope. The results show that hardness and strength of Al-SiC composite increases and ductility decreases as compared to Al alloy in both as-cast and forged conditions. Optical microscope images showed that the distribution of SiC in Al matrix was more homogeneous in a forged composite as compared to cast one and reduction of porosity was found. Further, it showed that due to forging cycle the grain size was reduced by 30% to 35% from initial size.

Finite element simulations and experimental investigations on ductile fracture in cold forging of aluminum alloy

Science.gov (United States)

Amiri, Amir; Nikpour, Amin; Saraeian, Payam

2018-05-01

Forging is one of the manufacturing processes of aluminium parts which has two major categories: called hot and cold forging. In the cold forging, the dimensional and geometrical accuracy of final part is high. However, fracture may occur in some aluminium alloys during the process because of less workability. Fracture in cold forging can be in the form of ductile, brittle or combination of both depending on the alloy type. There are several criteria for predicting fracture in cold forging. In this study, cold forging process of 6063 aluminium alloy for three different parts is simulated in order to predict fracture. The results of numerical simulations of Freudenthal criterion is in conformity with experimental tests.

[Determination of the 120-day post prostatic biopsy mortality rate].

Science.gov (United States)

Canat, G A; Duclos, A; Couray-Targe, S; Schott, A-M; Polazzi, S; Scoazec, J-Y; Berger, F; Perrin, P

2014-06-01

Concerning death-rates were reported following prostate biopsy but the lack of contexts in which event occurred makes it difficult to take any position. Therefore, we aimed to determine the 120-day post-biopsy mortality rate. Between 2000 and 2011, 8804 men underwent prostate biopsy in the hospice civils de Lyon. We studied retrospectively, the mortality rate after each of the 11,816 procedures. Biopsies imputability was assessed by examining all medical records. Dates of death were extracted from our local patient management database, which is updated trimestrially with death notifications from the French National Institute for Statistics and Economic Studies. In our study 42 deaths occurred within 120days after 11,816 prostate biopsies (0.36%). Of the 42 records: 9 were lost to follow-up, 3 had no identifiable cause of death, 28 had an intercurrent event ruling out prostate biopsy as a cause of death. Only 2 deaths could be linked to biopsy. We reported at most 2 deaths possibly related to prostate biopsy over 11,816 procedures (0.02%). We confirmed the fact that prostate biopsies can be lethal but this rare outcome should not be considered as an argument against prostate screening given the circumstances in which it occurs. 5. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

Phenotypic and genotypic characteristics of mastocytosis according to the age of onset.

Directory of Open Access Journals (Sweden)

Fanny Lanternier

Full Text Available Adult's mastocytosis is usually associated with persistent systemic involvement and c-kit 816 mutation, while pediatrics disease is mostly limited to the skin and often resolves spontaneously. We prospectively included 142 adult patients with histologically proven mastocytosis. We compared phenotypic and genotypic features of adults patients whose disease started during childhood (Group 1, n = 28 with those of patients whose disease started at adult's age (Group 2, n = 114. Genotypic analysis was performed on skin biopsy by sequencing of c-kit exons 17 and 8 to 13. According to WHO classification, the percentage of systemic disease was similar (75 vs. 73% in 2 groups. C-kit 816 mutation was found in 42% and 77% of patients in groups 1 and 2, respectively (p<0.001. 816 c-kit mutation was associated with systemic mastocytosis in group 2 (87% of patients with systemic mastocytosis vs. 45% with cutaneous mastocytosis, p = 0.0001. Other c-kit activating mutations were found in 23% of patients with mastocytosis' onset before the age of 5, 0% between 6 and 15 years and 2% at adults' age (p<0.001. In conclusion, pathogenesis of mastocytosis significantly differs according to the age of disease's onset. Our data may have major therapeutic relevance when considering c-kit-targeted therapy.

Influence of performance improvement of AP1000 nuclear island main equipment forging on manufacturing

International Nuclear Information System (INIS)

Liu Zhiying

2013-01-01

In order to comply with the 60-year design life of an AP1000 nuclear power station, higher strength and ductility requirements have been made on AP1000 nuclear island SG forgings than on CPR1000 nuclear island main equipment. In addition, bigger size of AP1000 nuclear island SG forgings increases the difficulty of manufacturing them. Insufficient recognition of these changes may cause unstable quality of forgings and possible quality problems in follow-up welding procedure. On the basis of comparison and analysis of AP1000 nuclear island SG forgings and CPR1000 nuclear island forgings, this thesis suggests clear directions for the actions we need to take. (author)

Simulation and analysis of hot forging process for industrial locking gear elevators

Science.gov (United States)

Maarefdoust, M.; Kadkhodayan, M.

2010-06-01

In this paper hot forging process for industrial locking gear elevators is simulated and analyzed. An increase in demand of industrial locking gear elevators with better quality and lower price caused the machining process to be replaced by hot forging process. Production of industrial locking gear elevators by means of hot forging process is affected by many parameters such as billet temperature, geometry of die and geometry of pre-formatted billet. In this study the influences of billet temperature on effective plastic strain, radius of die corners on internal stress of billet and thickness of flash on required force of press are investigated by means of computer simulation. Three-dimensional modeling of initial material and die are performed by Solid Edge, while simulation and analysis of forging are performed by Super Forge. Based on the computer simulation the required dies are designed and the workpieces are formed. Comparison of simulation results with experimental data demonstrates great compatibility.

Research into Oil-based Colloidal-Graphite Lubricants for Forging of Al-based Alloys

International Nuclear Information System (INIS)

Petrov, A.; Petrov, P.; Petrov, M.

2011-01-01

The presented paper describes the topical problem in metal forging production. It deals with the choice of an optimal lubricant for forging of Al-based alloys. Within the scope of the paper, the properties of several oil-based colloidal-graphite lubricants were investigated. The physicochemical and technological properties of these lubricants are presented. It was found that physicochemical properties of lubricant compositions have an influence on friction coefficient value and quality of forgings.The ring compression method was used to estimate the friction coefficient value. Hydraulic press was used for the test. The comparative analysis of the investigated lubricants was carried out. The forging quality was estimated on the basis of production test. The practical recommendations were given to choose an optimal oil-based colloidal-graphite lubricant for isothermal forging of Al-based alloy.

Study on the microstructure of the different parts for new aluminum alloy forgings

International Nuclear Information System (INIS)

Gao Wei; Zheng Xiaojing; Wu Fu

2014-01-01

The mechanical properties of former aluminium alloy forgings cannot achieve technique demand. Because the component, dimension and preparation technology of new aluminum alloy have changed, the microstructure and mechanical properties of forgings are researched. It is concluded that the flowline of forgings has good continuity and uniformity, it does not have a prominent difference on microhardness of different parts. The results prove that the microstructure of forgings has good consistency. The matrix structure of forgings consists of fiber texture and equiaxed structure. The residual second phases, which are harmful to mechanical properties, are observed in the equiaxed structure. The center of equiaxed structure core zone, the edge of equiaxed structure transition zone and equiaxed structure edge zone should be focus on observing test, they are the sampling location of tensile property. (authors)

75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

Science.gov (United States)

2010-11-18

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known As Contech Forgings, LLC..., applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser Aluminum-Greenwood Forge Division...

Protein (Cyanobacteria): 414077569 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available lasmid addiction system poison protein Anabaena sp. 90 MLINLNENINYTVVIGIDAQDFFESASATLQKKLDRCFEILKIEPRNYPNIKALKGEFSGYYRYRVGDYRVIYEIDDNSKLVTILLIAHRSKVYE ... YP_006996887.1 NC_019440 1117:5824 ... 1161:889 ... 1162:2120 1163:3278 46234:816 ... p

Study of iron deposit using seismic refraction and resistivity in Carajás Mineral Province, Brazil

Science.gov (United States)

Nogueira, Pedro Vencovsky; Rocha, Marcelo Peres; Borges, Welitom Rodrigues; Silva, Adalene Moreira; Assis, Luciano Mozer de

2016-10-01

This work comprises the acquisition, processing and interpretation of 2D seismic shallow refraction (P-wave) and resistivity profiles located in the iron ore deposit of N4WS, Carajás Mineral Province (CMP), northern Brazil. The geophysical methods were used to identify the boundaries of the iron ore deposit. Another objective was to evaluate the potentiality of these geophysical methods in that geological context. In order to validate the results, the geophysical lines were located to match a geological borehole line. For the seismic refraction, we used 120 channels, spaced by 10 m, in a line of 1190 m, with seven shot points. The resistivity method used in the acquisition was the electrical resistivity imaging, with pole-pole array, in order to reach greater depths. The resistivity line had a length of 1430 m, with 10 m spacing between electrodes. The seismic results produced a model with two distinct layers. Based on the velocities values, the first layer was interpreted as altered rocks, and the second layer as more preserved rocks. It was not possible to discriminate different lithologies with the seismic method inside each layer. From the resistivity results, a zone of higher resistivity (> 3937 Ω·m) was interpreted as iron ore, and a region of intermediate resistivity (from 816 to 2330 Ω·m) as altered rocks. These two regions represent the first seismic layer. On the second seismic layer, an area with intermediated resistivity values (from 483 to 2330 Ω·m) was interpreted as mafic rocks, and the area with lower resistivity (boreholes and show reasonable correlation, suggesting that the geophysical anomalies correspond to the main variations in composition and physical properties of rocks.

Numerical modelling of damage evolution in ingot forging

DEFF Research Database (Denmark)

Christiansen, Peter; Martins, Paulo A.F.; Bay, Niels Oluf

2015-01-01

The ingot forging process is numerically simulated applying both the Shima-Oyane porous plasticity model as a coupled damage model and the uncoupled normalized Cockcroft & Latham criterion. Four different cases including two different lower die angles (120º and 180º) and two different sizes of feed...... (400mm and 800mm) are analysed. Comparison of the simulation results with recommendations in literature on ingot forging, indicates the normalized Cockcroft & Latham damage criterion to be the most realistic of the two....

Manufacturing and material properties of ultralarge size forgings for advanced BWRPV

International Nuclear Information System (INIS)

Suzuki, Komei; Sato, Ikuo; Tsukada, Hisashi

1994-01-01

Ultralarge size forgings for the advanced boiling water reactor (ABWR) pressure vessel as represented by the bottom petal made from a 600ton ingot have been developed. The bottom petal is a larger wall thickness ring with 10 integrated nozzles inside and outside the ring. The outer diameter is 7.8m, the height is 1.8m and the wall thickness if 1.1m in the as-forged condition. A very high purity level of P≤qslant0.003% and S≤qslant0.003% can be obtained by the application of double-refining processes to all the molten steel. The forging shows a homogeneous chemical distribution, sound internal qualities and adequate impact properties.This paper summarizes the manufacturing technique and material properties of large size forgings such as the bottom petal, the shell with integrated skirt and the bottom dome. ((orig.))

Investigation of the influence of hybrid layers on the life time of hot forging dies

Directory of Open Access Journals (Sweden)

S. Legutko

2013-04-01

Full Text Available The paper deals with the issues related in the process of drop forging with special attention paid to the durability of forging tools. It presents the results of industrial investigation of the influence of hybrid layers on hot forging dies. The effectiveness of hybrid layers type nitrided layer/PVD coating applied for extending the life of forging tools whose working surfaces are exposed to such complex exploitation conditions as, among others, cyclically varying high thermal and mechanical loads, as well as intensive abrasion at raised temperature. The examination has been performed on a set of forging tools made of Unimax steel and intended for forging steel rings of gear box synchronizer in the factory FAS in Swarzedz (Poland.

Analysis of Filling and Stresses in the Hot Forging Process Depending on Flange Die Shapes

International Nuclear Information System (INIS)

Kim, Jun Hyoung; Kim, Cheol

2010-01-01

Hot closed-forging process and the die used for forming an automotive flange were analyzed from the viewpoints of heat transfer, grain-flow lines, and stresses to obtain a forged product without defects such as surface cracks, laps, cold shots, and partial filling. The forging process including up-set, pre-forging, final forging and pressing forces was investigated using finite element analysis. The influence of the preform die and the ratio of the heights of the upper die to lower die on the forging process and die were investigated and a die shape (10 .deg. for the preform die, and 1.5:1 ratio for the final die) suitable to achieve successful forging was determined on the basis of a parametric study. All parametric design requirements such as strength, full filling, and a load limit of 13,000 KN were satisfied for this newly developed flange die. New dies and flanges were fabricated and investigated. Defects such as partial filling and surface cracks were not observed

Physical modeling and numerical simulation of V-die forging ingot with central void

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2014-01-01

Numerical simulation and physical modeling performed on small-scale ingots made from pure lead, having a hole drilled through their centerline to mimic porosity, are utilized to characterize the deformation mechanics of a single open die forging compression stage and to identify the influence...... of the lower V-die angle on porosity closure and forging load requirements of large cast ingots. Results show that a lower V-die angle of 120 provides the best closure of centerline porosity without demanding the highest forging loads or developing unreasonably asymmetric shapes that may create difficulties...... in multi-stage open die forging procedures....

High yttria ferritic ODS steels through powder forging

Science.gov (United States)

Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.

2017-05-01

Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y2O3 (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility.

76 FR 66996 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Forging...

Science.gov (United States)

2011-10-28

... for OMB Review; Comment Request; Forging Machines ACTION: Notice. SUMMARY: The Department of Labor... collection request (ICR) titled, ``Forging Machines,'' to the Office of Management and Budget (OMB) for....218, it is mandatory for covered employers to conduct and to document periodic inspections of forging...

Interseccionalidade de gênero, classe e raça e vulnerabilidade de adolescentes negras às DST/aids Intersectionality of gender, class and race, and vulnerability of black female adolescents to STD/AIDS

Directory of Open Access Journals (Sweden)

Stella R. Taquette

2010-12-01

Full Text Available OBJETIVO: verificar a vulnerabilidade ao HIV/aids de adolescentes femininas moradoras de favelas da cidade do Rio de Janeiro. MÉTODO: foi utilizada uma combinação de métodos, quantitativo e qualitativo. Na etapa quantitativa, realizou-se um estudo observacional de corte transversal por meio de entrevistas e exames clínico/laboratoriais para diagnóstico de DST, e, na qualitativa, desenvolveram-se grupos focais sobre os temas sexualidade, gênero e raça. RESULTADOS: foram entrevistadas 816 adolescentes de 10 diferentes comunidades, com um grupo focal em cada favela: 74% eram negras, 39% eram sexualmente ativas e destas 24,4% eram portadoras de DST. Houve uma relação estatisticamente significativa entre a variável raça/cor negra e a atividade sexual. Na fase qualitativa, evidenciou-se que a discriminação racial sofrida é cotidiana e contribui para a construção de autoimagem negativa que aliada a pobreza, violência de gênero e dificuldade de acesso aos serviços de saúde ampliam a vulnerabilidade às DST/aids. CONCLUSÃO: o estudo sugere a criação de políticas que proporcionem o aumento da oferta de serviços de atendimento ginecológico a esse público, com ações que favoreçam a utilização de preservativo feminino e contribuam para reduzir a desigualdade social, de gênero e de raça.OBJECTIVE: To verify the vulnerability to HIV/AIDS of female adolescents that live in poor communities of the city of Rio de Janeiro. METHODS: It was carried out with quantitative and qualitative analyses. The quantitative phase was a cross-sectional study, through interviews of 816 adolescents and clinical/laboratory tests in ten different slums, and the qualitative phase was done on one focus group about sexuality of gender and race in each community. RESULTS: 74% of the adolescents were black, 39% had sexual activity and 24.4% of those had STD. A statistical significant association occurred between the black color/race and sexual activity

Forging New, Non-traditional Partnerships Among Physicists, Teachers and Students

Energy Technology Data Exchange (ETDEWEB)

Bardeen, Marjorie [Fermilab; Adams, Mark [Illinois U., Chicago; Wayne, Mitchell [Notre Dame U.; Karmgard, Dan [Notre Dame U.; Goussiou, Anna [Washington U., Seattle

2017-05-02

The QuarkNet collaboration has forged new, nontraditional relationships among particle physicists, high school teachers and their students. QuarkNet provides professional development for teachers and creates opportunities for teachers and students to engage in particle physics data investigations and join research teams. Embedded in the U.S. particle research community, QuarkNet leverages the nature of particle physics research—the long duration of the experiments with extensive lead times, construction periods, and data collection and analysis periods. QuarkNet is patterned after the large collaborations with a central management infrastructure and a distributed workload across university- and lab-based research groups. We describe the important benefits of the QuarkNet outreach program that flow to university faculty and present successful strategies that others can adapt for use in their countries.

Design and Analysis of a Forging Die for Manufacturing of Multiple Connecting Rods

Science.gov (United States)

Megharaj, C. E.; Nagaraj, P. M.; Jeelan Pasha, K.

2016-09-01

This paper demonstrates to utilize the hammer capacity by modifying the die design such that forging hammer can manufacture more than one connecting rod in a given forging cycle time. To modify the die design study is carried out to understand the parameters that are required for forging die design. By considering these parameters, forging die is designed using design modelling tool solid edge. This new design now can produce two connecting rods in same capacity hammer. The new design is required to validate by verifying complete filing of metal in die cavities without any defects in it. To verify this, analysis tool DEFORM 3D is used in this project. Before start of validation process it is require to convert 3D generated models in to. STL file format to import the models into the analysis tool DEFORM 3D. After importing these designs they are analysed for material flow into the cavities and energy required to produce two connecting rods in new forging die design. It is found that the forging die design is proper without any defects and also energy graph shows that the forging energy required to produce two connecting rods is within the limit of that hammer capacity. Implementation of this project increases the production of connecting rods by 200% in less than previous cycle time.

Protein (Cyanobacteria): 648410610 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available WP_026102361.1 NZ_KB235920 1117:21745 ... 52604:1915 ... 44474:816 118161:1544 ... hydrogenase nickel incorpora...tion protein HypA Pleurocapsa sp. PCC 7319 MHETDMTKALILTMKDWYVSQPEQRKIEKVHLIVGQFTCV

Development and efficiency assessment of process lubrication for hot forging

Science.gov (United States)

Kargin, S.; Artyukh, Viktor; Ignatovich, I.; Dikareva, Varvara

2017-10-01

The article considers innovative technologies in testing and production of process lubricants for hot bulk forging. There were developed new compositions of eco-friendly water-graphite process lubricants for hot extrusion and forging. New approaches to efficiency assessment of process lubricants are developed and described in the following article. Laboratory and field results are presented.

Development of strategies for saving energy by temperature reduction in warm forging processes

Science.gov (United States)

Varela, Sonia; Santos, Maite; Vadillo, Leire; Idoyaga, Zuriñe; Valbuena, Óscar

2016-10-01

This paper is associated to the European policy of increasing efficiency in raw material and energy usage. This policy becomes even more important in sectors consuming high amount of resources, like hot forging industry, where material costs sums up to 50% of component price and energy ones are continuously raising. The warm forging shows a clear potential of raw material reduction (near-net-shape components) and also of energy saving (forging temperature under 1000°C). However and due to the increment of the energy costs, new solutions are required by the forging sector in order to reduce the temperature below 900°C. The reported research is based on several approaches to reduce the forging temperature applied to a flanged shaft of the automotive sector as demonstration case. The developed investigations have included several aspects: raw material, process parameters, tools and dies behavior during forging process and also metallographic evaluation of the forged parts. This paper summarizes analysis of the ductility and the admissible forces of the flanged shaft material Ck45 in as-supplied state (as-rolled) and also in two additional heat treated states. Hot compression and tensile tests using a GLEEBLE 3800C Thermo mechanical simulator have been performed pursuing this target. In the same way, a coupled numerical model based on Finite Element Method (FEM) has been developed to predict the material flow, the forging loads and the stresses on the tools at lower temperature with the new heat treatments of the raw material. In order to validate the previous development, experimental trials at 850 °C and 750 °C were carried out in a mechanical press and the results were very promising.

Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

International Nuclear Information System (INIS)

L-Cancelos, R.; Varas, F.; Viéitez, I.; Martín, E.

2016-01-01

Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved. (paper)

Analysis of the thermo-mechanical deformations in a hot forging tool by numerical simulation

Science.gov (United States)

L-Cancelos, R.; Varas, F.; Martín, E.; Viéitez, I.

2016-03-01

Although programs have been developed for the design of tools for hot forging, its design is still largely based on the experience of the tool maker. This obliges to build some test matrices and correct their errors to minimize distortions in the forged piece. This phase prior to mass production consumes time and material resources, which makes the final product more expensive. The forging tools are usually constituted by various parts made of different grades of steel, which in turn have different mechanical properties and therefore suffer different degrees of strain. Furthermore, the tools used in the hot forging are exposed to a thermal field that also induces strain or stress based on the degree of confinement of the piece. Therefore, the mechanical behaviour of the assembly is determined by the contact between the different pieces. The numerical simulation allows to analyse different configurations and anticipate possible defects before tool making, thus, reducing the costs of this preliminary phase. In order to improve the dimensional quality of the manufactured parts, the work presented here focuses on the application of a numerical model to a hot forging manufacturing process in order to predict the areas of the forging die subjected to large deformations. The thermo-mechanical model developed and implemented with free software (Code-Aster) includes the strains of thermal origin, strains during forge impact and contact effects. The numerical results are validated with experimental measurements in a tooling set that produces forged crankshafts for the automotive industry. The numerical results show good agreement with the experimental tests. Thereby, a very useful tool for the design of tooling sets for hot forging is achieved.

The structural and phase state formed in construction titanium alloy by radial forging

Energy Technology Data Exchange (ETDEWEB)

Shlyakhova, Galina V.; Danilov, Vladimir I.; Orlova, Dina V.; Zuev, Lev B. [Institute of Strength Physics and Materials Science SB RAS, Tomsk (Russian Federation); Zavodchikov, Aleksandr S. [Perm State Technical University, Perm (Russian Federation)

2011-07-01

The feasibility of rod manufacture from construction titanium alloy using radial forging on a high duty machine SXK16 was investigated. The investigations were carried on for titanium rod samples using the methods of metallography, electron transmission microscophy and X-ray analysis. The results obtained are described herein. It is found that radial forging results in the formation of homogeneous fine-grained structure.Using radial forging process, high-quality items are produced. As-worked material has submicrocrystalline globular structure and an optimal α:β phase ratio. Besides, the technology is more cost-effective relative to conventional flow charts. Key words: forging, titanium alloy, fine-grain structure, substructure, pore size.

75 FR 71536 - Airworthiness Directives; SOCATA Model TBM 700 Airplanes

Science.gov (United States)

2010-11-24

... of this material at the FAA, call 816-329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado... Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri...

