Optimization of the Retrieval of Waste from Hanford Tank S-109 through Numerical Modeling
International Nuclear Information System (INIS)
Patel, R.; Tachiev, G.; Mulchandani, A.; Roelant, D.
2009-01-01
This report covers 10 different retrieval scenarios to support the U.S. Department of Energy's Office of River Protection in its mission to facilitate the retrieval and treatment of high-level radioactive waste stored in underground tanks at the Hanford site by investigating the transport properties of the salt-cake. Salt-cake consists of salts precipitated out of the brines during evaporation and storage. The main objective of this study is to gain a better understanding of the dissolution process that will occur in Tank 241-S-109 as it is retrieved to provide waste for Vitrification at the Demonstration Bulk Vitrification System Facility (DBVS). Double Shell Tank (DST) space is extremely limited and will continue to be until the Waste Treatment Plant becomes operational. Maximizing the utilization of DST space is the goal of the S-109 Partial Waste Retrieval Project that will provide waste feed to the Demonstration Bulk Vitrification System (DBVS). Florida International University, FIU has developed a 2-D axisymmetric numerical model which will assist the Department of Energy (DOE) and Savannah River Site (SRS) in evaluating the potential of selective salt-cake retrieval for schedule acceleration and significant cost savings by analyzing the performance of different retrieval scenarios with the prediction of Cs breakthrough curves in the resulting salt-cake brine and to determine the displacement patterns of Cs. This predictive information is critical for scheduling and operational purposes. Ten retrieval scenarios which include addition of flushing liquid at the entire surface of the tank or at a side peripheral channel were simulated. All retrieval scenarios were analyzed for incremental retrieval (saturation of the tank with flushing liquid followed by complete drainage at the central well) versus continuous retrieval (water is continuously added at the top and retrieved at a central well). Furthermore, the specifics of the tank hydrology were approximated
48 CFR 49.109-5 - Partial settlements.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Partial settlements. 49... MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.109-5 Partial settlements. The TCO should attempt... settlements covering particular items of the prime contractor's settlement proposal. However, when a TCO...
40 CFR 266.109 - Low risk waste exemption.
2010-07-01
... MANAGEMENT FACILITIES Hazardous Waste Burned in Boilers and Industrial Furnaces § 266.109 Low risk waste exemption. (a) Waiver of DRE standard. The DRE standard of § 266.104(a) does not apply if the boiler or... 99.9 percent destruction and removal efficiency. That is, assume that 0.1 percent of the mass weight...
Partial gamma-ray cross section measurements in 109Ag(n, x n y p gamma) reactions
Energy Technology Data Exchange (ETDEWEB)
Fotiadis, Nikolaos [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Nelson, Ronald Owen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Carroll, James [US Army Research Laboratory, Adelphi, MD (United States)
2015-06-02
We report on absolute partial cross sections for production of discrete γ-rays using 109Ag(n, xnypγ) reactions with x ≤ 7 and y ≤ 1 in a total of 12 reaction channels. The data were taken using the GEANIE spectrometer comprised of 20 high-purity Ge detectors with 20 BGO escape-suppression shields. The broad-spectrum pulsed neutron beam of the Los Alamos Neutron Science Center’s (LANSCE) WNR facility provided neutrons in the energy range from 0.2 to 300 MeV. The time-of- flight technique was used to determine the incident neutron energies. Partial γ-ray cross sections have been measured for a total of 109 transitions and for neutron energies 0.8 MeV< En<300 MeV. An estimate of the population of isomers in the (n, n'), (n, 2n) and (n, 3n) channels was made.
Reuse of waste iron as a partial replacement of sand in concrete.