Controlled austempering of hammer forgings aimed at pseudo normalized microstructure directly after deformation

Directory of Open Access Journals (Sweden)

P. Skubisz

2017-01-01

Full Text Available The study concerns cost-effective realization of controlled thermomechanical processing (CTMP of medium-carbon and HSLA steel aimed at producing microstructure and properties equivalent to normalized condition directly after forging. The results of theoretical and physical modeling of hot forging with subsequent heat treating adopted for industrial realization in continuous manner were verified in semi-industrial conditions of a forge plant.

Research on Energy-Saving Production Scheduling Based on a Clustering Algorithm for a Forging Enterprise

Directory of Open Access Journals (Sweden)

Yifei Tong

2016-02-01

Full Text Available Energy efficiency is a buzzword of the 21st century. With the ever growing need for energy efficient and low-carbon production, it is a big challenge for high energy-consumption enterprises to reduce their energy consumption. To this aim, a forging enterprise, DVR (the abbreviation of a forging enterprise, is researched. Firstly, an investigation into the production processes of DVR is given as well as an analysis of forging production. Then, the energy-saving forging scheduling is decomposed into two sub-problems. One is for cutting and machining scheduling, which is similar to traditional machining scheduling. The other one is for forging and heat treatment scheduling. Thirdly, former forging production scheduling is presented and solved based on an improved genetic algorithm. Fourthly, the latter is discussed in detail, followed by proposed dynamic clustering and stacking combination optimization. The proposed stacking optimization requires making the gross weight of forgings as close to the maximum batch capacity as possible. The above research can help reduce the heating times, and increase furnace utilization with high energy efficiency and low carbon emissions.

Kick-off symposium series to help New Ph.D.s is a success

Science.gov (United States)

Chernys, Michael; Roughan, Moninya

The U.S. National Science Foundation (NSF) and the U.S. Office of Naval Research (ONR) recently sponsored the first of what is expected to be many symposia to be held every couple of years to help new scientists begin their research careers. The inaugural dissertation symposium, Physical Oceanography Dissertation Symposium I (PODS I), provided a forum for new Ph.D.s and doctoral candidates soon to receive their degrees in physical oceanography or a related field, to discuss science and forge future professional relationships. The next symposium is expected to be in October 2003, in Hawaii, in concert with the Dissertation Symposium for Chemical Oceanographers (DISCO); information to be posted at http://spars.aibs.org/pods/. Applications from prospective participants were sought internationally, with the sponsoring agencies and coordinators advertising by e-mail, through personal communication with established researchers, and by informing degree-granting institutions in the related fields.

Improvement of mechanical properties of zirconia-toughened alumina by sinter forging

NARCIS (Netherlands)

He, Y.; Winnubst, Aloysius J.A.; Verweij, H.; Burggraaf, Anthonie; Burggraaf, A.J.

1994-01-01

ZTA powder with a composition of 85 wt% alumina/15 wt% zirconia was prepared by a gel precipitation method. Sinter forging was performed with this powder to enhance the mechanical properties of ZTA materials. The influence of processing flaws on mechanical properties of sinter forged materials and

Comparative Thermal Aging Effects on PM-HIP and Forged Inconel 690

Science.gov (United States)

Bullens, Alexander L.; Bautista, Esteban; Jaye, Elizabeth H.; Vas, Nathaniel L.; Cain, Nathan B.; Mao, Keyou; Gandy, David W.; Wharry, Janelle P.

2018-03-01

This study compares thermal aging effects in Inconel 690 (IN690) produced by forging and powder metallurgy with hot isostatic pressing (PM-HIP). Isothermal aging is carried out over 400-800°C for up to 1000 h and then metallography and nanoindentation are utilized to relate grain microstructure with hardness and yield strength. The PM-HIP IN690 maintains a constant grain size through all aging conditions, while the forged IN690 exhibits limited grain growth at the highest aging temperature and longest aging time. The PM-HIP IN690 exhibits comparable mechanical integrity as the forged material throughout aging: hardness and yield strength are unchanged with 100 h aging, but increase after 1000 h aging at all temperatures. In both the PM-HIP and forged IN690, the Hall-Petch relationship for Ni-based superalloys predicts yield strength for 0-100 h aged specimens, but underestimates yield strength in the 1000 h aged specimens because of thermally induced precipitation.

76 FR 4216 - Airworthiness Directives; SOCATA Model TBM 700 Airplanes

Science.gov (United States)

2011-01-25

..., call 816-329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small... found in 14 CFR 39.19. Send information to Attn: Albert Mercado, Aerospace Engineer, FAA, Small Airplane...

Forging a nation. A celebration of Australia's mineral and energy sector

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-03-01

More than 150 years since Australia's first gold strike and over 200 years since coal mining first began, this publication showcases the vital importance of this industry to Australia. It looks at key issues facing the sector such as energy market reform and sustainability and analyses key commodities such as oil and gas, coal, iron ore, gold, gemstones along newly emerging materials such as mineral sands and magnesium.

Manufacturing and properties of closure head forging integrated with flange for PWR reactor pressure vessel

International Nuclear Information System (INIS)

Tomoharu Sasaki; Iku Kurihara; Etsuo Murai; Yasuhiko Tanaka; Koumei Suzuki

2003-01-01

Closure head forging (SA508, Gr.3 Cl.1) integrated with flange for PWR reactor pressure vessel has been developed. This is intended to enhance structural integrity of closure head resulted in elimination of ISI, by eliminating weld joint between closure head and flange in the conventional design. Manufacturing procedures have been established so that homogeneity and isotropy of the material properties can be assured in the closure head forging integrated with flange. Acceptance tensile and impact test specimens are taken and tested regarding the closure head forging integrated with flange as very thick and complex forgings. This paper describes the manufacturing technologies and material properties of the closure head forging integrated with flange. (orig.)

Historical “Truth,” Constructed Memory: Restaging Germany’s Reunification in Thomas Berger’s Television Melodrama Wir sind das Volk. Liebe kennt keine Grenzen (We are the people. Love without limits (2008

Directory of Open Access Journals (Sweden)

Katrin B Mascha

2012-04-01

Full Text Available Film and television are popular media for the (representation of history and the depiction of momentous past events. Germany’s reunification is no exception. After the fall of the Berlin Wall, Germany has witnessed a proliferation of media production that endeavors to historicize and aestheticize the past. This coincides with the need to forge a post-Wall identity of the new Germany. My discussion of Thomas Berger’s award winning television drama Wir sind das Volk. Liebe kennt keine Grenzen (2008 examines how reunification is presented in a mixture of fictitious elements and authentic historical reconstruction based on shared memories of this past. Following a melodramatic trajectory, the film aims at the reconciliation of German society as a people twenty years after reunification.

Lovastatin reduces neuronal cell death in hippocampal CA1 subfield after pilocarpine-induced status epilepticus: preliminary results Lovastatina reduz a lesão celular na região CA1 do hipocampo após o status epilepticus induzido pela pilocarpina: resultados preliminares

Directory of Open Access Journals (Sweden)

Pauline Rangel

2005-12-01

Full Text Available OBJECTIVE: To further characterize the capacity of lovastatin to prevent hippocampal neuronal loss after pilocarpine-induced status epilepticus (SE METHOD: Adult male Wistar rats were divided into four groups: (A control rats, received neither pilocarpine nor lovastatin (n=5; (B control rats, received just lovastatin (n=5; (C rats that received just pilocarpine (n=5; (D rats that received pilocarpine and lovastatin (n=5. After pilocarpine injection (350mg/kg, i.p., only rats that displayed continuous, convulsive seizure activity were included in our study. Seizure activity was monitored behaviorally and terminated with an injection of diazepam (10 mg/kg, i.p. after 4 h of convulsive SE. The rats treated with lovastatin received two doses of 20mg/kg via an oesophagic probe immediately and 24 hours after SE induction. Seven days after pilocarpine-induced SE, all the animals were perfused and their brains were processed for histological analysis through Nissl method. RESULTS: The cell counts in the Nissl-stained sections performed within the hippocampal formation showed a significant cell loss in rats that received pilocarpine and presented SE (CA1= 26.8 ± 13.67; CA3= 38.1 ± 7.2; hilus= 43.8 ± 3.95 when compared with control group animals (Group A: CA1= 53.2 ± 9.63; CA3= 63.5 ± 13.35; hilus= 59.08 ± 10.24; Group B: CA1= 74.3 ± 8.16; CA3= 70.1 ± 3.83; hilus= 70.6 ± 5.10. The average neuronal cell number of CA1 subfield of rats that present SE and received lovastatin (44.4 ± 17.88 was statically significant increased when compared with animals that just presented SE. CONCLUSION: Lovastatin exert a neuroprotective role in the attenuation of brain damage after SE.OBJETIVO: Capacidade da lovastatina em prevenir a perda de neurônios hipocampais após o status epilepticus (SE induzido pela pilocarpina. MÉTODO: Ratos adultos Wistar foram divididos em 4 grupos: (A ratos controles que não receberam pilocarpina nem lovastatina (n=5; (B ratos

Fatigue in cold-forging dies: Tool life analysis

DEFF Research Database (Denmark)

Skov-Hansen, P.; Bay, Niels; Grønbæk, J.

1999-01-01

In the present investigation it is shown how the tool life of heavily loaded cold-forging dies can be predicted. Low-cycle fatigue and fatigue crack growth testing of the tool materials are used in combination with finite element modelling to obtain predictions of tool lives. In the models...... the number of forming cycles is calculated first to crack initiation and then during crack growth to fatal failure. An investigation of a critical die insert in an industrial cold-forging tool as regards the influence of notch radius, the amount and method of pre-stressing and the selected tool material...

Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

Energy Technology Data Exchange (ETDEWEB)

Wojtaszek, Marek, E-mail: mwojtasz@metal.agh.edu.pl; Śleboda, Tomasz

2014-12-05

Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography.

Effect of forging process on microstructure, mechanical and corrosion properties of biodegradable Mg-1Ca alloy

International Nuclear Information System (INIS)

Harandi, Shervin Eslami; Hasbullah Idris, Mohd; Jafari, Hassan

2011-01-01

Research highlights: → Forging temperature demonstrates more pronounced effect compared to forging speed. → Precipitation of Mg 2 Ca phase at grain boundaries accelerates corrosion rate. → Forging process doesn't provide the corrosion resistance required for bone healing. -- Abstract: The performance of Mg-1Ca alloy, a biodegradable metallic material, may be improved by hot working in order that it may be of use in bone implant applications. In this study, Mg-1Ca cast alloy was preheated to different temperatures before undergoing forging process with various forging speeds. Macro- and microstructure of the samples were examined by stereo and scanning electron microscopes (SEM) equipped with energy dispersive X-ray spectroscopy (EDS), respectively. To determine the mechanical properties of the alloy, hardness value and plastic deformation ability of the samples were measured. To investigate the corrosion behaviour of the alloy, immersion and electrochemical tests were performed on the samples in simulated body fluid and the corrosion products were characterized by SEM/EDS. The results showed that increasing forging temperature decreased grain size led to improved hardness value and plastic deformation ability of the alloy, whereas no significant effect was observed by changing forging speed. Moreover, forging at higher temperatures led to an increase in the amount of Mg 2 Ca phase at grain boundaries resulted in higher corrosion rates. It can be concluded that although forging process improved the mechanical properties of the alloy, it does not satisfy the corrosion resistance criteria required for bone healing.

Design and verification of thermomechanical parameters of P/M Ti6Al4V alloy forging

International Nuclear Information System (INIS)

Wojtaszek, Marek; Śleboda, Tomasz

2014-01-01

Highlights: • Thermomechanical parameters of P/M Ti6Al4V alloy processing were determined. • The use of the mixture of elemental powders allows reducing manufacturing costs. • Numerical modelling allowed to elaborate favourable parameters of forging. • The industrial trials of hot forging of P/M Ti6Al4V alloy were successful. - Abstract: This work is focused on the design of technology of forging high-quality Ti6Al4V alloy by means of powder metallurgy methods. A mixture of elemental powders, with the chemical composition of that of Ti6Al4V alloy, was used as a starting material for the investigation. Powder mixtures were fully densified by hot compaction under precisely controlled conditions. The mechanical properties of the obtained compacts were examined. The mechanical behaviour of the investigated alloy powder compacts was evaluated by compression test under various thermomechanical conditions using Gleeble simulator. The microstructure of powder compacts as well as P/M alloy samples deformed in compression tests was examined. All data obtained from the experimental tests were applied as boundary conditions for numerical simulation of forging of selected forgings. Basing on the results of both plastometric tests and simulations, thermomechanical parameters of the investigated alloy forging were determined. Designed parameters of forging technology were verified by forging trials performed in industrial conditions. The quality of the obtained forgings was examined by means of computed tomography

Manufacturing of large and integral-type steel forgings for nuclear steam supply system components

International Nuclear Information System (INIS)

Kawaguchi, S.; Tsukada, H.; Suzuki, K.; Sato, I.; Onodera, S.

1986-01-01

Forgings for the reactor pressure vessel (RPV) of the pressurized heavy water reactor (PHWR) 700 MWe, which is composed of seven major parts and nozzles totaling about 965 tons, were successfully developed. These forgings are: 1. Flanges: an outside diameter of 8440 mm and a weight of 238 tons max, requiring an ingot of 570 tons. 2. Shells and torus: an outside diameter of about 8000 mm with large height. 3. Cover dome: a diameter of 6800 mm and a thickness of 460 mm, requiring a blank forging before forming of 8000 mm in diameter and 550 m thick. The material designation is 20Mn-Mo-Ni 5 5 (equivalent to SA508, Class 3). In this paper, the manufacturing of and the properties of such large and integral forgings are discussed, including an overview of manufacturing processes for ultralarge-sized forgings over the last two decades

New design of process for cold forging to improve multi-stage gas fitting

Directory of Open Access Journals (Sweden)

Han-Sung Huang

2016-04-01

Full Text Available This work develops a process that solves the problem of the formation of cracks inside forged gas fittings in the cold forging process that arises from poor forging process design. DEFORM-3D forming software was utilized, and macroscopic experiments with optical microscopy and scanning electron microscopy were conducted to investigate the processed structures and the distribution therein of metal flow lines, and to find the internal micro-cracks to determine whether the cold forging process is reasonable. Analytical results herein demonstrate that the stress and strain inside the gas fitting can be elucidated using metal forming software. Together with experimental results, they demonstrate that a concentration of stress damages the workpiece in the forming process. Moreover, as metal flow lines become narrower, the workpiece becomes more easily damaged. Consequently, the improved cold forging process that is described in this work should be utilized to reduce the occurrence of fine cracks and defects. Planning for proper die design and production, increasing the quality of products, and reducing the number of defective products promote industrial competitiveness.

Hyperfractionated radiaton therapy and bis-chlorethyl nitrosourea in the treatment of malignant glioma - possible advantage observed at 72.0 Gy in 1.2 Gy B.I.D. fractions: Report of the radiation therapy oncology group protocol 8302

International Nuclear Information System (INIS)

Nelson, D.F.; Curran, W.J.; Powlis, W.D.; Scott, C.; Nelson, J.S.; Weinstein, A.S.; Ahmad, K.; Constine, L.S.; Murray, K.; Mohiuddin, M.; Fischbach, J.

1993-01-01

Between January 1983 and November 1987, the Radiation Therapy Oncology Group conducted a prospective, randomized, multi-institutional, dose searching Phase I/II trial to evaluate hyperfractionated radiation therapy in the treatment of supratentorial malignant glioma. Patients with anaplastic astrocytoma, or glioblastoma multiforme, age 18-70 years with a Karnofsky performance status of 40-100 were stratified according to age, Karnofsky performance status, and histology, and were randomized. Initially randomization was to one of three arms: 64.8 Gy, 72.0 Gy, and 76.8 Gy. Fractions of 1.2 Gy were given twice daily, 5 days per week, with intervals of 4 to 8 hr. All patients received bis-chlorethyl nitrosourea (BCNU) 80 mg/m2 on days 3, 4, 5 of radiation therapy and then every 8 weeks for 1 year. After acceptable rates of acute and late effects were found, the randomization was changed to 81.6 Gy and 72.0 Gy with a weighting of 2:1. Out of 466 patients randomized, 435 were analyzed. The distribution of prognostic factors was comparable among the 76.8 Gy arm, 81.6 Gy arm, and the final randomization of the 72 Gy arm. The 64.8 Gy arm and the initial randomization of the 72 Gy arm had somewhat worse prognostic variables. Late radiation toxicity occurred in 1.3-6.8% of the patients, with a modest increase with increasing radiation dose. The best survival occurred in those patients treated with 72 Gy. The Cox proportional hazards model confirmed the prognostic variables of age, histology and Karnofsky performance status. In addition, the longer interval of 4.5-8 hr was associated with a worse prognosis than the 4-4.4 hr interval. The difference in survival between the 81.6 Gy arm and the lower three arms approached significance with inferior survival observed in the 81.6 Gy arm. 72 Gy delivered by 1.2 Gy twice daily is no more toxic than 60 Gy delivered conventionally. 26 refs., 6 figs., 7 tabs

Managing Tensions And Forging Creative Synergies Between ...

African Journals Online (AJOL)

Managing Tensions And Forging Creative Synergies Between Indigenous And Modern Settlement Planning Concepts And Practices: Lessons For The Design And Planning For Sustainable Settlements And Built-Forms In Southern Africa.

Diferencias en comportamientos prosociales entre adolescentes colombianos

Directory of Open Access Journals (Sweden)

Jesús Redondo Pacheco

2015-07-01

Full Text Available Actualmente, se evidencia la influencia de variables socio-ambientales, como la cultura, el sexo, la edad o la nacionalidad, en la adquisición, desarrollo y mantenimiento de las conductas prosociales. El objetivo de este estudio fue analizar las diferencias en conductas prosociales entre estudiantes de educación secundaria de las ciudades de Pasto y Bucaramanga (Colombia, a quienes se administró la escala de Conducta Prosocial del TeenageInventory of Social Skills (TISS.Participaron 2.694 estudiantes con edades comprendidas entre 11 y 17 años (1878 de Pasto y 816 de Bucaramanga. De acuerdo con los resultados,los adolescentes de la ciudad de Pasto presentaron niveles significativamente más altos de conducta prosocial que los adolescentes de Bucaramanga. Este patrón de resultados fue similar por género y edad. Abstract This paper focuses on the analysis of pro-social behavior in high school students from Pasto and Bucaramanga (Colombia. 2,694 students between 11 and 17 years old (1878 from Pasto y 816 from Bucaramanga were sampled and a Pro-social Behavior Scale of Teenage Inventory of Social Skills (TISS was administered. As a result, this research shows teenagers from Pasto showed higher levels of pro-social behavior than those from Bucaramanga. Socio-environmental variables, such as culture, sex, age or nationality influence students´ pro-social behavior development and maintenance.

Obtenção de nova fonte de peroxidase de folha de Copaifera langsdorffii Desf. com alta atividade Obtention of a new source of peroxidase from Copaifera langsdorffii leaf, Desf. with high activity

Directory of Open Access Journals (Sweden)

Hermelinda Penha Freire Maciel

2006-12-01

Full Text Available Objetivou-se neste trabalho extrair peroxidase de folha de Copaifera langsdorffii (COP, medir sua atividade, compará-la com a peroxidase de raiz forte (Horseradish peroxidase - HRP e determinar o pH ótimo, a melhor solução extratora e o efeito de aditivos sobre a atividade da COP. Os resultados mostraram que a COP atingiu 81,6% da atividade de HRP e a faixa de pH ótimo foi de 5,5 a 6,0. A melhor solução extratora da enzima foi o tampão fosfato de sódio 50 mM, pH 6,0 e o melhor aditivo foi o PVPP. Concluindo, a COP apresenta atividade mais alta que outras peroxidases de diferentes fontes citadas na literatura.The purpose of this work was to extract peroxidase from Copaifera langsdorffii leaves (COP, measure its activity, compare it to that of Horseradish peroxidase and determine the optimum pH, the best extraction solution and the effect of additives on the COP activity. The results showed that COP has 81.6% of the activity of HRP and an optimum pH range between 5.5-6.0. The best extraction solution was a sodium phosphate buffer 50 mM, pH 6.0 and the best additive was PVPP. In conclusion, COP presents higher activity than peroxidases from different sources reported in the literature.

A Qualitative Interpretation of Residual Magnetic Anomaly using ...

African Journals Online (AJOL)

A Qualitative Interpretation of Residual Magnetic Anomaly using Ground ... The magnetic data was collected using a G816 proton precision magnetometer. ... Analysis of residual anomaly graph reveals the existence of some structural features ...

Distribution of Microstructure and Vickers Hardness in Spur Bevel Gear Formed by Cold Rotary Forging

Directory of Open Access Journals (Sweden)

Wuhao Zhuang

2014-11-01

Full Text Available Cold rotary forging is a novel metal forming technology which is widely used to produce the high performance gears. Investigating the microstructure and mechanical property of cold rotary forged gears has a great significance in improving their service performance. In this study, the grain morphology in different regions of the spur bevel gear which is processed by cold rotary forging is presented. And the distribution regulars of the grain deformation and Vickers hardness in the transverse and axial sections of the gear tooth are studied experimentally. A three-dimensional rigid-plastic FE model is developed to simulate the cold rotary forging process of a spur bevel gear under the DEFORM-3D software environment. The variation of effective strain in the spur bevel gear has been investigated so as to explain the distribution regulars of the microstructure and Vickers hardness. The results of this research thoroughly reveal the inhomogeneous deformation mechanisms in cold rotary forging of spur bevel gears and provide valuable guidelines for improving the performance of cold rotary forged spur bevel gears.

Bottom-up construction of a superstructure in a porous uranium-organic crystal

Energy Technology Data Exchange (ETDEWEB)

Li, Peng; Vermeulen, Nicolaas A.; Malliakas, Christos D.; G?mez-Gualdr?n, Diego A.; Howarth, Ashlee J.; Mehdi, B. Layla; Dohnalkova, Alice; Browning, Nigel D.; O?Keeffe, Michael; Farha, Omar K.

2017-04-20

Bottom-up construction of highly intricate structures from simple building blocks remains one of the most difficult challenges in chemistry. We report a structurally complex, mesoporous uranium-based metal-organic framework (MOF) made from simple starting components. The structure comprises 10 uranium nodes and seven tricarboxylate ligands (both crystallographically nonequivalent), resulting in a 173.3-angstrom cubic unit cell enclosing 816 uranium nodes and 816 organic linkers—the largest unit cell found to date for any nonbiological material. The cuboctahedra organize into pentagonal and hexagonal prismatic secondary structures, which then form tetrahedral and diamond quaternary topologies with unprecedented complexity. This packing results in the formation of colossal icosidodecahedral and rectified hexakaidecahedral cavities with internal diameters of 5.0 nanometers and 6.2 nanometers, respectively—ultimately giving rise to the lowest-density MOF reported to date.

76 FR 30200 - Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of...

Science.gov (United States)

2011-05-24

...] Forging Machines; Extension of the Office of Management and Budget's (OMB) Approval of Information... extend OMB approval of the information collection requirements contained in the Forging Machines Standard... to reduce employees' risk of death or serious injury by ensuring that forging machines used by them...

Effect of Forging Allowance Value on the Power Consumption of Machining Process

Directory of Open Access Journals (Sweden)

L. D. Mal'kova

2015-01-01

Full Text Available The paper aim is to develop and study possible energy-efficiency measures for machined forgings drawing on analysis of the impact of the allowance for machining and its scatter.The most sophisticated option to take into consideration the effect of the cut depth is the work-piece machining in which the forging allowance value results from the blank production.Research of power consumption was conducted for turning the cylindrical surface of 144 mm length and  1,5 33 0,5   diameter on forgings of the work-pieces "screw of steering control" made from steel 60PP. A radial dimension allowance at said cylindrical surface at six points of the five sections was sized to assess the allowance value dispersion. The size of the sample measurements at the control points was n = 600. Statistic processing has shown normal law of distribution and sample homogeneity.To analyze the results of experiments was calculated a range of allowances for this workpiece. Calculated minimum and maximum allowance per one side for rough lathing were, respectively, 0.905 mm and 1.905mm. It was found that 77% points under control lie in calculated range of allowance values. And there are no points out of the range on lesser side that proves a lack of rejects; but there are points out of the range on the bigger side, that will require additional costs for machining the specified surface, including the cost of electricity.There were three power consumption calculations based on factory- recommended duty: for processing the entire sample of forgings with an average allowance, for machining forgings allowances of which are within the recommended design range of allowance, and for processing the entire sample of forgings with a minimum value of allowance.It was found that elimination of allowance values which are outside the recommended range enables to reduce the power consumption, at least, by 6%, and the overall power consumption for processing the measured forgings

Download

African Journals Online (AJOL)

USER

2015-10-16

Oct 16, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(Suppl. 1): 816 ... to climate change in Ondo State, Nigeria was investigated. .... migration, farming has been left to the very old. ..... Indonesia, for Global Warming.

50 CFR 665.816 - American Samoa longline limited entry program.

Science.gov (United States)

2010-10-01

..., provided that the person or business provided to NMFS or the Council, prior to March 22, 2002, a written... may be transferred (by sale, gift, bequest, intestate succession, barter, or trade) to the following... transferred (by sale, gift, bequest, intestate succession, barter, or trade) to the following persons only: (i...

30 CFR 816.71 - Disposal of excess spoil: General requirements.

Science.gov (United States)

2010-07-01

... does not slake in water or degrade to soil material, and which is free of coal, clay or other... of the soil. (2) Excess spoil shall be transported and placed in a controlled manner in horizontal... outslope of the fill if required for stability, control of erosion, to conserve soil moisture, or to...

Computer Οptimization of Geometric Form of Tool and Preform for Closed-die Forging of Compressor Blade Simulator

Directory of Open Access Journals (Sweden)

A. V. Botkin

2014-07-01

Full Text Available Using the software package DEFORM 3D when developing technology of isothermal forging workpiece blades it is possible to reduce the pre-production time, to improve the quality of forgings and increase lifetime of forging dies. Computer modeling allows to predict the formation of such defects during forging as notches and wrinkles, underfilling of die impression, to estimate tool loads. Preform shape and angular position of the blade simulator were optimized in order to minimize the lateral forces generated during the forging operation.

Manufacture of large monoblock LP rotor forgings and their quality

International Nuclear Information System (INIS)

Suzuki, Akira; Kinoshita, Shushi; Kohno, Masayoshi; Miyakawa, Mutsuhiro; Kikuchi, Hideo

1986-01-01

This paper describes the manufacturing and the quality of large monoblock low pressure rotors forged from 360 ton and 420 ton ingots. To obtain good and homogenous mechanical properties throughout a rotor, a computer was used to determine the heat treatment conditions. It was found that the technique was very effective at predicting mechanical properties of a monoblock rotor. Mechanical properties including the fracture toughness and fatigue crack propagation characteristics of monoblock rotor forgings proved satisfactory. (author)

Identification of forged Bank of England £20 banknotes using IR spectroscopy.

Science.gov (United States)

Sonnex, Emily; Almond, Matthew J; Baum, John V; Bond, John W

2014-01-24

Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm(-1) arising from νasym (CO3(2-)) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm(-1)), ν(C-H) (ca. 2900 cm(-1)) and ν(C=O) (ca. 1750 cm(-1)) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Copyright © 2013 Elsevier B.V. All rights reserved.

Identification of forged Bank of England £20 banknotes using IR spectroscopy

Science.gov (United States)

Sonnex, Emily; Almond, Matthew J.; Baum, John V.; Bond, John W.

2014-01-01

Bank of England notes of £20 denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. An aim of this work was to develop a non-destructive method so that a small, compact Fourier transform infrared spectrometer (FT-IR) instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 cm-1 arising from νasym (CO32-) from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine £20 notes were observed in the ν(OH) (ca. 3500 cm-1), ν(Csbnd H) (ca. 2900 cm-1) and ν(Cdbnd O) (ca. 1750 cm-1) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper.

The Utopian Promise: John Akomfrah’s Poetics of the Archive

Directory of Open Access Journals (Sweden)

Dara Waldron

2017-02-01

Full Text Available John Akomfrah’s 'Handsworth Songs' (1986 and 'The Stuart Hall Project' (2012 bookend the British filmmaker’s career in a uniquely political sense. Both are implicitly concerned with the film archive, with the potential it accorded for poetic and political ends. Stuart Hall famously responded to the criticism of 'Handsworth Songs' by Salman Rushdie at the time of the film’s release, championing the Black Audio Film Collective, which Akomfrah was a founding member of, in their attempts to forge a new cinematic language to represent post-migrant minorities. Akomfrah’s method, in both films, is interesting in this regard; using archival footage, it constructs a collage-based film used to challenge hegemonic constructions of sound and image with regard to political representation in film. This article addresses this method. It takes the ‘utopian promise’, which Akomfrah associates with the archive, as a starting point to explore the theoretical alignment between the archival image and the future. As a result, the article pushes against responses to Akomfrah films that have sought to situate their content as exclusively concerned with issues of political representation in the present, exploring an Akomfrah poetics that comes out of a utopian tradition of thought concerned with thinking about the future; or at least, the possibilities of the future.

Intersubjective decision-making for computer-aided forging technology design

Science.gov (United States)

Kanyukov, S. I.; Konovalov, A. V.; Muizemnek, O. Yu.

2017-12-01

We propose a concept of intersubjective decision-making for problems of open-die forging technology design. The intersubjective decisions are chosen from a set of feasible decisions using the fundamentals of the decision-making theory in fuzzy environment according to the Bellman-Zadeh scheme. We consider the formalization of subjective goals and the choice of membership functions for the decisions depending on subjective goals. We study the arrangement of these functions into an intersubjective membership function. The function is constructed for a resulting decision, which is chosen from a set of feasible decisions. The choice of the final intersubjective decision is discussed. All the issues are exemplified by a specific technological problem. The considered concept of solving technological problems under conditions of fuzzy goals allows one to choose the most efficient decisions from a set of feasible ones. These decisions correspond to the stated goals. The concept allows one to reduce human participation in automated design. This concept can be used to develop algorithms and design programs for forging numerous types of forged parts.

The relationship between UT reported size and actual size of the defects in rotor forgings

International Nuclear Information System (INIS)

Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

2003-01-01

In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some differences between the reported size with the ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

The relationship between UT reported size and actual size of the defects in rotor forgings

International Nuclear Information System (INIS)

Seong, Un Hak; Kim, Jeong Tae; Park, Yun Sik

2003-01-01

In order to evaluate the reliability of rotor forgings, it is very important to know the actual size of the defects in the rotor forgings. The determination of the defect size requires the accurate non-destructive measurement. However, there may be some difference between the reported size with ultrasonic non-destructive testing method and the actual size of defects. These differences may be a severe cause of errors in evaluation of rotor forgings. So, the calculated size with 'Master Curve' considering safety factor, which is usually larger than the reported size, has been used in evaluation of rotor forgings. The relation between the EFBH (Equivalent Flat Bottom Hole) size measured by non-destructive method and the actual size by destructive method in many rotors manufactured at Doosan was investigated. In this investigation, 'Master Curve' compensating the differences between UT reported size and actual size of defects in our rotor forgings was obtainable. The applicability of this 'Master Curve' as a way of calculating the actual defect size was also investigated. For the evaluation of rotor forgings, it is expected that this 'Master Curve' may be used to determine the accurate actual size of defects.

Fabrication and properties of Y-Ba-Cu-O high Tc superconductor by upset-forging method

International Nuclear Information System (INIS)

Chang, Ho Jung; Kang, Kae Myung; Song, Jin Tae

1990-01-01

YBa 2 Cu 3 O 7-x oxide superconductors was fabricated by sintering process and upset-forging method, respectively, and microstructures and conduction properties were compared. There was no difference in crystal structure the (001) x-ray reflection presumably due to preferred crystal orientation of the YBa 2 Cu 3 O 7-x superconductor. Furthermore, the grain size of the 123-phase increased as the reduction ratio became larger during the upset-forging. The critical temperature for zero resistivity of both samples was almost the same, i.e., about 90K. These results have demonstrated the potential of producing YBa 2 Cu 3 O 7-x superconducting wire or tape effectively using a upset-forging method. The critical current density of the upset-forged sample, however, was lower than that of the sintered one, which fact might be ascribed to microcrack formation during fast upset-forging. (Author)

Henry Moore’s Public Sculpture in the US: The Collaborations with I. M. Pei

Directory of Open Access Journals (Sweden)

Alex Potts

2016-07-01

Full Text Available The many commissions Henry Moore received for public sculpture in the United States provided the occasion for several quite distinctive works. While not site specific, these were unique, and their final form, scale, and disposition was elaborated with a particular setting in mind. This aspect of Moore’s work in the US, which began with the monumental piece he designed for the Lincoln Center in New York in 1963–65, is examined here by focusing on the productive relationship he forged with the architect I. M. Pei in the 1970s. The sculptures Moore produced in collaboration with Pei respond in suggestive ways to the spatial environments created in American cities by late modern architectural developments. They also realize an oddly effective combination of the biomorphic and abstract that differs both from the bodily conception of Moore’s earlier work and the non-figurative character of much public sculpture of the time.

Mareas rojas de Mesodinium rubrum (Lohmann) Hamburger y Buddenbrock en el Golfo de California (Invierno de 1998)

OpenAIRE

Gárate-Lizárraga, Ismael; Band-Schmidt, Christine; Cervantes-Duarte, Rafael; Escobedo-Urías, Diana

2002-01-01

Durante el invierno de 1998 se colectaron un total de 13 muestras de mareas rojas causadas por el protozoario fotosintético Mesodinium rubrum en el Golfo de California. El registro de temperatura del agua varió de 20.3 a 23.2°C. La salinidad, el oxígeno disuelto, el pH, y la concentración de nutrientes se determinaron sólo en los parches observados en las costas de Sinaloa. La salinidad varió entre 34.71 y 35.25. El oxígeno disuelto osciló entre 5.29 y 6.78 ml/l y el pH varió de 8.16 a 8.27. ...

Observation of Top Quark Production in Proton-Nucleus Collisions.

Science.gov (United States)