Ismail, Zainab Z; Al-Hashmi, Enas A
2008-11-01
One of the major environmental issues in Iraq is the large quantity of waste iron resulting from the industrial sector which is deposited in domestic waste and in landfills. A series of 109 experiments and 586 tests were carried out in this study to examine the feasibility of reusing this waste iron in concrete. Overall, 130 kg of waste iron were reused to partially replace sand at 10%, 15%, and 20% in a total of 1703 kg concrete mixtures. The tests performed to evaluate waste-iron concrete quality included slump, fresh density, dry density, compressive strength, and flexural strength tests: 115 cubes of concrete were molded for the compressive strength and dry density tests, and 87 prisms were cast for the flexural strength tests. This work applied 3, 7, 14, and 28 days curing ages for the concrete mixes. The results confirm that reuse of solid waste material offers an approach to solving the pollution problems that arise from an accumulation of waste in a production site; in the meantime modified properties are added to the concrete. The results show that the concrete mixes made with waste iron had higher compressive strengths and flexural strengths than the plain concrete mixes.
Hydrogen or Soot?: Partial Oxidation of High-boiling Hydrocarbon Wastes
Czech Academy of Sciences Publication Activity Database
Lederer, J.; Hanika, Jiří; Nečesaný, F.; Poslední, W.; Tukač, V.; Veselý, Václav
2015-01-01
Roč. 29, č. 1 (2015), s. 5-11 ISSN 0352-9568 Institutional support: RVO:67985858 Keywords : partial oxidation * waste * hydrocarbon Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.675, year: 2015
DQO Summary Report for 105-N/109-N Interim Safe Storage Project Waste Characterization
Energy Technology Data Exchange (ETDEWEB)
T. A. Lee
2005-09-15
The DQO summary report provides the results of the DQO process completed for waste characterization activities for the 105-N/109-N Reactor Interim Safe Storage Project including decommission, deactivate, decontaminate, and demolish activities for six associated buildings.
DQO Summary Report for 105-N/109-N Interim Safe Storage Project Waste Characterization
International Nuclear Information System (INIS)
Lee, T.A.
2005-01-01
The DQO summary report provides the results of the DQO process completed for waste characterization activities for the 105-N/109-N Reactor Interim Safe Storage Project including decommission, deactivate, decontaminate, and demolish activities for six associated buildings.
suitability of polyvinyl waste powder as partial replacement
African Journals Online (AJOL)
eobe
as partial replacement of cement in the production o. PWP at interval ... conducted to assess the suitability of polyvinyl waste p polyvinyl waste p .... pose a serious environmental threat because of the fact that they ... served as the control. 2.2.3.
Energy Technology Data Exchange (ETDEWEB)
Mahoney, L.A.; Antoniak, Z.I.; Bates, J.M.
1997-12-01
This report provides the results obtained for the single-shell tanks (SSTs) sampled with the Retained Gas Sampler (RGS) during 1997: Tanks 241-U-103, 241-S-106, 241-BY-101, and 241-BY-109. The RGS is a modified version of the core sampler used at Hanford. It is designed specifically to be used in concert with the gas extraction equipment in the hot cell to capture and extrude a gas-containing waste sample in a hermetically sealed system. The four tanks represent several different types of flammable gas SSTs. Tank U-103 is on the Flammable Gas Watch List (FGWL) and is one of the highest-priority group of SSTs that show evidence of significant gas retention. Tank S-106, though not a FGWL tank, has a uniquely high barometric pressure response and continuing rapid surface level rise, indicating a large and increasing volume of retained gas. Tanks BY-101 and BY-109 are not on the FGWL but were chosen to test the effect of recent salt-well pumping on gas retention. Section 2 of this report provides an overview of the process by which retained gases in the Hanford tanks are sampled and analyzed. A detailed description of the procedure used to reduce and analyze the data is provided in Section 3. Tank-by-tank results are covered in Section 4 (with the data presented in the order in which the tanks were sampled), and an RGS system performance overview is given in Section 5. Section 6 presents conclusions from these analyses and recommendations for further research. The cited references are listed in Section 7. Appendix A describes the procedures used to extract gas and ammonia from the samples, Appendix B contains detailed laboratory data from each of the tanks, and Appendix C gives field sampling data.