Sirunyan, A M; Tumasyan, A; Adam, W; Ambrogi, F; Asilar, E; Bergauer, T; Brandstetter, J; Brondolin, E; Dragicevic, M; Erö, J; Escalante Del Valle, A; Flechl, M; Friedl, M; Frühwirth, R; Ghete, V M; Grossmann, J; Hrubec, J; Jeitler, M; König, A; Krammer, N; Krätschmer, I; Liko, D; Madlener, T; Mikulec, I; Pree, E; Rad, N; Rohringer, H; Schieck, J; Schöfbeck, R; Spanring, M; Spitzbart, D; Waltenberger, W; Wittmann, J; Wulz, C-E; Zarucki, M; Chekhovsky, V; Mossolov, V; Suarez Gonzalez, J; De Wolf, E A; Di Croce, D; Janssen, X; Lauwers, J; Van De Klundert, M; Van Haevermaet, H; Van Mechelen, P; Van Remortel, N; Abu Zeid, S; Blekman, F; D'Hondt, J; De Bruyn, I; De Clercq, J; Deroover, K; Flouris, G; Lontkovskyi, D; Lowette, S; Marchesini, I; Moortgat, S; Moreels, L; Python, Q; Skovpen, K; Tavernier, S; Van Doninck, W; Van Mulders, P; Van Parijs, I; Beghin, D; Bilin, B; Brun, H; Clerbaux, B; De Lentdecker, G; Delannoy, H; Dorney, B; Fasanella, G; Favart, L; Goldouzian, R; Grebenyuk, A; Kalsi, A K; Lenzi, T; Luetic, J; Maerschalk, T; Marinov, A; Seva, T; Starling, E; Vander Velde, C; Vanlaer, P; Vannerom, D; Yonamine, R; Zenoni, F; Cornelis, T; Dobur, D; Fagot, A; Gul, M; Khvastunov, I; Poyraz, D; Roskas, C; Salva, S; Tytgat, M; Verbeke, W; Zaganidis, N; Bakhshiansohi, H; Bondu, O; Brochet, S; Bruno, G; Caputo, C; Caudron, A; David, P; De Visscher, S; Delaere, C; Delcourt, M; Francois, B; Giammanco, A; Komm, M; Krintiras, G; Lemaitre, V; Magitteri, A; Mertens, A; Musich, M; Piotrzkowski, K; Quertenmont, L; Saggio, A; Vidal Marono, M; Wertz, S; Zobec, J; Aldá Júnior, W L; Alves, F L; Alves, G A; Brito, L; Correa Martins Junior, M; Hensel, C; Moraes, A; Pol, M E; Rebello Teles, P; Belchior Batista Das Chagas, E; Carvalho, W; Chinellato, J; Coelho, E; Da Costa, E M; Da Silveira, G G; De Jesus Damiao, D; Fonseca De Souza, S; Huertas Guativa, L M; Malbouisson, H; Melo De Almeida, M; Mora Herrera, C; Mundim, L; Nogima, H; Sanchez Rosas, L J; Santoro, A; Sznajder, A; Thiel, M; Tonelli Manganote, E J; Torres Da Silva De Araujo, F; Vilela Pereira, A; Ahuja, S; Bernardes, C A; Tomei, T R Fernandez Perez; Gregores, E M; Mercadante, P G; Novaes, S F; Padula, Sandra S; Romero Abad, D; Ruiz Vargas, J C; Aleksandrov, A; Hadjiiska, R; Iaydjiev, P; Misheva, M; Rodozov, M; Shopova, M; Sultanov, G; Dimitrov, A; Litov, L; Pavlov, B; Petkov, P; Fang, W; Gao, X; Yuan, L; Ahmad, M; Bian, J G; Chen, G M; Chen, H S; Chen, M; Chen, Y; Jiang, C H; Leggat, D; Liao, H; Liu, Z; Romeo, F; Shaheen, S M; Spiezia, A; Tao, J; Wang, C; Wang, Z; Yazgan, E; Zhang, H; Zhang, S; Zhao, J; Ban, Y; Chen, G; Li, J; Li, Q; Liu, S; Mao, Y; Qian, S J; Wang, D; Xu, Z; Zhang, F; Wang, Y; Avila, C; Cabrera, A; Chaparro Sierra, L F; Florez, C; González Hernández, C F; Ruiz Alvarez, J D; Segura Delgado, M A; Courbon, B; Godinovic, N; Lelas, D; Puljak, I; Ribeiro Cipriano, P M; Sculac, T; Antunovic, Z; Kovac, M; Brigljevic, V; Ferencek, D; Kadija, K; Mesic, B; Starodumov, A; Susa, T; Ather, M W; Attikis, A; Mavromanolakis, G; Mousa, J; Nicolaou, C; Ptochos, F; Razis, P A; Rykaczewski, H; Finger, M; Finger, M; Carrera Jarrin, E; Assran, Y; Elgammal, S; Mahrous, A; Dewanjee, R K; Kadastik, M; Perrini, L; Raidal, M; Tiko, A; Veelken, C; Eerola, P; Kirschenmann, H; Pekkanen, J; Voutilainen, M; Havukainen, J; Heikkilä, J K; Järvinen, T; Karimäki, V; Kinnunen, R; Lampén, T; Lassila-Perini, K; Laurila, S; Lehti, S; Lindén, T; Luukka, P; Siikonen, H; Tuominen, E; Tuominiemi, J; Tuuva, T; Besancon, M; Couderc, F; Dejardin, M; Denegri, D; Faure, J L; Ferri, F; Ganjour, S; Ghosh, S; Gras, P; Hamel de Monchenault, G; Jarry, P; Kucher, I; Leloup, C; Locci, E; Machet, M; Malcles, J; Negro, G; Rander, J; Rosowsky, A; Sahin, M Ö; Titov, M; Abdulsalam, A; Amendola, C; Antropov, I; Baffioni, S; Beaudette, F; Busson, P; Cadamuro, L; Charlot, C; Granier de Cassagnac, R; Jo, M; Lisniak, S; Lobanov, A; Martin Blanco, J; Nguyen, M; Ochando, C; Ortona, G; Paganini, P; Pigard, P; Salerno, R; Sauvan, J B; Sirois, Y; Stahl Leiton, A G; Strebler, T; Yilmaz, Y; Zabi, A; Zghiche, A; Agram, J-L; Andrea, J; Bloch, D; Brom, J-M; Buttignol, M; Chabert, E C; Chanon, N; Collard, C; Conte, E; Coubez, X; Fontaine, J-C; Gelé, D; Goerlach, U; Jansová, M; Le Bihan, A-C; Tonon, N; Van Hove, P; Gadrat, S; Beauceron, S; Bernet, C; Boudoul, G; Chierici, R; Contardo, D; Depasse, P; El Mamouni, H; Fay, J; Finco, L; Gascon, S; Gouzevitch, M; Grenier, G; Ille, B; Lagarde, F; Laktineh, I B; Lethuillier, M; Mirabito, L; Pequegnot, A L; Perries, S; Popov, A; Sordini, V; Vander Donckt, M; Viret, S; Toriashvili, T; Bagaturia, I; Autermann, C; Feld, L; Kiesel, M K; Klein, K; Lipinski, M; Preuten, M; Schomakers, C; Schulz, J; Teroerde, M; Zhukov, V; Albert, A; Dietz-Laursonn, E; Duchardt, D; Endres, M; Erdmann, M; Erdweg, S; Esch, T; Fischer, R; Güth, A; Hamer, M; Hebbeker, T; Heidemann, C; Hoepfner, K; Knutzen, S; Merschmeyer, M; Meyer, A; Millet, P; Mukherjee, S; Pook, T; Radziej, M; Reithler, H; Rieger, M; Scheuch, F; Teyssier, D; Thüer, S; Flügge, G; Kargoll, B; Kress, T; Künsken, A; Müller, T; Nehrkorn, A; Nowack, A; Pistone, C; Pooth, O; Stahl, A; Aldaya Martin, M; Arndt, T; Asawatangtrakuldee, C; Beernaert, K; Behnke, O; Behrens, U; Bermúdez Martínez, A; Bin Anuar, A A; Borras, K; Botta, V; Campbell, A; Connor, P; Contreras-Campana, C; Costanza, F; Diez Pardos, C; Eckerlin, G; Eckstein, D; Eichhorn, T; Eren, E; Gallo, E; Garay Garcia, J; Geiser, A; Grados Luyando, J M; Grohsjean, A; Gunnellini, P; Guthoff, M; Harb, A; Hauk, J; Hempel, M; Jung, H; Kasemann, M; Keaveney, J; Kleinwort, C; Korol, I; Krücker, D; Lange, W; Lelek, A; Lenz, T; Leonard, J; Lipka, K; Lohmann, W; Mankel, R; Melzer-Pellmann, I-A; Meyer, A B; Mittag, G; Mnich, J; Mussgiller, A; Ntomari, E; Pitzl, D; Raspereza, A; Savitskyi, M; Saxena, P; Shevchenko, R; Stefaniuk, N; Van Onsem, G P; Walsh, R; Wen, Y; Wichmann, K; Wissing, C; Zenaiev, O; Aggleton, R; Bein, S; Blobel, V; Centis Vignali, M; Dreyer, T; Garutti, E; Gonzalez, D; Haller, J; Hinzmann, A; Hoffmann, M; Karavdina, A; Klanner, R; Kogler, R; Kovalchuk, N; Kurz, S; Lapsien, T; Marconi, D; Meyer, M; Niedziela, M; Nowatschin, D; Pantaleo, F; Peiffer, T; Perieanu, A; Scharf, C; Schleper, P; Schmidt, A; Schumann, S; Schwandt, J; Sonneveld, J; Stadie, H; Steinbrück, G; Stober, F M; Stöver, M; Tholen, H; Troendle, D; Usai, E; Vanhoefer, A; Vormwald, B; Akbiyik, M; Barth, C; Baselga, M; Baur, S; Butz, E; Caspart, R; Chwalek, T; Colombo, F; De Boer, W; Dierlamm, A; Faltermann, N; Freund, B; Friese, R; Giffels, M; Harrendorf, M A; Hartmann, F; Heindl, S M; Husemann, U; Kassel, F; Kudella, S; Mildner, H; Mozer, M U; Müller, Th; Plagge, M; Quast, G; Rabbertz, K; Schröder, M; Shvetsov, I; Sieber, G; Simonis, H J; Ulrich, R; Wayand, S; Weber, M; Weiler, T; Williamson, S; Wöhrmann, C; Wolf, R; Anagnostou, G; Daskalakis, G; Geralis, T; Kyriakis, A; Loukas, D; Topsis-Giotis, I; Karathanasis, G; Kesisoglou, S; Panagiotou, A; Saoulidou, N; Kousouris, K; Evangelou, I; Foudas, C; Gianneios, P; Katsoulis, P; Kokkas, P; Mallios, S; Manthos, N; Papadopoulos, I; Paradas, E; Strologas, J; Triantis, F A; Tsitsonis, D; Csanad, M; Filipovic, N; Pasztor, G; Surányi, O; Veres, G I; Bencze, G; Hajdu, C; Horvath, D; Hunyadi, Á; Sikler, F; Veszpremi, V; Beni, N; Czellar, S; Karancsi, J; Makovec, A; Molnar, J; Szillasi, Z; Bartók, M; Raics, P; Trocsanyi, Z L; Ujvari, B; Choudhury, S; Komaragiri, J R; Bahinipati, S; Bhowmik, S; Mal, P; Mandal, K; Nayak, A; Sahoo, D K; Sahoo, N; Swain, S K; Bansal, S; Beri, S B; Bhatnagar, V; Chawla, R; Dhingra, N; Kaur, A; Kaur, M; Kaur, S; Kumar, R; Kumari, P; Mehta, A; Singh, J B; Walia, G; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A; Chauhan, S; Choudhary, B C; Garg, R B; Keshri, S; Kumar, A; Malhotra, S; Naimuddin, M; Ranjan, K; Sharma, R; Bhardwaj, R; Bhattacharya, R; Bhattacharya, S; Bhawandeep, U; Dey, S; Dutt, S; Dutta, S; Ghosh, S; Majumdar, N; Modak, A; Mondal, K; Mukhopadhyay, S; Nandan, S; Purohit, A; Roy, A; Roy Chowdhury, S; Sarkar, S; Sharan, M; Thakur, S; Behera, P K; Chudasama, R; Dutta, D; Jha, V; Kumar, V; Mohanty, A K; Netrakanti, P K; Pant, L M; Shukla, P; Topkar, A; Aziz, T; Dugad, S; Mahakud, B; Mitra, S; Mohanty, G B; Sur, N; Sutar, B; Banerjee, S; Bhattacharya, S; Chatterjee, S; Das, P; Guchait, M; Jain, Sa; Kumar, S; Maity, M; Majumder, G; Mazumdar, K; Sarkar, T; Wickramage, N; Chauhan, S; Dube, S; Hegde, V; Kapoor, A; Kothekar, K; Pandey, S; Rane, A; Sharma, S; Chenarani, S; Eskandari Tadavani, E; Etesami, S M; Khakzad, M; Mohammadi Najafabadi, M; Naseri, M; Paktinat Mehdiabadi, S; Rezaei Hosseinabadi, F; Safarzadeh, B; Zeinali, M; Felcini, M; Grunewald, M; Abbrescia, M; Calabria, C; Colaleo, A; Creanza, D; Cristella, L; De Filippis, N; De Palma, M; Errico, F; Fiore, L; Iaselli, G; Lezki, S; Maggi, G; Maggi, M; Miniello, G; My, S; Nuzzo, S; Pompili, A; Pugliese, G; Radogna, R; Ranieri, A; Selvaggi, G; Sharma, A; Silvestris, L; Venditti, R; Verwilligen, P; Abbiendi, G; Battilana, C; Bonacorsi, D; Borgonovi, L; Braibant-Giacomelli, S; Campanini, R; Capiluppi, P; Castro, A; Cavallo, F R; Chhibra, S S; Codispoti, G; Cuffiani, M; Dallavalle, G M; Fabbri, F; Fanfani, A; Fasanella, D; Giacomelli, P; Grandi, C; Guiducci, L; Marcellini, S; Masetti, G; Montanari, A; Navarria, F L; Perrotta, A; Rossi, A M; Rovelli, T; Siroli, G P; Tosi, N; Albergo, S; Costa, S; Di Mattia, A; Giordano, F; Potenza, R; Tricomi, A; Tuve, C; Barbagli, G; Chatterjee, K; Ciulli, V; Civinini, C; D'Alessandro, R; Focardi, E; Lenzi, P; Meschini, M; Paoletti, S; Russo, L; Sguazzoni, G; Strom, D; Viliani, L; Benussi, L; Bianco, S; Fabbri, F; Piccolo, D; Primavera, F; Calvelli, V; Ferro, F; Ravera, F; Robutti, E; Tosi, S; Benaglia, A; Beschi, A; Brianza, L; Brivio, F; Ciriolo, V; Dinardo, M E; Fiorendi, S; Gennai, S; Ghezzi, A; Govoni, P; Malberti, M; Malvezzi, S; Manzoni, R A; Menasce, D; Moroni, L; Paganoni, M; Pauwels, K; Pedrini, D; Pigazzini, S; Ragazzi, S; Tabarelli de Fatis, T; Buontempo, S; Cavallo, N; Di Guida, S; Fabozzi, F; Fienga, F; Iorio, A O M; Khan, W A; Lista, L; Meola, S; Paolucci, P; Sciacca, C; Thyssen, F; Azzi, P; Bacchetta, N; Benato, L; Bisello, D; Boletti, A; Carlin, R; Carvalho Antunes De Oliveira, A; Checchia, P; De Castro Manzano, P; Dorigo, T; Dosselli, U; Gasparini, F; Gasparini, U; Gozzelino, A; Lacaprara, S; Margoni, M; Meneguzzo, A T; Pozzobon, N; Ronchese, P; Rossin, R; Simonetto, F; Torassa, E; Zanetti, M; Zotto, P; Zumerle, G; Braghieri, A; Magnani, A; Montagna, P; Ratti, S P; Re, V; Ressegotti, M; Riccardi, C; Salvini, P; Vai, I; Vitulo, P; Alunni Solestizi, L; Biasini, M; Bilei, G M; Cecchi, C; Ciangottini, D; Fanò, L; Leonardi, R; Manoni, E; Mantovani, G; Mariani, V; Menichelli, M; Rossi, A; Santocchia, A; Spiga, D; Androsov, K; Azzurri, P; Bagliesi, G; Boccali, T; Borrello, L; Castaldi, R; Ciocci, M A; Dell'Orso, R; Fedi, G; Giannini, L; Giassi, A; Grippo, M T; Ligabue, F; Lomtadze, T; Manca, E; Mandorli, G; Messineo, A; Palla, F; Rizzi, A; Savoy-Navarro, A; Spagnolo, P; Tenchini, R; Tonelli, G; Venturi, A; Verdini, P G; Barone, L; Cavallari, F; Cipriani, M; Daci, N; Del Re, D; Di Marco, E; Diemoz, M; Gelli, S; Longo, E; Margaroli, F; Marzocchi, B; Meridiani, P; Organtini, G; Paramatti, R; Preiato, F; Rahatlou, S; Rovelli, C; Santanastasio, F; Amapane, N; Arcidiacono, R; Argiro, S; Arneodo, M; Bartosik, N; Bellan, R; Biino, C; Cartiglia, N; Cenna, F; Costa, M; Covarelli, R; Degano, A; Demaria, N; Kiani, B; Mariotti, C; Maselli, S; Migliore, E; Monaco, V; Monteil, E; Monteno, M; Obertino, M M; Pacher, L; Pastrone, N; Pelliccioni, M; Pinna Angioni, G L; Romero, A; Ruspa, M; Sacchi, R; Shchelina, K; Sola, V; Solano, A; Staiano, A; Traczyk, P; Belforte, S; Casarsa, M; Cossutti, F; Della Ricca, G; Zanetti, A; Kim, D H; Kim, G N; Kim, M S; Lee, J; Lee, S; Lee, S W; Moon, C S; Oh, Y D; Sekmen, S; Son, D C; Yang, Y C; Lee, A; Kim, H; Moon, D H; Oh, G; Brochero Cifuentes, J A; Goh, J; Kim, T J; Cho, S; Choi, S; Go, Y; Gyun, D; Ha, S; Hong, B; Jo, Y; Kim, Y; Lee, K; Lee, K S; Lee, S; Lim, J; Park, S K; Roh, Y; Almond, J; Kim, J; Kim, J S; Lee, H; Lee, K; Nam, K; Oh, S B; Radburn-Smith, B C; Seo, S H; Yang, U K; Yoo, H D; Yu, G B; Kim, H; Kim, J H; Lee, J S H; Park, I C; Choi, Y; Hwang, C; Lee, J; Yu, I; Dudenas, V; Juodagalvis, A; Vaitkus, J; Ahmed, I; Ibrahim, Z A; Md Ali, M A B; Mohamad Idris, F; Wan Abdullah, W A T; Yusli, M N; Zolkapli, Z; Reyes-Almanza, R; Ramirez-Sanchez, G; Duran-Osuna, M C; Castilla-Valdez, H; De La Cruz-Burelo, E; Heredia-De La Cruz, I; Rabadan-Trejo, R I; Lopez-Fernandez, R; Mejia Guisao, J; Sanchez-Hernandez, A; Carrillo Moreno, S; Oropeza Barrera, C; Vazquez Valencia, F; Eysermans, J; Pedraza, I; Salazar Ibarguen, H A; Uribe Estrada, C; Morelos Pineda, A; Krofcheck, D; Butler, P H; Ahmad, A; Ahmad, M; Hassan, Q; Hoorani, H R; Saddique, A; Shah, M A; Shoaib, M; Waqas, M; Bialkowska, H; Bluj, M; Boimska, B; Frueboes, T; Górski, M; Kazana, M; Nawrocki, K; Szleper, M; Zalewski, P; Bunkowski, K; Byszuk, A; Doroba, K; Kalinowski, A; Konecki, M; Krolikowski, J; Misiura, M; Olszewski, M; Pyskir, A; Walczak, M; Bargassa, P; Beirão Da Cruz E Silva, C; Di Francesco, A; Faccioli, P; Galinhas, B; Gallinaro, M; Hollar, J; Leonardo, N; Lloret Iglesias, L; Nemallapudi, M V; Seixas, J; Strong, G; Toldaiev, O; Vadruccio, D; Varela, J; Afanasiev, S; Bunin, P; Gavrilenko, M; Golutvin, I; Gorbunov, I; Kamenev, A; Karjavin, V; Lanev, A; Malakhov, A; Matveev, V; Palichik, V; Perelygin, V; Shmatov, S; Shulha, S; Skatchkov, N; Smirnov, V; Voytishin, N; Zarubin, A; Ivanov, Y; Kim, V; Kuznetsova, E; Levchenko, P; Murzin, V; Oreshkin, V; Smirnov, I; Sosnov, D; Sulimov, V; Uvarov, L; Vavilov, S; Vorobyev, A; Andreev, Yu; Dermenev, A; Gninenko, S; Golubev, N; Karneyeu, A; Kirsanov, M; Krasnikov, N; Pashenkov, A; Tlisov, D; Toropin, A; Epshteyn, V; Gavrilov, V; Lychkovskaya, N; Popov, V; Pozdnyakov, I; Safronov, G; Spiridonov, A; Stepennov, A; Toms, M; Vlasov, E; Zhokin, A; Aushev, T; Bylinkin, A; Chistov, R; Danilov, M; Parygin, P; Philippov, D; Polikarpov, S; Tarkovskii, E; Andreev, V; Azarkin, M; Dremin, I; Kirakosyan, M; Terkulov, A; Baskakov, A; Belyaev, A; Boos, E; Dudko, L; Ershov, A; Gribushin, A; Kodolova, O; Korotkikh, V; Lokhtin, I; Miagkov, I; Obraztsov, S; Petrushanko, S; Savrin, V; Snigirev, A; Vardanyan, I; Blinov, V; Skovpen, Y; Shtol, D; Azhgirey, I; Bayshev, I; Bitioukov, S; Elumakhov, D; Godizov, A; Kachanov, V; Kalinin, A; Konstantinov, D; Mandrik, P; Petrov, V; Ryutin, R; Sobol, A; Troshin, S; Tyurin, N; Uzunian, A; Volkov, A; Adzic, P; Cirkovic, P; Devetak, D; Dordevic, M; Milosevic, J; Rekovic, V; Alcaraz Maestre, J; Bachiller, I; Barrio Luna, M; Cerrada, M; Colino, N; De La Cruz, B; Delgado Peris, A; Fernandez Bedoya, C; Fernández Ramos, J P; Flix, J; Fouz, M C; Gonzalez Lopez, O; Goy Lopez, S; Hernandez, J M; Josa, M I; Moran, D; Pérez-Calero Yzquierdo, A; Puerta Pelayo, J; Quintario Olmeda, A; Redondo, I; Romero, L; Soares, M S; Álvarez Fernández, A; Albajar, C; de Trocóniz, J F; Missiroli, M; Cuevas, J; Erice, C; Fernandez Menendez, J; Gonzalez Caballero, I; González Fernández, J R; Palencia Cortezon, E; Sanchez Cruz, S; Vischia, P; Vizan Garcia, J M; Cabrillo, I J; Calderon, A; Chazin Quero, B; Curras, E; Duarte Campderros, J; Fernandez, M; Garcia-Ferrero, J; Gomez, G; Lopez Virto, A; Marco, J; Martinez Rivero, C; Martinez Ruiz Del Arbol, P; Matorras, F; Piedra Gomez, J; Rodrigo, T; Ruiz-Jimeno, A; Scodellaro, L; Trevisani, N; Vila, I; Vilar Cortabitarte, R; Abbaneo, D; Akgun, B; Auffray, E; Baillon, P; Ball, A H; Barney, D; Bendavid, J; Bianco, M; Bloch, P; Bocci, A; Botta, C; Camporesi, T; Castello, R; Cepeda, M; Cerminara, G; Chapon, E; Chen, Y; d'Enterria, D; Dabrowski, A; Daponte, V; David, A; De Gruttola, M; De Roeck, A; Deelen, N; Dobson, M; du Pree, T; Dünser, M; Dupont, N; Elliott-Peisert, A; Everaerts, P; Fallavollita, F; Franzoni, G; Fulcher, J; Funk, W; Gigi, D; Gilbert, A; Gill, K; Glege, F; Gulhan, D; Harris, P; Hegeman, J; Innocente, V; Jafari, A; Janot, P; Karacheban, O; Kieseler, J; Knünz, V; Kornmayer, A; Kortelainen, M J; Krammer, M; Lange, C; Lecoq, P; Lourenço, C; Lucchini, M T; Malgeri, L; Mannelli, M; Martelli, A; Meijers, F; Merlin, J A; Mersi, S; Meschi, E; Milenovic, P; Moortgat, F; Mulders, M; Neugebauer, H; Ngadiuba, J; Orfanelli, S; Orsini, L; Pape, L; Perez, E; Peruzzi, M; Petrilli, A; Petrucciani, G; Pfeiffer, A; Pierini, M; Rabady, D; Racz, A; Reis, T; Rolandi, G; Rovere, M; Sakulin, H; Schäfer, C; Schwick, C; Seidel, M; Selvaggi, M; Sharma, A; Silva, P; Sphicas, P; Stakia, A; Steggemann, J; Stoye, M; Tosi, M; Treille, D; Triossi, A; Tsirou, A; Veckalns, V; Verweij, M; Zeuner, W D; Bertl, W; Caminada, L; Deiters, K; Erdmann, W; Horisberger, R; Ingram, Q; Kaestli, H C; Kotlinski, D; Langenegger, U; Rohe, T; Wiederkehr, S A; Backhaus, M; Bäni, L; Berger, P; Bianchini, L; Casal, B; Dissertori, G; Dittmar, M; Donegà, M; Dorfer, C; Grab, C; Heidegger, C; Hits, D; Hoss, J; Kasieczka, G; Klijnsma, T; Lustermann, W; Mangano, B; Marionneau, M; Meinhard, M T; Meister, D; Micheli, F; Musella, P; Nessi-Tedaldi, F; Pandolfi, F; Pata, J; Pauss, F; Perrin, G; Perrozzi, L; Quittnat, M; Reichmann, M; Sanz Becerra, D A; Schönenberger, M; Shchutska, L; Tavolaro, V R; Theofilatos, K; Vesterbacka Olsson, M L; Wallny, R; Zhu, D H; Aarrestad, T K; Amsler, C; Canelli, M F; De Cosa, A; Del Burgo, R; Donato, S; Galloni, C; Hreus, T; Kilminster, B; Pinna, D; Rauco, G; Robmann, P; Salerno, D; Schweiger, K; Seitz, C; Takahashi, Y; Zucchetta, A; Candelise, V; Chang, Y H; Cheng, K Y; Doan, T H; Jain, Sh; Khurana, R; Kuo, C M; Lin, W; Pozdnyakov, A; Yu, S S; Kumar, Arun; Chang, P; Chao, Y; Chen, K F; Chen, P H; Fiori, F; Hou, W-S; Hsiung, Y; Liu, Y F; Lu, R-S; Paganis, E; Psallidas, A; Steen, A; Tsai, J F; Asavapibhop, B; Kovitanggoon, K; Singh, G; Srimanobhas, N; Bat, A; Boran, F; Cerci, S; Damarseckin, S; Demiroglu, Z S; Dozen, C; Dumanoglu, I; Girgis, S; Gokbulut, G; Guler, Y; Hos, I; Kangal, E E; Kara, O; Kayis Topaksu, A; Kiminsu, U; Oglakci, M; Onengut, G; Ozdemir, K; Sunar Cerci, D; Tali, B; Tok, U G; Turkcapar, S; Zorbakir, I S; Zorbilmez, C; Karapinar, G; Ocalan, K; Yalvac, M; Zeyrek, M; Gülmez, E; Kaya, M; Kaya, O; Tekten, S; Yetkin, E A; Agaras, M N; Atay, S; Cakir, A; Cankocak, K; Köseoglu, I; Grynyov, B; Levchuk, L; Ball, F; Beck, L; Brooke, J J; Burns, D; Clement, E; Cussans, D; Davignon, O; Flacher, H; Goldstein, J; Heath, G P; Heath, H F; Kreczko, L; Newbold, D M; Paramesvaran, S; Sakuma, T; Seif El Nasr-Storey, S; Smith, D; Smith, V J; Belyaev, A; Brew, C; Brown, R M; Calligaris, L; Cieri, D; Cockerill, D J A; Coughlan, J A; Harder, K; Harper, S; Linacre, J; Olaiya, E; Petyt, D; Shepherd-Themistocleous, C H; Thea, A; Tomalin, I R; Williams, T; Auzinger, G; Bainbridge, R; Borg, J; Breeze, S; Buchmuller, O; Bundock, A; Casasso, S; Citron, M; Colling, D; Corpe, L; Dauncey, P; Davies, G; De Wit, A; Della Negra, M; Di Maria, R; Elwood, A; Haddad, Y; Hall, G; Iles, G; James, T; Lane, R; Laner, C; Lyons, L; Magnan, A-M; Malik, S; Mastrolorenzo, L; Matsushita, T; Nash, J; Nikitenko, A; Palladino, V; Pesaresi, M; Raymond, D M; Richards, A; Rose, A; Scott, E; Seez, C; Shtipliyski, A; Summers, S; Tapper, A; Uchida, K; Vazquez Acosta, M; Virdee, T; Wardle, N; Winterbottom, D; Wright, J; Zenz, S C; Cole, J E; Hobson, P R; Khan, A; Kyberd, P; Reid, I D; Teodorescu, L; Zahid, S; Borzou, A; Call, K; Dittmann, J; Hatakeyama, K; Liu, H; Pastika, N; Smith, C; Bartek, R; Dominguez, A; Buccilli, A; Cooper, S I; Henderson, C; Rumerio, P; West, C; Arcaro, D; Avetisyan, A; Bose, T; Gastler, D; Rankin, D; Richardson, C; Rohlf, J; Sulak, L; Zou, D; Benelli, G; Cutts, D; Garabedian, A; Hadley, M; Hakala, J; Heintz, U; Hogan, J M; Kwok, K H M; Laird, E; Landsberg, G; Lee, J; Mao, Z; Narain, M; Pazzini, J; Piperov, S; Sagir, S; Syarif, R; Yu, D; Band, R; Brainerd, C; Burns, D; Calderon De La Barca Sanchez, M; Chertok, M; Conway, J; Conway, R; Cox, P T; Erbacher, R; Flores, C; Funk, G; Ko, W; Lander, R; Mclean, C; Mulhearn, M; Pellett, D; Pilot, J; Shalhout, S; Shi, M; Smith, J; Stolp, D; Tos, K; Tripathi, M; Wang, Z; Bachtis, M; Bravo, C; Cousins, R; Dasgupta, A; Florent, A; Hauser, J; Ignatenko, M; Mccoll, N; Regnard, S; Saltzberg, D; Schnaible, C; Valuev, V; Bouvier, E; Burt, K; Clare, R; Ellison, J; Gary, J W; Ghiasi Shirazi, S M A; Hanson, G; Heilman, J; Karapostoli, G; Kennedy, E; Lacroix, F; Long, O R; Olmedo Negrete, M; Paneva, M I; Si, W; Wang, L; Wei, H; Wimpenny, S; Yates, B R; Branson, J G; Cittolin, S; Derdzinski, M; Gerosa, R; Gilbert, D; Hashemi, B; Holzner, A; Klein, D; Kole, G; Krutelyov, V; Letts, J; Masciovecchio, M; Olivito, D; Padhi, S; Pieri, M; Sani, M; Sharma, V; Tadel, M; Vartak, A; Wasserbaech, S; Wood, J; Würthwein, F; Yagil, A; Zevi Della Porta, G; Amin, N; Bhandari, R; Bradmiller-Feld, J; Campagnari, C; Dishaw, A; Dutta, V; Franco Sevilla, M; Gouskos, L; Heller, R; Incandela, J; Ovcharova, A; Qu, H; Richman, J; Stuart, D; Suarez, I; Yoo, J; Anderson, D; Bornheim, A; Lawhorn, J M; Newman, H B; Nguyen, T Q; Pena, C; Spiropulu, M; Vlimant, J R; Xie, S; Zhang, Z; Zhu, R Y; Andrews, M B; Ferguson, T; Mudholkar, T; Paulini, M; Russ, J; Sun, M; Vogel, H; Vorobiev, I; Weinberg, M; Cumalat, J P; Ford, W T; Jensen, F; Johnson, A; Krohn, M; Leontsinis, S; Mulholland, T; Stenson, K; Wagner, S R; Alexander, J; Chaves, J; Chu, J; Dittmer, S; Mcdermott, K; Mirman, N; Patterson, J R; Quach, D; Rinkevicius, A; Ryd, A; Skinnari, L; Soffi, L; Tan, S M; Tao, Z; Thom, J; Tucker, J; Wittich, P; Zientek, M; Abdullin, S; Albrow, M; Alyari, M; Apollinari, G; Apresyan, A; Apyan, A; Banerjee, S; Bauerdick, L A T; Beretvas, A; Berryhill, J; Bhat, P C; Bolla, G; Burkett, K; Butler, J N; Canepa, A; Cerati, G B; Cheung, H W K; Chlebana, F; Cremonesi, M; Duarte, J; Elvira, V D; Freeman, J; Gecse, Z; Gottschalk, E; Gray, L; Green, D; Grünendahl, S; Gutsche, O; Harris, R M; Hasegawa, S; Hirschauer, J; Hu, Z; Jayatilaka, B; Jindariani, S; Johnson, M; Joshi, U; Klima, B; Kreis, B; Lammel, S; Lincoln, D; Lipton, R; Liu, M; Liu, T; Lopes De Sá, R; Lykken, J; Maeshima, K; Magini, N; Marraffino, J M; Mason, D; McBride, P; Merkel, P; Mrenna, S; Nahn, S; O'Dell, V; Pedro, K; Prokofyev, O; Rakness, G; Ristori, L; Schneider, B; Sexton-Kennedy, E; Soha, A; Spalding, W J; Spiegel, L; Stoynev, S; Strait, J; Strobbe, N; Taylor, L; Tkaczyk, S; Tran, N V; Uplegger, L; Vaandering, E W; Vernieri, C; Verzocchi, M; Vidal, R; Wang, M; Weber, H A; Whitbeck, A; Acosta, D; Avery, P; Bortignon, P; Bourilkov, D; Brinkerhoff, A; Carnes, A; Carver, M; Curry, D; Field, R D; Furic, I K; Gleyzer, S V; Joshi, B M; Konigsberg, J; Korytov, A; Kotov, K; Ma, P; Matchev, K; Mei, H; Mitselmakher, G; Shi, K; Sperka, D; Terentyev, N; Thomas, L; Wang, J; Wang, S; Yelton, J; Joshi, Y R; Linn, S; Markowitz, P; Rodriguez, J L; Ackert, A; Adams, T; Askew, A; Hagopian, S; Hagopian, V; Johnson, K F; Kolberg, T; Martinez, G; Perry, T; Prosper, H; Saha, A; Santra, A; Sharma, V; Yohay, R; Baarmand, M M; Bhopatkar, V; Colafranceschi, S; Hohlmann, M; Noonan, D; Roy, T; Yumiceva, F; Adams, M R; Apanasevich, L; Berry, D; Betts, R R; Cavanaugh, R; Chen, X; Evdokimov, O; Gerber, C E; Hangal, D A; Hofman, D J; Jung, K; Kamin, J; Sandoval Gonzalez, I D; Tonjes, M B; Trauger, H; Varelas, N; Wang, H; Wu, Z; Zhang, J; Bilki, B; Clarida, W; Dilsiz, K; Durgut, S; Gandrajula, R P; Haytmyradov, M; Khristenko, V; Merlo, J-P; Mermerkaya, H; Mestvirishvili, A; Moeller, A; Nachtman, J; Ogul, H; Onel, Y; Ozok, F; Penzo, A; Snyder, C; Tiras, E; Wetzel, J; Yi, K; Blumenfeld, B; Cocoros, A; Eminizer, N; Fehling, D; Feng, L; Gritsan, A V; Maksimovic, P; Roskes, J; Sarica, U; Swartz, M; Xiao, M; You, C; Al-Bataineh, A; Baringer, P; Bean, A; Boren, S; Bowen, J; Castle, J; Khalil, S; Kropivnitskaya, A; Majumder, D; Mcbrayer, W; Murray, M; Rogan, C; Royon, C; Sanders, S; Schmitz, E; Tapia Takaki, J D; Wang, Q; Ivanov, A; Kaadze, K; Maravin, Y; Mohammadi, A; Saini, L K; Skhirtladze, N; Rebassoo, F; Wright, D; Baden, A; Baron, O; Belloni, A; Eno, S C; Feng, Y; Ferraioli, C; Hadley, N J; Jabeen, S; Jeng, G Y; Kellogg, R G; Kunkle, J; Mignerey, A C; Ricci-Tam, F; Shin, Y H; Skuja, A; Tonwar, S C; Abercrombie, D; Allen, B; Azzolini, V; Barbieri, R; Baty, A; Bi, R; Brandt, S; Busza, W; Cali, I A; D'Alfonso, M; Demiragli, Z; Gomez Ceballos, G; Goncharov, M; Hsu, D; Hu, M; Iiyama, Y; Innocenti, G M; Klute, M; Kovalskyi, D; Lee, Y-J; Levin, A; Luckey, P D; Maier, B; Marini, A C; Mcginn, C; Mironov, C; Narayanan, S; Niu, X; Paus, C; Roland, C; Roland, G; Salfeld-Nebgen, J; Stephans, G S F; Tatar, K; Velicanu, D; Wang, J; Wang, T W; Wyslouch, B; Benvenuti, A C; Chatterjee, R M; Evans, A; Hansen, P; Hiltbrand, J; Kalafut, S; Kubota, Y; Lesko, Z; Mans, J; Nourbakhsh, S; Ruckstuhl, N; Rusack, R; Turkewitz, J; Wadud, M A; Acosta, J G; Oliveros, S; Avdeeva, E; Bloom, K; Claes, D R; Fangmeier, C; Golf, F; Gonzalez Suarez, R; Kamalieddin, R; Kravchenko, I; Monroy, J; Siado, J E; Snow, G R; Stieger, B; Dolen, J; Godshalk, A; Harrington, C; Iashvili, I; Nguyen, D; Parker, A; Rappoccio, S; Roozbahani, B; Alverson, G; Barberis, E; Freer, C; Hortiangtham, A; Massironi, A; Morse, D M; Orimoto, T; Teixeira De Lima, R; Trocino, D; Wamorkar, T; Wang, B; Wisecarver, A; Wood, D; Bhattacharya, S; Charaf, O; Hahn, K A; Mucia, N; Odell, N; Schmitt, M H; Sung, K; Trovato, M; Velasco, M; Bucci, R; Dev, N; Hildreth, M; Hurtado Anampa, K; Jessop, C; Karmgard, D J; Kellams, N; Lannon, K; Li, W; Loukas, N; Marinelli, N; Meng, F; Mueller, C; Musienko, Y; Planer, M; Reinsvold, A; Ruchti, R; Siddireddy, P; Smith, G; Taroni, S; Wayne, M; Wightman, A; Wolf, M; Woodard, A; Alimena, J; Antonelli, L; Bylsma, B; Durkin, L S; Flowers, S; Francis, B; Hart, A; Hill, C; Ji, W; Liu, B; Luo, W; Winer, B L; Wulsin, H W; Cooperstein, S; Driga, O; Elmer, P; Hardenbrook, J; Hebda, P; Higginbotham, S; Kalogeropoulos, A; Lange, D; Luo, J; Marlow, D; Mei, K; Ojalvo, I; Olsen, J; Palmer, C; Piroué, P; Stickland, D; Tully, C; Malik, S; Norberg, S; Barker, A; Barnes, V E; Das, S; Folgueras, S; Gutay, L; Jones, M; Jung, A W; Khatiwada, A; Miller, D H; Neumeister, N; Peng, C C; Qiu, H; Schulte, J F; Sun, J; Wang, F; Xiao, R; Xie, W; Cheng, T; Parashar, N; Stupak, J; Chen, Z; Ecklund, K M; Freed, S; Geurts, F J M; Guilbaud, M; Kilpatrick, M; Li, W; Michlin, B; Padley, B P; Roberts, J; Rorie, J; Shi, W; Tu, Z; Zabel, J; Zhang, A; Bodek, A; de Barbaro, P; Demina, R; Duh, Y T; Ferbel, T; Galanti, M; Garcia-Bellido, A; Han, J; Hindrichs, O; Khukhunaishvili, A; Lo, K H; Tan, P; Verzetti, M; Ciesielski, R; Goulianos, K; Mesropian, C; Agapitos, A; Chou, J P; Gershtein, Y; Gómez Espinosa, T A; Halkiadakis, E; Heindl, M; Hughes, E; Kaplan, S; Kunnawalkam Elayavalli, R; Kyriacou, S; Lath, A; Montalvo, R; Nash, K; Osherson, M; Saka, H; Salur, S; Schnetzer, S; Sheffield, D; Somalwar, S; Stone, R; Thomas, S; Thomassen, P; Walker, M; Delannoy, A G; Heideman, J; Riley, G; Rose, K; Spanier, S; Thapa, K; Bouhali, O; Castaneda Hernandez, A; Celik, A; Dalchenko, M; De Mattia, M; Delgado, A; Dildick, S; Eusebi, R; Gilmore, J; Huang, T; Kamon, T; Mueller, R; Pakhotin, Y; Patel, R; Perloff, A; Perniè, L; Rathjens, D; Safonov, A; Tatarinov, A; Ulmer, K A; Akchurin, N; Damgov, J; De Guio, F; Dudero, P R; Faulkner, J; Gurpinar, E; Kunori, S; Lamichhane, K; Lee, S W; Libeiro, T; Mengke, T; Muthumuni, S; Peltola, T; Undleeb, S; Volobouev, I; Wang, Z; Greene, S; Gurrola, A; Janjam, R; Johns, W; Maguire, C; Melo, A; Ni, H; Padeken, K; Sheldon, P; Tuo, S; Velkovska, J; Xu, Q; Arenton, M W; Barria, P; Cox, B; Hirosky, R; Joyce, M; Ledovskoy, A; Li, H; Neu, C; Sinthuprasith, T; Wang, Y; Wolfe, E; Xia, F; Harr, R; Karchin, P E; Poudyal, N; Sturdy, J; Thapa, P; Zaleski, S; Brodski, M; Buchanan, J; Caillol, C; Dasu, S; Dodd, L; Duric, S; Gomber, B; Grothe, M; Herndon, M; Hervé, A; Hussain, U; Klabbers, P; Lanaro, A; Levine, A; Long, K; Loveless, R; Ruggles, T; Savin, A; Smith, N; Smith, W H; Taylor, D; Woods, N

2017-12-15

The first observation of top quark production in proton-nucleus collisions is reported using proton-lead data collected by the CMS experiment at the CERN LHC at a nucleon-nucleon center-of-mass energy of sqrt[s_{NN}]=8.16  TeV. The measurement is performed using events with exactly one isolated electron or muon candidate and at least four jets. The data sample corresponds to an integrated luminosity of 174  nb^{-1}. The significance of the tt[over ¯] signal against the background-only hypothesis is above 5 standard deviations. The measured cross section is σ_{tt[over ¯]}=45±8  nb, consistent with predictions from perturbative quantum chromodynamics.

Observation of Top Quark Production in Proton-Nucleus Collisions

Science.gov (United States)

Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Dragicevic, M.; Erö, J.; Escalante Del Valle, A.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van De Klundert, M.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Marchesini, I.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Beghin, D.; Bilin, B.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Dorney, B.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Kalsi, A. K.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Seva, T.; Starling, E.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; David, P.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Saggio, A.; Vidal Marono, M.; Wertz, S.; Zobec, J.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Coelho, E.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Sanchez Rosas, L. J.; Santoro, A.; Sznajder, A.; Thiel, M.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Tomei, T. R. Fernandez Perez; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Sultanov, G.; Dimitrov, A.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Yuan, L.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, J.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Zhang, F.; Wang, Y.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Segura Delgado, M. A.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Assran, Y.; Elgammal, S.; Mahrous, A.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Kirschenmann, H.; Pekkanen, J.; Voutilainen, M.; Havukainen, J.; Heikkilä, J. K.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Laurila, S.; Lehti, S.; Lindén, T.; Luukka, P.; Siikonen, H.; Tuominen, E.; Tuominiemi, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Leloup, C.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Amendola, C.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Bagaturia, I.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Teroerde, M.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Aggleton, R.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baselga, M.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Faltermann, N.; Freund, B.; Friese, R.; Giffels, M.; Harrendorf, M. A.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Gianneios, P.; Katsoulis, P.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Tsitsonis, D.; Csanad, M.; Filipovic, N.; Pasztor, G.; Surányi, O.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kaur, A.; Kaur, M.; Kaur, S.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Borgonovi, L.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Ravera, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Beschi, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Margoni, M.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Md Ali, M. A. B.; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Eysermans, J.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sosnov, D.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chistov, R.; Danilov, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Tarkovskii, E.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Dudko, L.; Ershov, A.; Gribushin, A.; Kodolova, O.; Korotkikh, V.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Snigirev, A.; Vardanyan, I.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Godizov, A.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Mandrik, P.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Bachiller, I.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; Albajar, C.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Akgun, B.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bendavid, J.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Deelen, N.; Dobson, M.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gilbert, A.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Jafari, A.; Janot, P.; Karacheban, O.; Kieseler, J.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Ngadiuba, J.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Rabady, D.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Backhaus, M.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Dorfer, C.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Sanz Becerra, D. A.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Schweiger, K.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Chang, Y. H.; Cheng, K. y.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Bat, A.; Boran, F.; Cerci, S.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Dumanoglu, I.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kayis Topaksu, A.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Sunar Cerci, D.; Tali, B.; Tok, U. G.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Köseoglu, I.; Grynyov, B.; Levchuk, L.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Heath, G. P.; Heath, H. F.; Kreczko, L.; Newbold, D. M.; Paramesvaran, S.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Linacre, J.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Borg, J.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Teodorescu, L.; Zahid, S.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hadley, M.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Lee, J.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Karapostoli, G.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Gilbert, D.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; Gouskos, L.; Heller, R.; Incandela, J.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T. Q.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Quach, D.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Alyari, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Gleyzer, S. V.; Joshi, B. M.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Shi, K.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Rogan, C.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Rebassoo, F.; Wright, D.; Baden, A.; Baron, O.; Belloni, A.; Eno, S. C.; Feng, Y.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Hu, M.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Hiltbrand, J.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Wadud, M. A.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Golf, F.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Freer, C.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wamorkar, T.; Wang, B.; Wisecarver, A.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Bucci, R.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Li, W.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Siddireddy, P.; Smith, G.; Taroni, S.; Wayne, M.; Wightman, A.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Kalogeropoulos, A.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Qiu, H.; Schulte, J. F.; Sun, J.; Wang, F.; Xiao, R.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Chen, Z.; Ecklund, K. M.; Freed, S.; Geurts, F. J. M.; Guilbaud, M.; Kilpatrick, M.; Li, W.; Michlin, B.; Padley, B. P.; Roberts, J.; Rorie, J.; Shi, W.; Tu, Z.; Zabel, J.; Zhang, A.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Mengke, T.; Muthumuni, S.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Poudyal, N.; Sturdy, J.; Thapa, P.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.; CMS Collaboration

2017-12-01

The first observation of top quark production in proton-nucleus collisions is reported using proton-lead data collected by the CMS experiment at the CERN LHC at a nucleon-nucleon center-of-mass energy of √{sN N }=8.16 TeV . The measurement is performed using events with exactly one isolated electron or muon candidate and at least four jets. The data sample corresponds to an integrated luminosity of 174 nb-1 . The significance of the t t ¯ signal against the background-only hypothesis is above 5 standard deviations. The measured cross section is σt t ¯=45 ±8 nb , consistent with predictions from perturbative quantum chromodynamics.

Recoil ion charge state distributions in low energy Arq+ - Ar collisions

International Nuclear Information System (INIS)

Vancura, J.; Marchetti, V.; Kostroun, V.O.

1992-01-01

We have measured the recoil ion charge state distributions in Ar q+ -- Ar (8≤q≤16) collisions at 2.3 qkeV and 0.18qkeV by time of flight (TOF) spectroscopy. For Ar 8-16+ , recoil ion charge states up to 6+ are clearly present, indicating that the 3p subshell in the target atom is being depleted, while for Ar 10-16+ , there is evidence that target 3s electrons are also being removed. Comparison of the recoil ion charge state spectra at 2.3 and 0.18 qkeV shows that for a given projectile charge, there is very little dependence of the observed recoil target charge state distribution on projectile energy

The Mantodea (Dictyoptera: Insecta of Rio Grande do Norte, Brazil: First List of Species and Geographical Records

Directory of Open Access Journals (Sweden)

Raphael Heleodoro

2016-12-01

Resumo. Este trabalho apresenta a primeira lista de espécies de louva-a-deus do Rio Grande do Norte, bem como sua distribuição dentro do Estado. Os registros das espécies são oriundos de espécimes depositados na Coleção Entomológica “Adalberto Antonio Varela Freire”, localizada na Universidade Federal do Rio Grande do Norte. Essa coleção possui um total de 1.816 espécimes de Mantodea depositados, representando 30 espécies distribuídas em 16 gêneros.

Nickel-base alloy forgings for advanced high temperature power plants

Energy Technology Data Exchange (ETDEWEB)

Donth, B.; Diwo, A.; Blaes, N.; Bokelmann, D. [Saarschmiede GmbH Freiformschmiede, Voelklingen (Germany)

2008-07-01

The strong efforts to reduce the CO{sub 2} emissions lead to the demand for improved thermal efficiency of coal fired power plants. An increased thermal efficiency can be realised by higher steam temperatures and pressures in the boiler and the turbine. The European development aims for steam temperatures of 700 C which requires the development and use of new materials and also associated process technology for large components. Temperatures of 700 C and above are too high for the application of ferritic steels and therefore only Nickel-Base Alloys can fulfill the required material properties. In particular the Nickel-Base Alloy A617 is the most candidate alloy on which was focused the investigation and development in several German and European programs during the last 10 years. The goal is to verify and improve the attainable material properties and ultrasonic detectability of large Alloy 617 forgings for turbine rotors and boiler parts. For many years Saarschmiede has been manufacturing nickel and cobalt alloys and is participating the research programs by developing the manufacturing routes for large turbine rotor forgings up to a maximum diameter of 1000 mm as well as for forged tubes and valve parts for the boiler side. The experiences in manufacturing and testing of very large forgings made from nickel base alloys for 700 C steam power plants are reported. (orig.)

Hahn AB, Germany (West). Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

Science.gov (United States)

1982-08-09

70 9 71*3 735 sś 71,5 76,2 76,7 76,7 7607 768 . 8 76.i 7LA. -900 43.5 6*.t 64.1 65.8 72.9 73*3 75.8 77.0 77.5 7807 79o2 79.2 79.2 79.41 79.4, 79.4p 800...97.6 97.6o 97.6 97.6 417.6 97.6 97.6 5000__ 1 AL.) aii 49 2 .5fl.jA .ifJ aL5 spt s.iiS I5 qA --anii-nqsrsn rsa q 2! 4500 44.1 50.5 51.6 52.2~ 53.9’ 53.9...81.2.180 6 : 3: 7711- 800 60.6 73.6 76.31 7 80 1 80.2 81.4, 81.6 81.7 81.9! 81.9, 81.9 81.9, 81.9 81.9 81.9, ’ i 63 5 768 79.51 80.9! 835 83. 84.7

A new approach to development drilling in Trinidad-Tesoro

Energy Technology Data Exchange (ETDEWEB)

Persad, K.M.

1972-01-01

A detailed correlation of the Upper Cruse by means of electric logs from wells in Central Palo Seco field in S. Trinidad was done in an attempt to trace sands which have yielded very high oil productions, but which shaled out completely, very rapidly, in seemingly random directions. A new approach was attempted, namely, using the S.P. shapes from the logs to identify depositional environments of the sands, with a view to determining the paleogeography of the area. This study has revealed a meander belt channel running from west to east and ending in a delta, with several distributary chanels. It has also been possible to distinguish areas of lagoonal or pro-deltaic deposition. On the basis of this study, one well P.S. 816, was drilled but found only part of the channel. Another location has been recommended, but has not yet been drilled. If this well finds the main channel, a dipmeter will be run to help in the siting of new locations.

LITERATURE CURRICULUM III--TEST FOR "THE MERCHANT OF VENICE."

Science.gov (United States)

KITZHABER, ALBERT R.

THIS TEST--"THE MERCHANT OF VENICE"--WAS DESIGNED BY THE OREGON CURRICULUM STUDY CENTER FOR A NINTH-GRADE LITERATURE CURRICULUM. IT IS INTENDED TO ACCOMPANY CURRICULUM UNITS AVAILABLE AS ED 010 815 AND ED 010 816. (MM)

Maximisation of the ratio of microhardness to the Young's modulus of Ti–12Mo–13Nb alloy through microstructure changes

Energy Technology Data Exchange (ETDEWEB)

Gabriel, Sinara B., E-mail: sinara@metalmat.ufrj.br [Universidade Federal do Rio de Janeiro, Departamento de Engenharia Metalúrgica e de Materiais, C.P. 68505, Rio de Janeiro, RJ 21945-970 (Brazil); Centro Universitário de Volta Redonda, Volta Redonda, RJ (Brazil); Almeida, Luiz H. de [Universidade Federal do Rio de Janeiro, Departamento de Engenharia Metalúrgica e de Materiais, C.P. 68505, Rio de Janeiro, RJ 21945-970 (Brazil); Nunes, Carlos A. [Universidade de São Paulo, Departamento de Engenharia de Materiais, C.P. 116, Lorena, SP 12.600-970 (Brazil); Dille, Jean [Université Libre de Bruxelles, Chemical and Materials Department, Av. F. Roosevelt 50, C. P. 194/03, Brussels (Belgium); Soares, Glória A. [Universidade Federal do Rio de Janeiro, Departamento de Engenharia Metalúrgica e de Materiais, C.P. 68505, Rio de Janeiro, RJ 21945-970 (Brazil)

2013-08-01

Alloys for orthopaedic and dentistry applications require high mechanical strength and a low Young's modulus to avoid stress shielding. Metastable β titanium alloys appear to fulfil these requirements. This study investigated the correlation of phases precipitated in a Ti–12Mo–13Nb alloy with changes in hardness and the Young's modulus. The alloy was produced by arc melting under an argon atmosphere, after which, it was heat treated and cold forged. Two different routes of heat treatment were employed. Phase transformations were studied by employing X-ray diffraction and transmission electron microscopy. Property characterisation was based on Vickers microhardness tests and Young's modulus measurements. The highest ratio of microhardness to the Young's modulus was obtained using thermomechanical treatment, which consists of heating at 1000 °C for 24 h, water quenching, cold forging to reduce 80% of the area, and ageing at 500 °C for 24 h, where the final microstructure consisted of an α phase dispersed in a β matrix. The α phase appeared in two different forms: as fine lamellas (with 240 ± 100 nm length) and massive particles of 200–500 nm size. - Highlights: • The work presents microstructure change and properties of Ti–12Mo–13Nb alloy. • The better condition was achieved by the α phase distributed in the β matrix. • The values obtained were higher than of the Ti–6Al–4V alloy and cp Ti.