International Nuclear Information System (INIS)
Mahoney, L.A.; Antoniak, Z.I.; Bates, J.M.
1997-12-01
This report provides the results obtained for the single-shell tanks (SSTs) sampled with the Retained Gas Sampler (RGS) during 1997: Tanks 241-U-103, 241-S-106, 241-BY-101, and 241-BY-109. The RGS is a modified version of the core sampler used at Hanford. It is designed specifically to be used in concert with the gas extraction equipment in the hot cell to capture and extrude a gas-containing waste sample in a hermetically sealed system. The four tanks represent several different types of flammable gas SSTs. Tank U-103 is on the Flammable Gas Watch List (FGWL) and is one of the highest-priority group of SSTs that show evidence of significant gas retention. Tank S-106, though not a FGWL tank, has a uniquely high barometric pressure response and continuing rapid surface level rise, indicating a large and increasing volume of retained gas. Tanks BY-101 and BY-109 are not on the FGWL but were chosen to test the effect of recent salt-well pumping on gas retention. Section 2 of this report provides an overview of the process by which retained gases in the Hanford tanks are sampled and analyzed. A detailed description of the procedure used to reduce and analyze the data is provided in Section 3. Tank-by-tank results are covered in Section 4 (with the data presented in the order in which the tanks were sampled), and an RGS system performance overview is given in Section 5. Section 6 presents conclusions from these analyses and recommendations for further research. The cited references are listed in Section 7. Appendix A describes the procedures used to extract gas and ammonia from the samples, Appendix B contains detailed laboratory data from each of the tanks, and Appendix C gives field sampling data
41 CFR 109-38.801 - Obtaining SF 149, U.S. Government National Credit Card.
2010-07-01
.... Government National Credit Card. 109-38.801 Section 109-38.801 Public Contracts and Property Management..., U.S. Government National Credit Card § 109-38.801 Obtaining SF 149, U.S. Government National Credit Card. DOE offices electing to use national credit cards shall request the assignment of billing address...
International Nuclear Information System (INIS)
Izak, Pavel; Hrma, Pavel R.; Wilson, Benjamin K.; Vienna, John D.
2000-01-01
The redox state of iron affects spinal crystallization in vitrified high-level waste (HLW) glass. Simulated HLW glass with spinel as the primary crystalline phase field was heat treated at constant temperatures within the interval from 850 C to 1300 C under varying atmospheres with oxygen partial pressure, Po2, ranging from 1x10-16 kPa (pure CO) to 101 kPa (pure O2). Liquidus temperature (TL) of glass increased with decreasing Po2 up to Po2 > 3 x 10-9 kPa. At Po2 < 3 x 10-9 kPa, Ni-Fe alloy precipitated from the glass, and TL decreased. Samples were analyzed with optical microscope and scanning electron microscope. The mass fraction of spinel in glass was determined using quantitative X-ray diffraction. Spinel composition was investigated with energy disperse spectroscopy. Ferrous-ferric equilibrium at TL was calculated in a HLW glass as a function of temperature and Po2, based on the previous studies by Schreiber. TL/FeO over the interval 0.0063 < gFeO < 0.051 (1x10-2 kPa < Po2 < 3x10-9 kPa) was estimated from calculated ferrous-ferric equilibrium at TL as 1835 C
Directory of Open Access Journals (Sweden)
Sara Fernandes
2017-08-01
Full Text Available The environmental concern about waste generation and the gradual decrease of oil reserves has led the way to finding new waste materials that may partially replace the bitumens used in the road paving industry. Used motor oil from vehicles is a waste product that could answer that demand, but it can also drastically reduce the viscosity, increasing the asphalt mixture’s rutting potential. Therefore, polymer modification should be used in order to avoid compromising the required performance of asphalt mixtures when higher amounts of waste motor oil are used. Thus, this study was aimed at assessing the performance of an asphalt binder/mixture obtained by replacing part of a paving grade bitumen (35/50 with 10% waste motor oil and 5% styrene-butadiene-styrene (SBS as an elastomer modifier. A comparison was also made with the results of a previous study using a blend of bio-oil from fast pyrolysis and ground tire rubber modifier as a partial substitute for usual PG64-22 bitumen. The asphalt binders were tested by means of Fourier infrared spectra and dynamic shear rheology, namely by assessing their continuous high-performance grade. Later, the water sensitivity, fatigue cracking resistance, dynamic modulus and rut resistance performance of the resulting asphalt mixtures was evaluated. It was concluded that the new binder studied in this work improves the asphalt mixture’s performance, making it an excellent solution for paving works.