Structural changes of radial forging die surface during service under thermo-mechanical fatigue

International Nuclear Information System (INIS)

Nematzadeh, Fardin; Akbarpour, Mohammad Reza; Kokabi, Amir Hosein; Sadrnezhaad, Seyed Khatiboleslam

2009-01-01

Radial forging is one of the modern open die forging techniques and has a wide application in producing machine parts. During operation at high temperatures, severe temperature change associated with mechanical loads and the resultant wearing of the die surface lead to intense variation in strain on the die surface. Therefore, under this operating condition, thermo-mechanical fatigue (TMF) occurs on the surface of the radial forging die. TMF decreases the life of the die severely. In the present research, different layers were deposited on a 1.2714 steel die by SMAW and GTAW, with a weld wire of UDIMET 520. The microstructure of the radial forging die surface was investigated during welding and service using an optical microscope and scanning electron microscope. The results revealed that, after welding, the structure of the radial forging die surface includes the γ matrix with a homogeneous distribution of fine semi-spherical carbides. The weld structure consisted mostly of columnar dendrites with low grain boundaries. Also, microstructural investigation of the die surface during operation showed that the weld structure of the die surface has remained without any considerable change. Only dendrites were deformed and broken. Moreover, grain boundaries of the dendrites were revealed during service.

Desenvolvimento pós-embrionário de Cochliomyia macellaria (Fabricius (Diptera: Calliphoridae, criada em duas dietas naturais, sob condições controladas

Directory of Open Access Journals (Sweden)

Débora Cardoso

2012-08-01

Cochliomyia macellaria tem interese médico e médico veterinário por ser veiculadora de enteropatógenos e causadora de miíase secundária. A busca por dietas com baixo custo que mantenham a qualidade da criação torna-se necessária. Objetivou-se avaliar a dieta moela de frango no desenvolvimento pós-embrionário de C. macellaria, comparada a carne bovina. Quarenta neolarvas (3ª geração foram transferidas para 80g de dieta (quatro repetições/tratamento. Foi registrada a massa corporal das larvas maduras, e estas transferidas para tubos de ensaio e mantidas a T 30ºC dia/28ºC noite, UR 70±10% e 12h de fotofase. As observações foram diárias. Houve diferença significativa entre a massa corporal das larvas criadas na dieta moela de frango (0,067g e carne bovina (0,062g. Não houve diferença significativa entre a duração média em dias do estágio larval (4,00; 4,17, pupal (4,09; 4,04; de neolarva a adulto (8,07 e 8,16, para moela e carne, respectivamente. A viabilidade média larval, pupal e total (> 85% não diferiram estatisticamente pelo teste t de Student, 5% de significância. Não houve desvio da razão sexual e não foi observada anormalidade dos adultos. A dieta moela de frango é uma alternativa eficaz e de baixo custo para criação de C. macellaria em laboratório.

Adediji et al (3)

African Journals Online (AJOL)

Timothy Ademakinwa

and the development of new copper-based radio- pharmaceuticals ... assay kits were obtained from Randox ... around the wells on sensitivity media. ... orally to the rats of various groups two times daily, ..... sons, New York, 628, 641, 811-816.

China’s Trade Relations with the United States in Perspective

Directory of Open Access Journals (Sweden)

Dong Wang

2010-01-01

Full Text Available China’s trade relations with the United States over the past four decades is a topic that has not been fully dealt with in scholarly works. This paper charts the course of US-China economic relations since 1971, explains the principal forces stimulating growth and encouraging change and, finally, discusses how these two economic giants fit into an interlocking Asian and world economy. In reaction to the post-2008 financial downturn, advocates for a new world economic order have suggested a rebalancing of global demand, which will arguably become a major, politically charged issue in the US and in China in the years to come. Growing economic interdependence has quickly presented new challenges and opportunities, with issues such as human rights, Most-Favoured-Nation status, the Taiwan and Tibet question, and the huge American trade deficit threatening to cloud the relationship at times. With China’s emergence as a major power and America’s hegemonic ambitions tested in successive wars, the contradiction between a booming commercial relationship and conflict associated with geopolitical and ideological differences will continue to constitute a serious challenge. The long-term goal for each side will be to forge economic ties strong enough to create a stable political relationship, rather than to be held hostage by geopolitical constraints.

Identification of Forged Bank of England 20 Gbp Banknotes Using IR Spectroscopy

Science.gov (United States)

Sonnex, Emily

2014-06-01

Bank of England notes of 20 GBP denomination have been studied using infrared spectroscopy in order to generate a method to identify forged notes. A principal aim of this work was to develop a method so that a small, compact ATR FTIR instrument could be used by bank workers, police departments or others such as shop assistants to identify forged notes in a non-lab setting. The ease of use of the instrument is the key to this method, as well as the relatively low cost. The presence of a peak at 1400 wn from the blank paper section of a forged note proved to be a successful indicator of the note's illegality for the notes that we studied. Moreover, differences between the spectra of forged and genuine 20 GBP notes were observed in the ν(OH) (ca. 3500 wn), ν(C-H) (ca. 2900 wn) and ν(C=O) (ca. 1750 wn) regions of the IR spectrum recorded for the polymer film covering the holographic strip. In cases where these simple tests fail, we have shown how an infrared microscope can be used to further differentiate genuine and forged banknotes by producing infrared maps of selected areas of the note contrasting inks with background paper. Further to this, with an announcement by the Bank of England to produce polymer banknotes in the future, the work has been extended using Australian polymer banknotes to show that the method would be transferable.

KIT mutation analysis in mast cell neoplasms

DEFF Research Database (Denmark)

Arock, M; Sotlar, K; Akin, C

2015-01-01

mutations in patients with mastocytosis at diagnosis and during follow-up with sufficient precision and sensitivity in daily practice. In addition, we provide recommendations for sampling and storage of diagnostic material as well as a robust diagnostic algorithm. Using highly sensitive assays, KIT D816V...... can be detected in peripheral blood leukocytes from most patients with systemic mastocytosis (SM) that is a major step forward in screening and SM diagnosis. In addition, the KIT D816V allele burden can be followed quantitatively during the natural course or during therapy. Our recommendations should...... greatly facilitate diagnostic and follow-up investigations in SM in daily practice as well as in clinical trials. In addition, the new tools and algorithms proposed should lead to a more effective screen, early diagnosis of SM and help to avoid unnecessary referrals....

Manufacturing of Nanostructured Rings from Previously ECAE-Processed AA5083 Alloy by Isothermal Forging

Directory of Open Access Journals (Sweden)

C. J. Luis

2013-01-01

Full Text Available The manufacturing of a functional hollow mechanical element or ring of the AA5083 alloy previously equal channel angular extrusion (ECAE processed, which presents a submicrometric microstructure, is dealt with. For this purpose, the design of two isothermal forging dies (preform and final shape is carried out using the design of experiments (DOE methodology. Moreover, after manufacturing the dies and carrying out tests so as to achieve real rings, the mechanical properties of these rings are analysed as well as their microstructure. Furthermore, a comparison between the different forged rings is made from ECAE-processed material subjected to different heat treatments, previous to the forging stage. On the other hand, the ring forging process is modelled through the use of finite element simulation in order to improve the die design and to study the force required for the isothermal forging, the damage value, and the strain the material predeformed by ECAE has undergone. With this present research work, it is intended to improve the knowledge about the mechanical properties of nanostructured material and the applicability of this material to industrial processes that allow the manufacturing of functional parts.

Mechanisms Involved in the Removal of Heavy Metals from Stormwater via Lignocellulosic Filtration Media

Science.gov (United States)

2018-01-01

This report aims to supplement our previous report (Yonge et al. 2016; WA-RD 816.3) that assessed copper and zinc adsorption to lignocellulosic filtration media using laboratory tests and field-scale column tests for urban stormwater remediation. The...

F. POLAK’S CONCEPT "THE IMAGE OF THE FUTURE"

Directory of Open Access Journals (Sweden)

Инга Владиславовна Желтикова

2013-04-01

Full Text Available The article is devoted to the analysis of the philosophic concept of the image of the future. The author defines this concept as some general idea of social expectations, existing at definite culture in definite time; he views its significance in the modern Russian science and social and political journalism. The author his particular attention focuses on Polak’s ideas about the image of the future. The article, introduces the Russian reader to with Polak’s conceptions which are set out in his work ‘The image of the future’, the book having been not yet translated into Russian. A study of the role of the image of the future in society is not only of purely academic interests, but it is also of great practical significance since modern culture faces a hard task of forging a positive and constructive vision of Tomorrow so as to realize this vision. Fred Polak was the first to undertake the difficult conceptual endeavour of clarify the role of the image of the future in the social process at the societal level.DOI: http://dx.doi.org/10.12731/2218-7405-2013-3-11

A comparative study of sequence- and structure-based features of small RNAs and other RNAs of bacteria.

Science.gov (United States)

Barik, Amita; Das, Santasabuj

2018-01-02

Small RNAs (sRNAs) in bacteria have emerged as key players in transcriptional and post-transcriptional regulation of gene expression. Here, we present a statistical analysis of different sequence- and structure-related features of bacterial sRNAs to identify the descriptors that could discriminate sRNAs from other bacterial RNAs. We investigated a comprehensive and heterogeneous collection of 816 sRNAs, identified by northern blotting across 33 bacterial species and compared their various features with other classes of bacterial RNAs, such as tRNAs, rRNAs and mRNAs. We observed that sRNAs differed significantly from the rest with respect to G+C composition, normalized minimum free energy of folding, motif frequency and several RNA-folding parameters like base-pairing propensity, Shannon entropy and base-pair distance. Based on the selected features, we developed a predictive model using Random Forests (RF) method to classify the above four classes of RNAs. Our model displayed an overall predictive accuracy of 89.5%. These findings would help to differentiate bacterial sRNAs from other RNAs and further promote prediction of novel sRNAs in different bacterial species.

The chemical bases of the various AIDS epidemics: recreational ...

Indian Academy of Sciences (India)

Unknown

also reported in Europe by the World Health Organization. (WHO), (Downs et al 1987). ..... nurse who has ever contracted AIDS (not just HIV) from the over 816,000 AIDS patients .... prevent or cure AIDS (Stolberg 2001). Due to the CDC's.

Sustainable design guidelines to support the Washington State ferries terminal design manual : design guideline application and refinement.

Science.gov (United States)

2013-08-01

The Sustainable Design Guidelines were developed in Phase I of this research program (WA-RD : 816.1). Here we are reporting on the Phase II effort that beta-tested the Phase I Guidelines on : example ferry terminal designs and refinements made ...

75 FR 55769 - Certain Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of...

Science.gov (United States)

2010-09-14

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant...) is conducting the sixteenth administrative review of the antidumping order on corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea (Korea).\\1\\ This review covers eight...

77 FR 14501 - Certain Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of...

Science.gov (United States)

2012-03-12

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant... the preliminary results of the antidumping duty administrative review for certain corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea (Korea).\\1\\ This review covers eight...

76 FR 55004 - Certain Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Preliminary...

Science.gov (United States)

2011-09-06

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant...) is conducting the seventeenth administrative review of the antidumping order on corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea \\1\\ (Korea). This review covers eight...

Dicty_cDB: Contig-U11897-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-17 AY155346_1( AY155346 |pid:none) Bactrocera cucurbitae white eye pr... 93 2e-...816 |pid:none) Bactrocera cucurbitae ABC membrane... 67 1e-09 U73828_1( U73828 |pid:none) Aedes albopictus w

Vernalization requirement of winter bread wheat modern varieties (Tritikum aestivum L.)

OpenAIRE

Н. В. Булавка; Л. М. Голик

2007-01-01

The study of vernalization requierement of winter bread wheat 87 modem varieties from Ukraine and Russia showed significant domination - 81.6% - of varieties with short vernalization requierement (30-40 days). Vernalization requierement differences among varieties from different climatic zones were revealed.

75 FR 2105 - Publication of OIG Updated Special Fraud Alert on Telemarketing by Durable Medical Equipment...

Science.gov (United States)

2010-01-14

... schemes that are used to obtain money from these programs and, when appropriate, issues Special Fraud... Dallas TX, LA, AR, OK, NM 214-767-8406 Kansas City MO, ND, SD, MT, KS, IA, CO, NE, 816-426-4000 UT, WY...

[A method of temperature measurement for hot forging with surface oxide based on infrared spectroscopy].

Science.gov (United States)

Zhang, Yu-cun; Qi, Yan-de; Fu, Xian-bin

2012-05-01

High temperature large forging is covered with a thick oxide during forging. It leads to a big measurement data error. In this paper, a method of measuring temperature based on infrared spectroscopy is presented. It can effectively eliminate the influence of surface oxide on the measurement of temperature. The method can measure the surface temperature and emissivity of the oxide directly using the infrared spectrum. The infrared spectrum is radiated from surface oxide of forging. Then it can derive the real temperature of hot forging covered with the oxide using the heat exchange equation. In order to greatly restrain interference spectroscopy through included in the received infrared radiation spectrum, three interference filter system was proposed, and a group of optimal gap parameter values using spectral simulation were obtained. The precision of temperature measurement was improved. The experimental results show that the method can accurately measure the surface temperature of high temperature forging covered with oxide. It meets the requirements of measurement accuracy, and the temperature measurement method is feasible according to the experiment result.

Modelling and Testing of Friction in Forging

DEFF Research Database (Denmark)

Bay, Niels

2007-01-01

Knowledge about friction is still limited in forging. The theoretical models applied presently for process analysis are not satisfactory compared to the advanced and detailed studies possible to carry out by plastic FEM analyses and more refined models have to be based on experimental testing...

Forging Inclusive Solutions: Experiential Earth Charter Education

Science.gov (United States)

Hill, Linda D.

2010-01-01

Forging Inclusive Solutions describes the aims, methodology and outcomes of Inclusive Leadership Adventures, an experiential education curriculum for exploring the Earth Charter. Experiential education builds meaningful relationships, skills, awareness and an inclusive community based on the Earth Charter principles. When we meet people where they…

Finite element analysis for temperature distributions in a cold forging

International Nuclear Information System (INIS)

Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong; Kim, Sung Wook; Song, In Chul; Jeon, Byung Cheol

2013-01-01

In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

Finite element analysis for temperature distributions in a cold forging

Energy Technology Data Exchange (ETDEWEB)

Kim, Dong Bum; Lee, In Hwan; Cho, Hae Yong [Chungbuk National University, Cheongju (Korea, Republic of); Kim, Sung Wook [Yanbian National University, Yanbian (China); Song, In Chul; Jeon, Byung Cheol [Sunil dyfas, Jincheon (Korea, Republic of)

2013-10-15

In this research, the finite element method is utilized to predict the temperature distributions in a cold-forging process for a cambolt. The cambolt is mainly used as a part of a suspension system of a vehicle. The cambolt has an off-centered lobe that manipulates the vertical position of the knuckle and wheel to a slight degree. The cambolt requires certain mechanical properties, such as strength and endurance limits. Moreover, temperature is also an important factor to realize mass production and improve efficiency. However, direct measurement of temperature in a forging process is infeasible with existing technology; therefore, there is a critical need for a new technique. Accordingly, in this study, a thermo-coupled finite element method is developed for predicting the temperature distribution. The rate of energy conversion to heat for the workpiece material is determined, and the temperature distribution is analyzed throughout the forging process for a cambolt. The temperatures associated with different punch speeds are also studied, as well as the relationships between load, temperature, and punch speed. Experimental verification of the technique is presented.

A material based approach to creating wear resistant surfaces for hot forging

Science.gov (United States)

Babu, Sailesh

Tools and dies used in metal forming are characterized by extremely high temperatures at the interface, high local pressures and large metal to metal sliding. These harsh conditions result in accelerated wear of tooling. Lubrication of tools, done to improve metal flow drastically quenches the surface layers of the tools and compounds the tool failure problem. This phenomenon becomes a serious issue when parts forged at complex and are expected to meet tight tolerances. Unpredictable and hence uncontrolled wear and degradation of tooling result in poor part quality and premature tool failure that result in high scrap, shop downtime, poor efficiency and high cost. The objective of this dissertation is to develop a computer-based methodology for analyzing the requirements hot forging tooling to resist wear and plastic deformation and wear and predicting life cycle of forge tooling. Development of such is a system is complicated by the fact that wear and degradation of tooling is influenced by not only the die material used but also numerous process controls like lubricant, dilution ratio, forging temperature, equipment used, tool geometries among others. Phenomenological models available u1 the literature give us a good thumb rule to selecting materials but do not provide a way to evaluate pits performance in field. Once a material is chosen, there are no proven approaches to create surfaces out of these materials. Coating approaches like PVD and CVD cannot generate thick coatings necessary to withstand the conditions under hot forging. Welding cannot generate complex surfaces without several secondary operations like heat treating and machining. If careful procedures are not followed, welds crack and seldom survive forging loads. There is a strong need for an approach to selectively, reliably and precisely deposit material of choice reliably on an existing surface which exhibit not only good tribological properties but also good adhesion to the substrate

Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

Directory of Open Access Journals (Sweden)

Abdullah K. Shehabat

2016-09-01

Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

Effect of raw materials and hardening process on hardness of manually forged knife

Science.gov (United States)

Balkhaya, Suwarno

2017-06-01

Knives are normally made by forging process either using a machine or traditional method by means of hammering process. This present work was conducted to study the effects of steel raw materials and hardening process on the hardness of manually forged knives. The knife samples were made by traditional hammering (forging) process done by local blacksmith. Afterward, the samples were heat treated with two different hardening procedures, the first was based on the blacksmith procedure and the second was systematically done at the laboratory. The forging was done in the temperature ranged between 900-950°C, while the final temperature ranged between 650-675°C. The results showed that knives made of spring steel and heat treated in simulated condition at the laboratory obtained higher level of hardness, i.e. 62 HRC. In general, knives heat treated by local blacksmith had lower level of hardness that those obtained from simulated condition. Therefore, we concluded that the traditional knife quality in term of hardness can be improved by optimizing the heat treatment schedule.

Fabrication Improvement of Cold Forging Hexagonal Nuts by Computational Analysis and Experiment Verification

Directory of Open Access Journals (Sweden)

Shao-Yi Hsia

2015-01-01

Full Text Available Cold forging has played a critical role in fasteners and has been applied to the automobile industry, construction industry, aerospace industry, and living products so that cold forging presents the opportunities for manufacturing more products. By using computer simulation, this study attempts to analyze the process of creating machine parts, such as hexagonal nuts. The DEFORM-3D forming software is applied to analyze the process at various stages in the computer simulation, and the compression test is also used for the flow stress equation in order to compare the differences between the experimental results and the equation that is built into the computer simulation software. At the same time, the metallography and hardness of experiments are utilized to understand the cold forging characteristics of hexagonal nuts. The research results would benefit machinery businesses to realize the forging load and forming conditions at various stages before the fastener formation. In addition to planning proper die design and production, the quality of the produced hexagonal nuts would be more stable to promote industrial competitiveness.

Procrastinación académica: validación de una escala en una muestra de estudiantes de una universidad privada (Academic Procrastination: validation of a Scale in a Sample of Students from a Private University

Directory of Open Access Journals (Sweden)

Sergio Alexis Dominguez Lara

2014-12-01

Full Text Available RESUMEN: El objetivo de la presente investigación es analizar las propiedades psicométricas de la Escala de Procrastinación Académica (EPA en una muestra constituida por 379 estudiantes de una universidad privada cuyas edades se encuentran entre 16 y 40 años (M = 20.82. El análisis factorial confirmatorio realizado revela que la EPA presenta una estructura bifactorial. La confiabilidad se estimó mediante el alfa de Cronbach obteniéndose .816 para la escala total; .821 para el factor Autorregulación académica, y .752 para el factor Postergación de actividades. Se concluye que la EPA cuenta con propiedades psicométricas adecuadas para seguir con estudios de validación utilizando otras estrategias, apoyando su uso como instrumento de evaluación de la procrastinación académica. ABSTRACT: The objective of this research is to analyze the psychometric properties of the Academic Procrastination Scale (EPA in a sample consisting of 379 students from a private university whose ages are between 16 and 40 years (M = 20.82. The confirmatory factor analysis conducted reveals that the EPA has a bivariate structure. Reliability was estimated through Cronbach’s alpha, obtaining.816 for the total scale; .821 for the self-regulating academic factor, and.752 for the activities postponement factor. It is concluded that the EPA has psychometric properties suitable to continue with validation studies using other strategies, supporting its use as a tool for evaluation of academic procrastination.

Influence of the Constitutive Flow Law in FEM Simulation of the Radial Forging Process

Directory of Open Access Journals (Sweden)

Olivier Pantalé

2013-01-01

Full Text Available Radial forging is a widely used forming process for manufacturing hollow products in transport industry. As the deformation of the workpiece, during the process, is a consequence of a large number of high-speed strokes, the Johnson-Cook constitutive law (taking into account the strain rate seems to be well adapted for representing the material behavior even if the process is performed under cold conditions. But numerous contributions concerning radial forging analysis, in the literature, are based on a simple elastic-plastic formulation. As far as we know, this assumption has yet not been validated for the radial forging process. Because of the importance of the flow law in the effectiveness of the model, our purpose in this paper is to analyze the influence of the use of an elastic-viscoplastic formulation instead of an elastic-plastic one for modeling the cold radial forging process. In this paper we have selected two different laws for the simulations: the Johnson-Cook and the Ludwik ones, and we have compared the results in terms of forging force, product's thickness, strains, stresses, and CPU time. For the presented study we use an AISI 4140 steel, and we denote a fairly good agreement between the results obtained using both laws.

Digging into the Past, Exploring the Present: Richard Flanagan’s Gould’s Book of Fish: A Novel in Twelve Fish

Directory of Open Access Journals (Sweden)

Maria Renata Dolce

2015-07-01

Full Text Available Abstract – This paper will analyze the ‘historical’ novel Gould’s Book of Fish (2001 by the Tasmanian writer Richard Flanagan with the aim of reflecting upon the power of the creative word as a means to forge reality, shape identities, mask or unmask truths, and also to prefigure a different, alternative world order based on commonly negotiated and thus shared values. The postmodernist revisiting of the traditional genre of the historical novel does not compromise the postcolonial commitment of the writer: Flanagan’s incursions into the Australian colonial past are informed by his concern for urgent social and political causes which has characterized his unswerving fight against all systems of inequality and exploitation. In his novel, the subversion of the linear causal relation of events which calls into question the truthfulness and objectivity of history, together with the foregrounded metanarrative reflection on the art of writing, contribute to the revisiting and re-discussing of the myth of progress and the cult of rationality at the very roots of Western civilization and of its imperialistic enterprise. Flanagan’s ‘anti-historical’ historical novel tackles urgent questions about modernity interrogating the founding narratives of the Australian national identity, in order to explore the uncontrollable and shifting areas of the contemporary ‘transnation’ in which the traditional categories shaping subjectivities are disrupted. As the paper will demonstrate, the writer digs into the past of his nation not simply in order to unravel its hidden histories but to detect the profound, inextricable interconnections with the present across different times and spaces. Feelings and experiences that exist above and beyond historical contingencies and cultural differences represent the writer’s privileged area of investigation as they trespass upon conventional and artificial boundaries revealing what it is that makes us all

(S,S,S,S-Nebivolol hydrochloride hemihydrate

Directory of Open Access Journals (Sweden)

Yoann Rousselin

2012-12-01

Full Text Available The asymmetric unit of the title hydrated salt, C22H26F2NO4+·Cl−·0.5H2O, consists of an (S,S,S,S-nebivolol {nebivol = bis[2-(6-fluoro-3,4-dihydro-2H-1-benzopyran-2-yl-2-hydroxyethyl]ammonium} cation, a chloride anion and a half-occupancy water molecule. The dihedral angle between the mean planes of the benzene rings is 50.34 (12°. The pyran rings adopt half-chair conformations. The crystal packing features O—H...O hydrogen bonds and weak N—H...Cl, O—H...Cl, and O—H...Cl interactions, producing layers along (010.

The Philip Morris Genome Project: a guide to tracking alliances of the world´s largest cigarette company

Directory of Open Access Journals (Sweden)

Alan Blum

2018-03-01

Full Text Available Background Beginning in the 1980s, tobacco control efforts shifted from school-based and clinic-based education about the dangers of smoking to direct confrontation of the tobacco industry. But the industry also evolved by developing innovative promotional campaigns, adopting new corporate identities, and forging alliances with other industries and charitable organizations. Methods To document the extent of the commercial, civic, political, academic, military,and cultural ties cultivated by the world´s largest cigarette manufacturer, Philip Morris, a continuous, 35-year ethnographic analysis was conducted, involving daily monitoring of the global business press; monthly review of tobacco industry trade publications; scrutiny of annual company reports; and attendance at 20 shareholders´ meetings, four international tobacco industry trade expositions, and over 200 sports, arts, and ethnic minority events sponsored by the company. Results 48 Philip Morris manufacturing facilities in 32 countries produce more than 800 billion cigarettes a year for 180 markets..A pioneer in sponsoring popular programs on the new medium of television in the 1950s; the company circumvented the 1971 ban on TV cigarette advertising by creating sporting events that were internationally televised. By acquiring beer and food companies In the 1980s, Philip Morris retained influence over the mass media covetous of advertising revenue. In 2002 the company changed its name to Altria to diminish the tobacco stigma. It makes the world´s top cigarette brand, Marlboro, and holds 28% of the global market excluding China. The company has forged an extensive network of alliances with agricultural, marketing, chemical, pharmaceutical, financial, packaging, entertainment, shipping, and technology companies, as well as ties to hundreds of museums, arts organizations, universities, libraries, and charities combating problems such as domestic violence, hunger, pollution, illiteracy, and

Experiment list: SRX369069 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 15242199,98.2,33.5,535 SET8 16h gammaH2AX name=SET8_16

Breast cancer risk variants at 6q25 display different phenotype associations and regulate ESR1, RMND1 and CCDC170

NARCIS (Netherlands)

A.M. Dunning (Alison); K. Michailidou (Kyriaki); K.B. Kuchenbaecker (Karoline); D. Thompson (Deborah); J.D. French (Juliet); J. Beesley (Jonathan); S. Healey (Sue); S. Kar (Siddhartha); K.A. Pooley (Karen); E. Lopez-Knowles (Elena); E. Dicks (Ed); D. Barrowdale (Daniel); N.A. Sinnott-Armstrong (Nicholas A); R.C. Sallari (Richard C); K.M. Hillman (Kristine); S. Kaufmann (Susanne); H. Sivakumaran (Haran); M.M. Marjaneh (Mahdi Moradi); J.S. Lee (Jason); M. Hills (Margaret); M. Jarosz (Monika); S. Drury (Suzie); S. Canisius (Sander); M. KBolla (Manjeet); J. Dennis (Joe); Q. Wang (Qin); J. LHopper (John); M.C. Southey (Mellissa C.); A. Broeks (Annegien); M.K. Schmidt (Marjanka); A. Lophatananon (Artitaya); K.R. Muir (K.); M.W. Beckmann (Matthias); P.A. Fasching (Peter); I. dos Santos Silva (Isabel); J. Peto (Julian); E.J. Sawyer (Elinor); I. Tomlinson (Ian); B. Burwinkel (Barbara); F. Marme (Federick); P. Guénel (Pascal); T. Truong (Thérèse); S.E. Bojesen (Stig); H. Flyger (Henrik); A. Gonzlez-Neira (Anna); J.I.A. Perez (Jose I.A.); H. Anton-Culver (Hoda); L. Eunjung (Lee); V. Arndt (Volker); H. Brenner (Hermann); A. Meindl (Alfons); R.K. Schmutzler (Rita); H. Brauch (Hiltrud); U. Hamann (Ute); K. Aittomki (Kristiina); C. Blomqvist (Carl); H. Ito (Hidemi); K. Matsuo (Keitaro); N.V. Bogdanova (Natalia); T. Dörk (Thilo); A. Lindblom (Annika); S. Margolin (Sara); V-M. Kosma (Veli-Matti); A. Mannermaa (Arto); C.-C. Tseng (Chiu-Chen); A.H. Wu (Anna); D. Lambrechts (Diether); H. Wildiers (Hans); J. Chang-Claude (Jenny); A. Rudolph (Anja); P. Peterlongo (Paolo); P. Radice (Paolo); J. EOlson (Janet); G. GGiles (Graham); R.L. Milne (Roger L); C.A. Haiman (Christopher A.); B.E. Henderson (Brian); M.S. Goldberg (Mark); S.H. Teo (Soo Hwang); C.H. Yip (Cheng Har); S. Nord (Silje); A.-L. Borresen-Dale (Anne-Lise); V. Kristensen (Vessela); J. Long (Jirong); W. Zheng (Wei); K. Pylks (Katri); R. Winqvist (Robert); I.L. Andrulis (Irene); J.A. Knight (Julia A.); P. Devilee (Peter); C.M. Seynaeve (Caroline); J.D. Figueroa (Jonine); M.E. Sherman (Mark); K. Czene (Kamila); H. Darabi (Hatef); A. Hollestelle (Antoinette); A.M.W. van den Ouweland (Ans); K. Humphreys (Keith); Y.-T. Gao (Yu-Tang); X.-O. Shu (Xiao-Ou); A. Cox (Angela); S.S. Cross (Simon); W.J. Blot (William); Q. Cai (Qiuyin); M. Ghoussaini (Maya); B. Perkins (Barbara); M. Shah (Mitul); J.-Y. Choi (Ji-Yeob); D. Kang (Daehee); S.C. Lee (Soo Chin); J.M. Hartman (Joost); M. Kabisch (Maria); D. Torres (Diana); A. Jakubowska (Anna); J. Lubinski (Jan); P. Brennan (Paul); S. Sangrajrang (Suleeporn); C.B. Ambrosone (Christine); A.E. Toland (Amanda); C-Y. Shen (Chen-Yang); P.-E. Wu (Pei-Ei); N. Orr (Nick); A.J. Swerdlow (Anthony ); L. McGuffog (Lesley); S. Healey (Sue); A. Lee (Andrew); M.K. Kapuscinski (Miroslav K.); E.M. John (Esther); M.B. Terry (Mary Beth); M.B. Daly (Mary B.); D. Goldgar (David); S.S. Buys (Saundra); R. Janavicius (Ramunas); L. Tihomirova (Laima); N. Tung (Nadine); C.M. Dorfling (Cecilia); E.J. van Rensburg (Elizabeth); S.L. Neuhausen (Susan); B. Ejlertsen (Bent); T.V. OHansen (Thomas V); A. Osorio (Ana); J. Benítez (Javier); R. Rando (Rachel); J.N. Weitzel (Jeffrey); B. Bonnani (Bernardo); B. Peissel (Bernard); S. Manoukian (Siranoush); L. Papi (Laura); L. Ottini (Laura); I. Konstantopoulou (I.); P. Apostolou (Paraskevi); J. Garber (Judy); M.U. Rashid (Muhammad Usman); D. Frost (Debra); L. Izatt (Louise); S.D. Ellis (Steve); A.K. Godwin (Andrew K.); N. Arnold (Norbert); D. Niederacher (Dieter); K. Rhiem (Kerstin); N. Bogdanova-Markov (Nadja); C. Sagne (Charlotte); D. Stoppa-Lyonnet (Dominique); F. Damiola (Francesca); O. Sinilnikova (Olga); S. Mazoyer (Sylvie); C. Isaacs (Claudine); K.B. MClaes (Kathleen B); K. De Leeneer (Kim); M. de La Hoya (Miguel); T. Caldes (Trinidad); H. Nevanlinna (Heli); S. Khan (Sofia); A.R. Mensenkamp (Arjen); M.J. Hooning (Maartje); M.A. Rookus (Matti); A. Kwong (Ava); E. Olah (Edith); O. Díez (Orland); J. Brunet (Joan); M.A. Pujana (Miguel); J. Gronwald (Jacek); T. Huzarski (Tomasz); R.B. Barkardottir (Rosa); R. Laframboise (Rachel); P. Soucy (Penny); M. Montagna (Marco); S. Agata (Simona); P.J. Teixeira; S. Kyung Park (Sue); N.M. Lindor (Noralane); F.J. Couch (Fergus J); M. Tischkowitz (Marc); L. Foretova (Lenka); J. Vijai (Joseph); K. Offit (Kenneth); C.F. Singer (Christian); C. Rappaport (Christine); C. MPhelan (Catherine); M.H. Greene (Mark H.); P.L. Mai (Phuong); G. Rennert (Gad); E.N. Imyanitov (Evgeny); P.J. Hulick (Peter); K.-A. Phillips (Kelly-Anne); M. Piedmonte (Marion); A.-M. Mulligan (Anna-Marie); G. Glendon (Gord); A. Bojesen (Anders); M. Thomassen (Mads); M.A. Caligo (Maria); S.-Y. Yoon (Sook-Yee); E. Friedman (Eitan); Y. Laitman (Yael); Å. Borg (Åke); A. von Wachenfeldt (Anna); H. Ehrencrona (Hans); J. Rantala (Johanna); O.I. Olopade (Olufunmilayo I.); P.A. Ganz (Patricia A.); R. Nussbaum (Robert); S.A. Gayther (Simon); K. LNathanson (Katherine); S.M. Domchek (Susan); B.K. Arun (Banu); G. Mitchell (Gillian); B.Y. Karlan (Beth Y.); K.J. Lester (Kathryn); G. Maskarinec (Gertraud); C. Woolcott (Christy); C.G. Scott (Christopher G.); J. Stone (Jennifer); C. Apicella (Carmel); R. Tamimi (Rulla); R.N. Luben (Robert); K.-T. Khaw (Kay-Tee); S. Helland (Slaug); V. Haakensen (Vilde); M. Dowsett (Mitch); P.D.P. Pharoah (Paul); J. Simard (Jacques); P. Hall (Per); M. Garca-Closas (Montserrat); C. Vachon (Celine); G. Chenevix-Trench (Georgia); A.C. Antoniou (Antonis C.); D.F. Easton (Douglas F.); S.L. Edwards (Stacey)

2016-01-01

textabstractWe analyzed 3,872 common genetic variants across the ESR1 locus (encoding estrogen receptor α) in 118,816 subjects from three international consortia. We found evidence for at least five independent causal variants, each associated with different phenotype sets, including estrogen

78 FR 55057 - Corrosion-Resistant Carbon Steel Flat Products from the Republic of Korea: Preliminary Results of...

Science.gov (United States)

2013-09-09

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon... Department) is conducting an administrative review of the antidumping duty order on corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea (Korea), covering the period [[Page 55058...

78 FR 16247 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea; Final Results of...

Science.gov (United States)

2013-03-14

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon... preliminary results of the administrative review of the antidumping duty order on corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea (Korea).\\1\\ This review covers seven manufacturers...

77 FR 54891 - Certain Corrosion-Resistant Carbon Steel Flat Products from the Republic of Korea: Preliminary...

Science.gov (United States)

2012-09-06

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant...) is conducting the 18th administrative review of the antidumping order on corrosion-resistant carbon steel flat products (CORE) from the Republic of Korea \\1\\ (Korea). This review covers seven...

Fulltext PDF

Indian Academy of Sciences (India)

2015-11-28

Nov 28, 2015 ... proteins in the process was also obvious, although the diversity of these proteins in the .... in a 'dual-RNA-guided DNA endonuclease' (Jinek et al. 2012, p 816). ... These different objectives do not, in theory, require the same ...

elucidating the mechanism of the adsorption of mucin to ...

African Journals Online (AJOL)

dcu user

. Although some kinetic information has been published on the oxidation of secondary alcohol by Cr(VI) 1,2, 8-16 complementary studies on its possible reaction pathways are scanty. It is in the light of this that the present work was undertaken ...

Editorial The Evolution of Minimal Access Surgery and the ...

African Journals Online (AJOL)

KIGZ

In its history, large incisions were an absolute necessity to a successful procedure. Exposure was the ... approximately15,000 general surgeons in the US were trained in LC . Most of the training was ... In “Textbook of. Laparoscopy” Ed. p8-16; ...

78 FR 53630 - Airworthiness Directives; Alexander Schleicher GmbH & Co. Segelflugzeugbau Sailplanes

Science.gov (United States)

2013-08-30

..., Kansas City, Missouri 64106. For information on the availability of this material at the FAA, call (816...; email: [email protected] . SUPPLEMENTARY INFORMATION: Discussion We issued a notice of proposed... rod for conformity following Alexander Schleicher Automatischer H[ouml]henruderanschlu[beta] (English...

Tailorable Burning Behavior of Ti14 Alloy by Controlling Semi-Solid Forging Temperature.

Science.gov (United States)

Chen, Yongnan; Yang, Wenqing; Zhan, Haifei; Zhang, Fengying; Huo, Yazhou; Zhao, Yongqing; Song, Xuding; Gu, Yuantong

2016-08-16

Semi-solid processing (SSP) is a popular near-net-shape forming technology for metals, while its application is still limited in titanium alloy mainly due to its low formability. Recent works showed that SSP could effectively enhance the formability and mechanical properties of titanium alloys. The processing parameters such as temperature and forging rate/ratio, are directly correlated with the microstructure, which endow the alloy with different chemical and physical properties. Specifically, as a key structural material for the advanced aero-engine, the burn resistant performance is a crucial requirement for the burn resistant titanium alloy. Thus, this work aims to assess the burning behavior of Ti14, a kind of burn resistant alloy, as forged at different semi-solid forging temperatures. The burning characteristics of the alloy are analyzed by a series of burning tests with different burning durations, velocities, and microstructures of burned sample. The results showed that the burning process is highly dependent on the forging temperature, due to the fact that higher temperatures would result in more Ti₂Cu precipitate within grain and along grain boundaries. Such a microstructure hinders the transport of oxygen in the stable burning stage through the formation of a kind of oxygen isolation Cu-enriched layer under the burn product zone. This work suggests that the burning resistance of the alloy can be effectively tuned by controlling the temperature during the semi-solid forging process.

On the domestically-made heavy forging for reactor pressure vessels of PWR nuclear power plant

International Nuclear Information System (INIS)

Pan Xiren; Zhang Chen.

1988-01-01

The present situation of the foreign heavy forgings for nuclear reactor pressure vessels and the heavy forgings condition which is used for the Qinshan 300MWe nuclear power plant are described. Some opinions of domestic products is proposed

THE FORMING OF MAGNESIUM ALLOY FORGINGS FOR AIRCRAFT AND AUTOMOTIVE APPLICATIONS

Directory of Open Access Journals (Sweden)

Anna Dziubińska

2016-09-01

Full Text Available The paper presents the theoretical and technological aspects of forming magnesium alloy parts for aircraft and automotive applications. The main applications of magnesium alloys in the aircraft and automotive industries are discussed. In addition, the forging technology for magnesium alloys is generally described, with a particular emphasis on wrought alloys. A brief outline of the state of the art in the forging of magnesium alloys is given based on a survey of the specialist literature and the results of previous research by the authors.

Adapted diffusion processes for effective forging dies

Science.gov (United States)

Paschke, H.; Nienhaus, A.; Brunotte, K.; Petersen, T.; Siegmund, M.; Lippold, L.; Weber, M.; Mejauschek, M.; Landgraf, P.; Braeuer, G.; Behrens, B.-A.; Lampke, T.

2018-05-01

Hot forging is an effective production method producing safety relevant parts with excellent mechanical properties. The economic efficiency directly depends on the occurring wear of the tools, which limits service lifetime. Several approaches of the presenting research group aim at minimizing the wear caused by interacting mechanical and thermal loads by using enhanced nitriding technology. Thus, by modifying the surface zone layer it is possible to create a resistance against thermal softening provoking plastic deformation and pronounced abrasive wear. As a disadvantage, intensely nitrided surfaces may possibly include the risk of increased crack sensitivity and therefore feature the chipping of material at the treated surface. Recent projects (evaluated in several industrial applications) show the high technological potential of adapted treatments: A first approach evaluated localized treatments by preventing areas from nitrogen diffusion with applied pastes or other coverages. Now, further ideas are to use this principle to structure the surface with differently designed patterns generating smaller ductile zones beneath nitrided ones. The selection of suitable designs is subject to certain geo-metrical requirements though. The intention of this approach is to prevent the formation and propagation of cracks under thermal shock conditions. Analytical characterization methods for crack sensitivity of surface zone layers and an accurate system of testing rigs for thermal shock conditions verified the treatment concepts. Additionally, serial forging tests using adapted testing geometries and finally, tests in the industrial production field were performed. Besides stabilizing the service lifetime and decreasing specific wear mechanisms caused by thermal influences, the crack behavior was influenced positively. This leads to a higher efficiency of the industrial production process and enables higher output in forging campaigns of industrial partners.

Manufacturing and material properties of forgings for reactor pressure vessel of high temperature engineering test reactor

International Nuclear Information System (INIS)

Sato, I.; Suzuki, K.

1994-01-01

For the reactor pressure vessel (RPV) of high temperature engineering test reactor (HTTR) which has been developed by Japan Atomic Energy Research Institute (JAERI), 2 1/4Cr-1Mo steel is used first in the world. Material confirmation test has been carried out to demonstrate good applicability of forged low Si 2 1/4Cr-1Mo steel to the RPV of HTTR. Recently, JSW has succeeded in the manufacturing of large size ring forgings and large size forged cover dome integrated with nozzles for stand pipe for the RPV. This paper describes the results of the material confirmation test as well as the manufacturing and material properties of the large forged cover dome integrated with nozzles for stand pipe. (orig.)

Results of heating mode performance tests of a solar-assisted heat pump

Science.gov (United States)

Jones, C. B.; Smetana, F. O.

1979-01-01

The performance of a heat pump, utilizing 8.16 square meters of low-cost solar collectors as the evaporator in a Freon-114 refrigeration cycle, was determined under actual insolation conditions during the summer and fall of 1976. C.O.P.'s (coefficient of performance) greater than 3 were obtained with condensing temperatures around 78 C and evaporating temperatures around 27 C. Ambient temperatures were about 3 C above evaporating temperatures. Similar performance levels were obtained at other insolation and temperature conditions. Experience with the system has identified some component and system changes which should increase the obtainable C.O.P. to about 4.0. These are described along with the system's design rationale. The accumulated data are presented as an appendix.

High-Temperature Oxidation Behavior and Kinetics of Forged 12Cr-MoVW Steel

Directory of Open Access Journals (Sweden)

Kim Yong Hwan

2017-06-01

Full Text Available The oxidation kinetics of forged 12Cr-MoVW steel was investigated in an air (N2+O2 atmosphere at 873-1073 K (Δ50 K using thermogravimetric analysis. The oxidized samples were characterized using X-ray diffraction, and the surface and cross-sectional morphologies were examined using scanning electron microscopy coupled with energy-dispersive X-ray spectroscopy. The forged 12Cr-MoVW steel samples exhibited parabolic behavior and a low oxidation rate compared with their as-cast counterparts. A protective oxide layer was uniformly formed at relatively low temperature (≤973 K for the forged samples, which thus exhibited better oxidation resistance than the as-cast ones. These oxides are considered solid-solution compounds such as (Fe, Cr2O3.

The Connection Between the Woman’s Christian Temperance Union and the Prohibition Party

Directory of Open Access Journals (Sweden)

Adam Chamberlain

2016-12-01

Full Text Available Scholars have long been interested in the complementary relationships forged by membership groups and political parties. The post-bellum period presents an opportunity to consider these connections using a case study of two groups concerned with the ills of alcohol, the Woman’s Christian Temperance Union (WCTU and the Prohibition Party. Our analysis of presidential elections from 1876 to 1900 reveals that—although women were disenfranchised at the time—the WCTU’s organization and infrastructure was essential to early Prohibition Party success. In 1884, the first election after the two created a formal alliance in 1882, the strength of the WCTU helped the party grow its voter base. However, the two slowly diverged over how to achieve prohibition, and this relationship dissipated; there is little evidence of any significant connection between the groups after 1884. This supports the proposition that a shared means of accomplishing goals is an essential element of an effective group–party partnership.

What is there to be learnt from the 1950s and 1960s for contemporary trainee teachers in Further Education?

Directory of Open Access Journals (Sweden)

Parfitt, Anne

2010-06-01

Full Text Available In this paper, some stories of staff who became Further Education (FE lecturers during the 1950s and 1960s are reported upon. What emerges is that this period when FE was being established was heavily reliant on the imagination of the actors in their community settings. Moreover, these pioneers in the sector, often from strong occupational backgrounds but with limited formal qualifications, were employed because it was considered that they would be able to use their creative wisdom to forge the necessary links with local industry and other relevant stakeholders, so as to give the FE brand a high profile in its respective local communities. It is contended that in the current, most likely prolonged, period of austerity there is much to be drawn from these experiences of yesteryear, in that what is revealed in the following is very much a perspective that funding was not necessarily the be-all and end-all when these practitioners were endeavouring to deliver excellence. In particular, it is argued that lessons can be learnt from former times and thus, by recalling these and other such narratives and including them in FE lecturers’ Initial Teacher Training(ITT and ongoing Continuing Professional Development (CPD programmes, we may stimulate our imaginations in relation to how FE can be further integrated into the local setting, despite the aforementioned contemporary financial constraints.

Forging a unique nursing partnership with China.