Tank 241-S-109 Grab Samples 9S-99-1 and 9S-99-2 and 9S-99-3 Analytical Results for the Final Report
International Nuclear Information System (INIS)
STEEN, F.H.
1999-01-01
This document is the final report for tank 2414-109 grab samples. Three grab samples were collected from riser 13 on July 28, 1999 and received by the 222-S laboratory on July 28, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report (Table 1). None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP (Sasaki, 1999)
Tank 241S109 Grab Samples 9S-99-1 and 9S-99-2 and 9S-99-3 Analytical Results for the Final Report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1999-11-23
This document is the final report for tank 2414-109 grab samples. Three grab samples were collected from riser 13 on July 28, 1999 and received by the 222-S laboratory on July 28, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report (Table 1). None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP (Sasaki, 1999).
International Nuclear Information System (INIS)
Evans, J.C.; Thomas, B.L.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.
1996-05-01
This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-U-109 (Tank U-109) At the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. This tank is on the Hydrogen Waste List. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases and total non-methane hydrocarbons is listed in a table. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples is also listed in the table. Detailed descriptions of the analytical results appear in the text
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Evans, J.C.
1996-05-01
This report describes the results of vapor samples taken from the headspace of waste storage tank 241-SX-109 (Tank SX-109) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5048. Samples were collected by WHC on August 1, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace
Partial replacement of Portland cement by red ceramic waste in mortars: study of pozzolanic activity
International Nuclear Information System (INIS)
Silva, A.R. da; Cabral, K.C.; Pinto, E.N. de M.G.l.
2016-01-01
The objective of this study is to analyze the pozzolanic activity of red ceramic residue on the partial replacement of Portland cement in mortars. The mortars were prepared by substituting 25% of the Portland cement for ground of ceramic residue with water cement’s factor of 0.48. The concrete used to construct the reference mortars and those with addiction was CPII-Z-32 (compound of Portland pozzolana cement). The chemical analysis and physical ceramic waste showed that this meets the requirements of NBR12653 (2014) for use as pozzolanic material. The pozzolanic activity index (IAP) obtained for the ceramic waste to twenty-eight days cure rate was 80.28%. (author)
International Nuclear Information System (INIS)
Clauss, T.W.; Ligotke, M.W.; Pool, K.H.; Lucke, R.B.; McVeety, B.D.; Sharma, A.K.; McCulloch, M.; Fruchter, J.S.; Goheen, S.C.
1995-10-01
This report describes organic analyses results from in situ samples obtained from the headspace of the Hanford waste storage Tank 241-C-109 (referred to as Tank C-109). The results described here were obtained to support safety and toxicological evaluations. Organic compounds were quantitatively determined. Thirteen organic tentatively identified compounds (TICs) were observed above the detection limit of (ca.) 10 ppbv, but standards for most of these were not available at the time of analysis, and the reported concentrations are semiquantitative estimates. In addition, the authors looked for the 40 standard TO-14 analytes. Of these, only one was observed above the 2-ppbv calibrated instrumental detection limit. However, it is believed, even though the values for dichlorodifluoromethane and trichlorofluoromethane are below the instrumental detection limit, they are accurate at these low concentrations. The six analytes account for approximately 100% of the total organic components in Tank C-109. These six organic analytes with the highest estimated concentrations are listed in Summary Table 1. Detailed descriptions of the results appear in the text
Tank characterization report for single-shell tank 241-C-109
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.
1997-05-23
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices.
Tank characterization report for single-shell tank 241-C-109
International Nuclear Information System (INIS)
Simpson, B.C.
1997-01-01
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices
Recycling of waste glass as a partial replacement for fine aggregate in concrete.
Ismail, Zainab Z; Al-Hashmi, Enas A
2009-02-01
Waste glass creates serious environmental problems, mainly due to the inconsistency of waste glass streams. With increasing environmental pressure to reduce solid waste and to recycle as much as possible, the concrete industry has adopted a number of methods to achieve this goal. The properties of concretes containing waste glass as fine aggregate were investigated in this study. The strength properties and ASR expansion were analyzed in terms of waste glass content. An overall quantity of 80 kg of crushed waste glass was used as a partial replacement for sand at 10%, 15%, and 20% with 900 kg of concrete mixes. The results proved 80% pozzolanic strength activity given by waste glass after 28 days. The flexural strength and compressive strength of specimens with 20% waste glass content were 10.99% and 4.23%, respectively, higher than those of the control specimen at 28 days. The mortar bar tests demonstrated that the finely crushed waste glass helped reduce expansion by 66% as compared with the control mix.
Final report for tank 241-BX-109, push mode cores 84 and 85
International Nuclear Information System (INIS)
Schreiber, R.D.
1996-01-01
This document summarizes the sampling activities for tank 241-BX-109. This report contains tables of the analytical results on total organic compounds and total inorganic compounds in the radioactive wastes. Tank 241-BX-109 has not been on a Watch List
International Nuclear Information System (INIS)
Pool, K.H.; Clauss, T.W.; Ligotke, M.W.
1995-06-01
This report describes inorganic and organic analyses results from in situ samples obtained from the headspace of the Hanford waste storage Tank 241-BY-109 (referred to as Tank BY-109). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Summary Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. Organic compounds were also quantitatively determined. Twenty-three organic tentatively identified compounds (TICs) were observed above the detection limit of (ca.) 10 ppbv, but standards for most of these were not available at the time of analysis, and the reported concentrations are semiquantitative estimates. In addition, we looked for the 40 standard TO-14 analytes. We observed 38. Of these, only a few were observed above the 2-ppbv calibrated instrument detection limit. The ten organic analytes with the highest estimated concentrations are listed in Summary Table 1. The ten analytes account for approximately 84% of the total organic components in Tank BY-109
49 CFR 1580.109 - Preemptive effect.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Preemptive effect. 1580.109 Section 1580.109 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION... Materials Receivers, and Private Cars § 1580.109 Preemptive effect. Under 49 U.S.C. 20106, issuance of the...
Directory of Open Access Journals (Sweden)
Omar M. Omar
2012-12-01
Full Text Available Green concrete are generally composed of recycling materials as hundred or partial percent substitutes for aggregate, cement, and admixture in concrete. Limestone waste is obtained as a by-product during the production of aggregates through the crushing process of rocks in rubble crusher units. Using quarry waste as a substitute of sand in construction materials would resolve the environmental problems caused by the large-scale depletion of the natural sources of river and mining sands. This paper reports the experimental study undertaken to investigate the influence of partial replacement of sand with limestone waste (LSW, with marble powder (M.P as an additive on the concrete properties. The replacement proportion of sand with limestone waste, 25%, 50%, and 75% were practiced in the concrete mixes except in the concrete mix. Besides, proportions of 5%, 10% and 15% marble powder were practiced in the concrete mixes. The effects of limestone waste as fine aggregate on several fresh and hardened properties of the concretes were investigated. The investigation included testing of compressive strength, indirect tensile strength, flexural strength, modulus of elasticity, and permeability. It was found that limestone waste as fine aggregate enhanced the slump test of the fresh concretes. But the unit weight concretes were not affected. However, the good performance was observed when limestone waste as fine aggregate was used in presence of marble powder.