Science.gov (United States)

Munn, Flavia

2017-07-12

When members of a London nursing faculty forged a learning partnership with a Chinese counterpart they likely did not expect to be discussing the benefits of using Florence Nightingale lamps to decorate hospital walls. But there is nothing ordinary about the collaboration between King's College London and Nanjing Health School.

Effect of the Process Parameters on the Formability, Microstructure, and Mechanical Properties of Thin Plates Fabricated by Rheology Forging Process with Electromagnetic Stirring Method

Science.gov (United States)

Jin, Chul Kyu; Jang, Chang Hyun; Kang, Chung Gil

2014-01-01

A thin plate (150 × 150 × 1.2 mm) with embedded corrugation is fabricated using the rheoforming method. Semisolid slurry is created using the electromagnetic stirring (EMS) system, and the thin plate is made with the forging die at the 200-ton hydraulic press. The cross sections and microstructures of the slurry with and without stirring are examined. To investigate the effect of the process parameters on the formability, microstructure, and mechanical properties of thin plate the slurry is subjected to 16 types of condition for the forging experiment. The 16 types included the following conditions: Whether the EMS is applied or not, three fractions of the solid phase at 35, 45 and 55 pct; two compression velocities at 30 and 300 mm s-1; and four different compression pressures—100, 150, 200 and 250 MPa. The thin plate's formability is enhanced at higher punch velocity for compressing the slurry, and fine solid particles are uniformly distributed, which in turn, enhances the plate's mechanical properties. The pressure between 150 and 200 MPa is an appropriate condition to form thin plates. A thin plate without defects can be created when the slurry at 35 pct of the solid fraction (f s) was applied at the compression velocity of 300 mm s-1 and 150 MPa of pressure. The surface state of thin plate is excellent with 220 MPa of tensile strength and 13.5 pct of elongation. The primary particles are fine over the entire plate, and there are no liquid segregation-related defects.

Modelling of Damage During Hot Forging of Ingots

DEFF Research Database (Denmark)

Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels

2013-01-01

Ductile damage modelling in the ingot forging process is discussed. Advantages and disadvantages of both coupled and uncoupled ductile damage models are presented. Some uncoupled damage models are examined in greater detail regarding their applicability to different processes, where hydrostatic...

Forged hollows (alloy 617) for PNP-hot gas collectors

International Nuclear Information System (INIS)

Hofmann, F.

1984-01-01

When the partners in the PNP-Project decided to manufacture components, such as gas collectors, from material of type alloy 617, the problem arose that required semi-fabricated products, especially forged hollows weighing several tons each, were not available. As VDM (Vereinigte Deutsche Metallwerke AG) had already experience in production of other semi-fabricated products of this alloy, attempts were made based on this knowledge, to develop manufacturing methods for forged hollows. The aim was to produce hollows as long as possible, and to keep the welding cost minimum. Welded seams are always critical during fabrication, as well as during later inspection under actual operating conditions. The three stage plan used to perform the above task illustrates the development aims is described

78 FR 59652 - Certain Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of...

Science.gov (United States)

2013-09-27

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant... corrosion-resistant carbon steel flat products (``CORE'') from the Republic of Korea (``Korea''), pursuant... administrative review of the antidumping duty order on CORE from Korea covering the period of review (``POR'') of...

77 FR 25405 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time...

Science.gov (United States)

2012-04-30

... antidumping duty order on corrosion-resistant carbon steel flat products from the Republic of Korea, covering... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time Limit for the Preliminary Results of...

76 FR 69703 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of Extension of...

Science.gov (United States)

2011-11-09

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon... administrative review of the antidumping duty order on corrosion-resistant carbon steel flat products from Korea, covering the period August 1, 2009, to July 31, 2010. See Initiation of Antidumping and Countervailing Duty...

76 FR 21332 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time...

Science.gov (United States)

2011-04-15

... antidumping duty order on corrosion-resistant carbon steel flat products from the Republic of Korea, covering... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time Limits for the Preliminary Results of...

75 FR 25841 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time...

Science.gov (United States)

2010-05-10

... antidumping duty order on corrosion-resistant carbon steel flat products from the Republic of Korea, covering... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Extension of Time Limits for the Preliminary Results of...

78 FR 59651 - Certain Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of...

Science.gov (United States)

2013-09-27

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Certain Corrosion-Resistant... duty order on certain corrosion-resistant carbon steel flat products (``CORE'') from the Republic of... covering the period of review (``POR'') of August 1, 2006 through July 31, 2007, with respect to the...

75 FR 77615 - Corrosion-Resistant Carbon Steel Flat Products From the Republic of Korea: Notice of Extension of...

Science.gov (United States)

2010-12-13

... DEPARTMENT OF COMMERCE International Trade Administration [A-580-816] Corrosion-Resistant Carbon... administrative review of the antidumping duty order on corrosion-resistant carbon steel flat products from Korea, covering the period August 1, 2008, to July 31, 2009. See Initiation of Antidumping and Countervailing Duty...

Parental Dysphoria and Children's Adjustment: Marital Conflict Styles, Children's Emotional Security, and Parenting as Mediators of Risk

Science.gov (United States)

Du Rocher Schudlich, Tina D.; Cummings, E. Mark

2007-01-01

Dimensions of martial conflict, children's emotional security regarding interparental conflict, and parenting style were examined as mediators between parental dysphoria and child adjustment. A community sample of 262 children, ages 8-16, participated with their parents. Behavioral observations were made of parents' interactions during marital…

Ground Water Issue: Phytoremediation of Contaminated Soil and Ground Water at Hazardous Waste Sites

Science.gov (United States)

2001-02-01

Phytoremediation. 1(2):115-123. Harms, H., and C. Langebartels. 1986. Standardized plant cell suspension test systems for an ecotoxicologic evaluation of the... macrophytes : Bacopa monnieri, Scirpus lacustris, Phragmites karka. Chandra et al., 1997 Maximum Cr accumulation was in Phragmites karka (816 mg/kg dry

Vernalization requirement of winter bread wheat modern varieties (Tritikum aestivum L.

Directory of Open Access Journals (Sweden)

Н. В. Булавка

2007-12-01

Full Text Available The study of vernalization requierement of winter bread wheat 87 modem varieties from Ukraine and Russia showed significant domination - 81.6% - of varieties with short vernalization requierement (30-40 days. Vernalization requierement differences among varieties from different climatic zones were revealed.

78 FR 47780 - Notice of Determinations Regarding Eligibility to Apply for Worker Adjustment Assistance

Science.gov (United States)

2013-08-06

... Unit of Engineering, Operations & Technology, Print Services. 82,758 Republic Steel, Massillon... number Subject firm Location Impact date 82,513 Veyance Technologies, Inc., Lincoln, NE Adecco Services..., Advertisement Division. 82,819 Vaughan Furniture Company, Galax, VA Corporate Office, 816 Glendale Road. 82,819A...

Learning Disabilities in Neurofibromatosis Type 1

Directory of Open Access Journals (Sweden)

J Gordon Millichap

2006-12-01

Full Text Available The frequency of specific leaning disabilities (SLD in neurofibromatosis type 1 (NF1 was determined in a cohort of 81 patients (43 males, 38 females; mean age 11 years 6 months; age range 8-16 followed at Children's Hospital, Westmead, NSW, Australia.

Fulltext PDF

Indian Academy of Sciences (India)

IAS Admin

and Diverse Implications in the Natural World. Science Academies' Summer Research Fellowship. Programme for Students and Teachers – 2016. Classics. On the Spontaneous. Fission of Uranium. Shyamadas Chatterjee. 856. 860. 861. 816 Split Beta-Lactamase Complementation Assay. A Search for the Molecular Better ...

Breast cancer risk variants at 6q25 display different phenotype associations and regulate ESR1, RMND1 and CCDC170

DEFF Research Database (Denmark)

Dunning, Alison M; Michailidou, Kyriaki; Kuchenbaecker, Karoline B

2016-01-01

We analyzed 3,872 common genetic variants across the ESR1 locus (encoding estrogen receptor α) in 118,816 subjects from three international consortia. We found evidence for at least five independent causal variants, each associated with different phenotype sets, including estrogen receptor (ER(+)...

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. Subatomic Physics – 100 Not Out and Still Going Strong! Avinash Khare. General Article Volume 2 Issue 12 December 1997 pp 8-16. Fulltext. Click here to view fulltext PDF. Permanent link:

Production of a 304 stainless steel nuclear reactor forging from a very large electroslag refined ingot

International Nuclear Information System (INIS)

Watkins, E.J.; Tihansky, E.L.

1986-01-01

A four-loop, upper barrel flange forging for a nuclear reactor was produced from what the authors believe to be the largest 304H grade stainless steel electroslag refined (ESR) ingot ever refined. The ingot was refined in a 1524-mm-diameter, ingot withdrawal-type ESR furnace using a lime-bearing slag, low-frequency a-c power, and dry air protection. Five electrodes were remelted in order to produce the desired ingot weight. The ingot was subsequently forged in a five-step operation on a 6800-metric-ton press to produce the desired barrel flange configuration. Testing of the finished machined forging revealed excellent tensile ductility, excellent ultrasonic penetrability, and good chemical uniformity with no macrosegregation. Overall quality was judged to be superior to previously produced, conventionally melted forgings

Forging Oxide-Dispersion-Strengthened Superalloys

Science.gov (United States)

Harf, F. H.; Glasgow, T. K.; Moracz, D. J.; Austin, C. M.

1986-01-01

Cladding of mild steel prevents surface cracking when alloy contacts die. Continual need for improvements in properties of alloys capable of withstanding elevated temperatures. Accomplished by using oxide-dispersion-strengthed superalloys such as Inconel Alloy MA 6000. Elevated tensile properties of forged alloy equal those of hot-rolled MA 6000 bar. Stress-rupture properties somewhat lower than those of bar stock but, at 1,100 degrees C, exceed those of strongest commercial single crystal, directionally solidified and conventionally cast superalloys.

Highlight: Forging the new Indonesia-Canada partnership | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

15 avr. 2016 ... Canada's Centre for International Governance Innovation and Indonesia's Centre for Strategic and International Studies organized the Indonesia-Canada Bilateral Forum, Innovation and Change: Forging the New Indonesia-Canada Partnership. IDRC co-sponsored the meeting, held May 26-27, 2015.

Manufacturing involving forging of multiple objects in contact

DEFF Research Database (Denmark)

Nielsen, Chris Valentin; Zhang, W.; Martins, P.A.F.

and dissimilar materials. While being plastically deformed against each other under increasing forging load, the parts dynamically develop their mutual contact interfaces. Comparisons of the final geometry as well as force-displacement curves are evaluated. The potential of simulated applications are discussed...

Phased array inspection of large size forged steel parts

Science.gov (United States)

Dupont-Marillia, Frederic; Jahazi, Mohammad; Belanger, Pierre

2018-04-01

High strength forged steel requires uncompromising quality to warrant advance performance for numerous critical applications. Ultrasonic inspection is commonly used in nondestructive testing to detect cracks and other defects. In steel blocks of relatively small dimensions (at least two directions not exceeding a few centimetres), phased array inspection is a trusted method to generate images of the inside of the blocks and therefore identify and size defects. However, casting of large size forged ingots introduces changes of mechanical parameters such as grain size, the Young's modulus, the Poisson's ratio, and the chemical composition. These heterogeneities affect the wave propagation, and consequently, the reliability of ultrasonic inspection and the imaging capabilities for these blocks. In this context, a custom phased array transducer designed for a 40-ton bainitic forged ingot was investigated. Following a previous study that provided local mechanical parameters for a similar block, two-dimensional simulations were made to compute the optimal transducer parameters including the pitch, width and number of elements. It appeared that depending on the number of elements, backwall reconstruction can generate high amplitude artefacts. Indeed, the large dimensions of the simulated block introduce numerous constructive interferences from backwall reflections which may lead to important artefacts. To increase image quality, the reconstruction algorithm was adapted and promising results were observed and compared with the scattering cone filter method available in the CIVA software.

S S Narvi

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. S S Narvi. Articles written in Bulletin of Materials Science. Volume 29 Issue 3 June 2006 pp 233-238 Biomaterials. External stimuli response on a novel chitosan hydrogel crosslinked with formaldehyde · A Singh S S Narvi P K Dutta N D Pandey · More Details Abstract Fulltext ...

Astrogliosis has Different Dynamics after Cell Transplantation and Mechanical Impact in the Rodent Model of Parkinson‘s Disease

Directory of Open Access Journals (Sweden)

Nikola Tomov

2018-03-01

Full Text Available Background: Transplantation of fetal mesencephalic tissue is a well-established concept for functional reinnervation of the dopamine-depleted rat striatum. However, there is no extensive description of the glial response of the host brain following this procedure. Aims: The present study aimed to quantitatively and qualitatively analyse astrogliosis surrounding intrastriatal grafts and compare it to the reaction to mechanical injury with the transplantation instrument only. Study Design: Animal experimentation. Methods: The standard 6-hydroxydopamine-induced unilateral model of Parkinson’s disease was used. The experimental animals received transplantation of a single-cell suspension of E14 ventral mesencephalic tissue. Control animals (sham-transplanted were subjected to injury by the transplantation cannula, without injection of a cell suspension. Histological analyses were carried out 7 and 28 days following the procedure by immunohistochemistry assays for tyrosine hydroxylase and glial fibrillary acidic protein. To evaluate astrogliosis, the cell density and immunopositive area were measured in distinct zones within and surrounding the grafts or the cannula tract. Results: Statistical analysis revealed that astrogliosis in the grafted striatum increased from day 7 to day 28, as shown by a significant change in both cell density and the immunopositive area. The cell density increased from 816.7±370.6 to 1403±272.1 cells/mm2 (p<0.0001 аnd from 523±245.9 to 1164±304.8 cells/mm2 (p<0.0001 in the two zones in the graft core, and from 1151±218.6 to 1485±210.6 cells/mm2 (p<0.05 for the zone in the striatum immediately adjacent to the graft. The glial fibrillary acidic protein-expressing area increased from 0.3109±0.1843 to 0.7949±0.1910 (p<0.0001 and from 0.1449±0.1240 to 0.702±0.2558 (p<0.0001 for the same zones in the graft core, and from 0.5277±0.1502 to 0.6969±0.1223 (p<0.0001 for the same area adjacent to the graft zone. However

Friction and wear in hot forging of steels

International Nuclear Information System (INIS)

Daouben, E.; Dubar, L.; Dubar, M.; Deltombe, R.; Dubois, A.; Truong-Dinh, N.; Lazzarotto, L.

2007-01-01

In the field of hot forging of steels, the mastering of wear phenomena enables to save cost production, especially concerning tools. Surfaces of tools are protected thanks to graphite. The existing lubrication processes are not very well known: amount and quality of lubricant, lubrication techniques have to be strongly optimized to delay wear phenomena occurrence. This optimization is linked with hot forging processes, the lubricant layers must be tested according to representative friction conditions. This paper presents the first part of a global study focused on wear phenomena encountered in hot forging of steels. The goal is the identification of reliable parameters, in order to bring knowledge and models of wear. A prototype testing stand developed in the authors' laboratory is involved in this experimental analysis. This test is called Warm and Hot Upsetting Sliding Test (WHUST). The stand is composed of a heating induction system and a servo-hydraulic system. Workpieces taken from production can be heated until 1200 deg. C. A nitrided contactor representing the tool is heated at 200 deg. C. The contactor is then coated with graphite and rubs against the workpiece, leaving a residual track on it. Friction coefficient and surface parameters on the contactor and the workpiece are the most representative test results. The surface parameters are mainly the sliding length before defects occurrence, and the amplitude of surface profile of the contactor. The developed methodology will be first presented followed by the different parts of the experimental prototype. The results of experiment show clearly different levels of performance according to different lubricants

Superplastic forging nitride ceramics

Science.gov (United States)

Panda, P.C.; Seydel, E.R.; Raj, R.

1988-03-22

A process is disclosed for preparing silicon nitride ceramic parts which are relatively flaw free and which need little or no machining, said process comprising the steps of: (a) preparing a starting powder by wet or dry mixing ingredients comprising by weight from about 70% to about 99% silicon nitride, from about 1% to about 30% of liquid phase forming additive and from 1% to about 7% free silicon; (b) cold pressing to obtain a preform of green density ranging from about 30% to about 75% of theoretical density; (c) sintering at atmospheric pressure in a nitrogen atmosphere at a temperature ranging from about 1,400 C to about 2,200 C to obtain a density which ranges from about 50% to about 100% of theoretical density and which is higher than said preform green density, and (d) press forging workpiece resulting from step (c) by isothermally uniaxially pressing said workpiece in an open die without initial contact between said workpiece and die wall perpendicular to the direction of pressing and so that pressed workpiece does not contact die wall perpendicular to the direction of pressing, to substantially final shape in a nitrogen atmosphere utilizing a temperature within the range of from about 1,400 C to essentially 1,750 C and strain rate within the range of about 10[sup [minus]7] to about 10[sup [minus]1] seconds[sup [minus]1], the temperature and strain rate being such that surface cracks do not occur, said pressing being carried out to obtain a shear deformation greater than 30% whereby superplastic forging is effected.

77 FR 43045 - Submission for OMB Review; Comment Request

Science.gov (United States)

2012-07-23

...: PPQ Form 816; Contract Pilot and Aircraft Acceptance. OMB Control Number: 0579-0298. Summary of... Agriculture, either independently or in cooperation with States, to carry out operations or measures to detect... or not widely distributed within the United States. This authority has been delegated to the...

Trajectories of Psychosocial Problems in Adolescents Predicted by Findings From Early Well-Child Assessments

NARCIS (Netherlands)

Jaspers, Merlijne; de Winter, Andrea F.; Huisman, Mark; Verhulst, Frank C.; Ormel, Johan; Stewart, Roy E.; Reijneveld, Sijmen A.

2012-01-01

Purpose: To describe trajectories of emotional and behavioral problems in adolescents and to identify early indicators of these trajectories using data from routine well-child assessments at ages 0-4 years. Methods: Data from three assessment waves of adolescents (n = 1,816) of the TRAILS were used

People Don't Come Here to Read Best-Sellers: The Vatican Library.

Science.gov (United States)

Rastelli, Lucy Gordan

1989-01-01

Reviews the development of the Vatican Library from the papacy of Leo III (795-816) to the present. The current status of the library is described, including print and nonprint collections, acquisitions and major bequests, access to the collections, and programs and services offered to scholars. (CLB)

IPv6: The Next Generation Internet Protocol

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 4. IPv6: The Next Generation Internet Protocol - New Features in IPv6. Harsha Srinath. General Article Volume 8 Issue 4 April 2003 pp 8-16. Fulltext. Click here to view fulltext PDF. Permanent link:

77 FR 35304 - Airworthiness Directives; Costruzioni Aeronautiche Tecnam srl Airplanes

Science.gov (United States)

2012-06-13

... available in the AD docket shortly after receipt. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace...) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa.gov . SUPPLEMENTARY INFORMATION: Comments... found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace Engineer, FAA, Small Airplane...

Production of A356 aluminum alloy wheels by thixo-forging combined with a low superheat casting process

Directory of Open Access Journals (Sweden)

Wang Shuncheng

2013-09-01

Full Text Available The A356 aluminum alloy wheels were produced by thixo-forging combined with a low superheat casting process. The as-cast microstructure, microstructure evolution during reheating and the mechanical properties of thixo-forged wheels made from the A356 aluminum alloy were studied. The results show that the A356 aluminum alloy round billet with fine, uniform and non-dendritic grains can be obtained when the melt is cast at 635 篊. When the round billet is reheated at 600 篊 for 60 min, the non-dendritic grains are changed into spherical ones and the round billet can be easily thixo-forged into wheels. The tensile strength, yield strength and elongation of the thixo-forged wheels with T6 heat treatment are 327.6 MPa, 228.3 MPa and 7.8%, respectively, which are higher than those of a cast wheel. It is suggested that the thixo-forging combined with the low superheat casting process is an effective technique to produce aluminum alloy wheels with high mechanical properties.

An assessment of Osmia rufa (syn. bicornis) as a pollinator of the sour cherry (Prunus cerasus) cv. Stevnsbaer in eastern Denmark

DEFF Research Database (Denmark)

Hansted, Lise; Grout, Brian William Wilson; Toldam-Andersen, Torben Bo

2014-01-01

. The remaining 8 pollen types were from entomophilous plants. Based on the results it is estimated that a mean of 220,000 O. rufa cocoons would be needed per hectare if the species were to be an effective, supplementary pollinator of P. cerasus cv. Stevnsbaer. Practical, economic and environmental considerations...... investigates the activity and food preferences of this species during flowering of sour cherry (P. cerasus cv. Stevnsbaer). Female O. rufa provisioned a mean of 2.96 ± 1.44 cells each with 6.24 ± 1.46 pollen types during the receptive period of flowering . In all 17 different pollen types were collected...... of which the most dominant were Salix (41.4% ± 9.34%) and Acer (33.24% ± 8.81%), followed by Betula (8.16% ± 5.08%), P. cerasus (8.16% ± 1.79%) and Fagus (3.56% ± 1.96%). P. cerasus was present in all samples. Nine pollen types were from anemophilous plants and represented 87.94% of the pollen collected...

Floating venous thrombi: diagnosis with spiral-CT-venography

International Nuclear Information System (INIS)

Gartenschlaeger, M.; Schmidt, J.A.

1996-01-01

Local application of contrast agent into an ipsilateral dorsal foot vein and spiral CT were used to examine 16 consecutive cases with deep venous thrombosis proven at conventional venography; in addition, colour Doppler flow imaging was performed. At conventional venography, 8/16 thrombi appeared to be floating and the remaining 8/16 were adherent to the vessel wall. Spiral-CT showed 15/16 thrombi to be adherent to the vessel wall; the floating thrombus correlated with findings in conventional venography. At colour Doppler flow imaging 3/16 thrombi were considered floating, one of them was discordant to conventional venography. The comparison of conventional venography to spiral-CT demonstrates complete agreement for adherence to vessel wall seen in conventional venography (p=1,0) and significant discordance in cases with free-floating appearance in conventional venography. Adherence of thrombi to the wall of the vessel at conventional venography is in agreement with computed tomography. Conventional venography probably overestimates the prevalence of free floating thrombi. (orig./MG) [de

strength and ductility of forged 1200 aluminum alloy reinforced

African Journals Online (AJOL)

eobe

duced cylindrical shape samples, which were homogenized at 420 ... and properties of deformed materials depend on other factors ... after the surfaces were ground with emery paper of ... Figure 2: Maximum elongation of forged and annealed.