International Nuclear Information System (INIS)
Keller, C.M.
1997-01-01
This document provides supporting calculations and equipment dedication plans for portable exhausters and ductwork installed on tanks S-109, SX-102/103, BY-105/106, S-101/102, and S-107. The exhausters will ventilate the tanks during saltwell pumping to prevent the potential accumulation of flammable gases
Waste glass as partial mineral precursor in alkali-activated slag/fly ash system
Zhang, S.; Keulen, A.; Arbi, K.; Ye, G.
2017-01-01
The feasibility of a waste glass powder residue (GP) from glass recycling as partial mineral precursor to produce alkali-activated materials is investigated. GP served as powder coal fly ash (PCFA) replacement within a reference system composed of 50% PCFA and 50% ground granulated blast furnace
International Nuclear Information System (INIS)
Scheele, R.D.; Bredt, P.R.; Sell, R.L.
1997-09-01
Water content plays a crucial role in the strategy developed by Webb et al. to prevent propagating or sustainable chemical reactions in the organic-bearing wastes stored in the 20 Organic Tank Watch List tanks at the U.S. Department of Energy''s Hanford Site. Because of water''s importance in ensuring that the organic-bearing wastes continue to be stored safely, Duke Engineering and Services Hanford commissioned the Pacific Northwest National Laboratory to investigate the effect of water partial pressure (P H2O ) on the water content of organic-bearing or representative wastes. Of the various interrelated controlling factors affecting the water content in wastes, P H2O is the most susceptible to being controlled by the and Hanford Site''s environmental conditions and, if necessary, could be managed to maintain the water content at an acceptable level or could be used to adjust the water content back to an acceptable level. Of the various waste types resulting from weapons production and waste-management operations at the Hanford Site, determined that saltcake wastes are the most likely to require active management to maintain the wastes in a Conditionally Safe condition. Webb et al. identified Tank U-105 as a Conditionally Safe saltcake tank. A Conditionally Safe waste is one that is currently safe based on waste classification criteria but could, if dried, be classified as open-quotes Unsafe.close quotes To provide information on the behavior of organic-bearing wastes, the Westinghouse Hanford Company provided us with four waste samples taken from Tank 241-U-105 (U-105) to determine the effect of P H2O on their equilibrium water content
41 CFR 109-40.103-3 - International transportation.
2010-07-01
... transportation. 109-40.103-3 Section 109-40.103-3 Public Contracts and Property Management Federal Property..., TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-3 International transportation. See 4 CFR 52.2 for a certificate required in nonuse of U.S. flag vessels or U.S...
Use of waste brick as a partial replacement of cement in mortar.
Naceri, Abdelghani; Hamina, Makhloufi Chikouche
2009-08-01
The aim of this study is to investigate the use of waste brick as a partial replacement for cement in the production of cement mortar. Clinker was replaced by waste brick in different proportions (0%, 5%, 10%, 15% and 20%) by weight for cement. The physico-chemical properties of cement at anhydrous state and the hydrated state, thus the mechanical strengths (flexural and compressive strengths after 7, 28 and 90 days) for the mortar were studied. The microstructure of the mortar was investigated using scanning electron microscopy (SEM), the mineralogical composition (mineral phases) of the artificial pozzolan was investigated by the X-ray diffraction (XRD) and the particle size distributions was obtained from laser granulometry (LG) of cements powders used in this study. The results obtained show that the addition of artificial pozzolan improves the grinding time and setting times of the cement, thus the mechanical characteristics of mortar. A substitution of cement by 10% of waste brick increased mechanical strengths of mortar. The results of the investigation confirmed the potential use of this waste material to produce pozzolanic cement.
Use of waste brick as a partial replacement of cement in mortar
International Nuclear Information System (INIS)
Naceri, Abdelghani; Hamina, Makhloufi Chikouche
2009-01-01
The aim of this study is to investigate the use of waste brick as a partial replacement for cement in the production of cement mortar. Clinker was replaced by waste brick in different proportions (0%, 5%, 10%, 15% and 20%) by weight for cement. The physico-chemical properties of cement at anhydrous state and the hydrated state, thus the mechanical strengths (flexural and compressive strengths after 7, 28 and 90 days) for the mortar were studied. The microstructure of the mortar was investigated using scanning electron microscopy (SEM), the mineralogical composition (mineral phases) of the artificial pozzolan was investigated by the X-ray diffraction (XRD) and the particle size distributions was obtained from laser granulometry (LG) of cements powders used in this study. The results obtained show that the addition of artificial pozzolan improves the grinding time and setting times of the cement, thus the mechanical characteristics of mortar. A substitution of cement by 10% of waste brick increased mechanical strengths of mortar. The results of the investigation confirmed the potential use of this waste material to produce pozzolanic cement.
Tank characterization report for single-shell tank 241-BY-109
International Nuclear Information System (INIS)
Jo, J.
1998-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-BY-109. This report supports the requirements of the Tri-Party Agreement Milestone M-44-15B
19 CFR 12.109 - Seizure and forfeiture.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure and forfeiture. 12.109 Section 12.109 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... § 12.109 Seizure and forfeiture. (a) Whenever any pre-Columbian monumental or architectural sculpture...
International Nuclear Information System (INIS)
Breuer, R.
1981-01-01
This development raises the question as to what extent a waste disposal provision clause of the first few partial construction permits has to be adapted to the factual situation that has changed. Thus the clause is factually outdated according to which the granting of an operating licence for a nuclear power station cannot be expected until the first partial construction permit for the German fuel-cycle centre is in hand. It is not only conceivable that a first partial construction permit for the German fuel-cycle centre will not be in hand at the time when the authorities will decide on a (first) operating licence to be granted for a nuclear power station under construction, but add to this the crucial fact that the condition given in the above-mentioned provision clause on waste disposal is no longer in keeping with the factual situation and the thereto adapted provision principles governing waste management. Special attention has to be given to the significance and impact of this waste disposal provision clause since the situation has changed. (orig./HP) [de
Partial replacement of the feldspar waste of flat glass ceramics for masses in white
International Nuclear Information System (INIS)
Porto, V.S.; Araujo, A.M.B.; Morais, C.R.S.; Cavalcanti, M.S.L.
2012-01-01
In all the industrial production process requires the consumption of raw materials exaggerated the traditional scarcity of incurring the same. To reverse this situation, one of the possible actions is the search for alternative technologies that aim to replace these materials by waste that exhibit similar characteristics. This study aims to verify the possibility of partially replacing feldspar by waste flat glass ceramic mass for white, since this type of waste, when subjected to high temperatures can act as a flux. For this research, initially the raw materials were characterized using the techniques of energy dispersive spectroscopy X-ray (EDX) and X-ray diffraction. Then, test pieces were prepared to be burned at temperatures between 1000 and 1250 ° C, which were submitted to tests of porosity to absorb water. The results are within the standards required by the standards established for ceramic products, which confirms the feasibility of such waste to act as a flux in ceramic white masses. (author)
Determination of Intrinsic Permeability for Packed Waste of Indonesian Solid Waste
Directory of Open Access Journals (Sweden)
Benno Rahardyan
2010-11-01
Full Text Available Gas permeability and intrinsic permeability are the major parameters to promote aeration for packed waste. The objectives of this research are to identify physical parameters of gas transfer from a various type of packed wastes and examine ventilation design theory for landfill to enhance waste stabilization. Method to determine value of gas permeability and intrinsic permeability for packed waste is by flushing the packed column containing various type and physical characteristics of wastes with an air pump. Permeability was calculated by measuring pressure gradient on sampling points of the column using inclined manometer at distance 10 cm, 23 cm, 46 cm, 69 cm, 92 cm and 115 cm from origin. Gas permeability is specifically relied on physical parameters of wastes as follows, density, moisture content, particle size and gas velocity on the surface of compacted waste layer. Compost has finer pore structure and smaller pore size than leaves as well as mixed organic (65% and inorganic wastes (35%. The experiment found the intrinsic permeability of leaves waste are in the order of 10-11 to 10-8 m2, 10-11 to 10-9 m2 for compost and 10-9 m2 for mixed organic (65% and inorganic wastes (35%.
41 CFR 109-40.305-50 - Negotiations involving national security.
2010-07-01
... national security. 109-40.305-50 Section 109-40.305-50 Public Contracts and Property Management Federal... Management § 109-40.305-50 Negotiations involving national security. Title 49 U.S.C., section 10721(b)(2... rate established * * * for transportation provided to the U.S. Government would endanger the National...
Directory of Open Access Journals (Sweden)
Md. Juwel Rana
2017-02-01
Full Text Available Urban household solid waste (HSW is well-known, but has little knowledge about the rural areas and sub-cities. The quest of the study was to investigate current HSW management system and people’s attitude towards it’s at Sitakunda Upazila. The study was conducted through a semi-structured questionnaire survey by interviewing 150 households from 3 different socioeconomic groups. The results showed that on an average each household generated 1.26 kg/day wastes which stands at 0.24 kg/person/day in the study area. However, HSW generation is positively correlated with family size (rxy=0.991, p˂0.05, average age of family members (rxy=0.455, p˂0.01, and monthly earnings (rxy=0.999, p˂0.01 of the households. Amidst the various categories of wastes, vegetable and food wastes (VFWs were identified as the highest value 68.4%. In contrast, 24.6% of the generated wastes were recyclable and 75.4% non-recyclable; 82.1% organic and 17.9% inorganic. A large percentage of sampled households opined that present HSW management involves merely partial collection that is also irregular in urban areas but absent in rural areas. Unfair HSW collection was noticed by 58.7% and partial source segregation is also rare 14%. Besides, 42.7% people were found to dispose their daily generated wastes by open dumping and 25.3% nearby lagoon. A large number of people were dissatisfied 68% and only 6.7% were satisfied with the existing HSW management system. In addition, most of the people encountered bad odor problems by 28.7% and wastes spread on roadside by 38%. Significant quantity of recyclable wastes was noticed to collect from households by hawkers/scraps in the study area and very few household were found to use VFWs with cow-dung to generate biogas.INTERNATIONAL JOURNAL OF ENVIRONMENT Volume-6, Issue-1, Dec-Feb 2016/17, page: 58-75
International Nuclear Information System (INIS)
Reynolds, Jacob G.
2013-01-01
Partial molar properties are the changes occurring when the fraction of one component is varied while the fractions of all other component mole fractions change proportionally. They have many practical and theoretical applications in chemical thermodynamics. Partial molar properties of chemical mixtures are difficult to measure because the component mole fractions must sum to one, so a change in fraction of one component must be offset with a change in one or more other components. Given that more than one component fraction is changing at a time, it is difficult to assign a change in measured response to a change in a single component. In this study, the Component Slope Linear Model (CSLM), a model previously published in the statistics literature, is shown to have coefficients that correspond to the intensive partial molar properties. If a measured property is plotted against the mole fraction of a component while keeping the proportions of all other components constant, the slope at any given point on a graph of this curve is the partial molar property for that constituent. Actually plotting this graph has been used to determine partial molar properties for many years. The CSLM directly includes this slope in a model that predicts properties as a function of the component mole fractions. This model is demonstrated by applying it to the constant pressure heat capacity data from the NaOH-NaAl(OH 4 H 2 O system, a system that simplifies Hanford nuclear waste. The partial molar properties of H 2 O, NaOH, and NaAl(OH) 4 are determined. The equivalence of the CSLM and the graphical method is verified by comparing results detennined by the two methods. The CSLM model has been previously used to predict the liquidus temperature of spinel crystals precipitated from Hanford waste glass. Those model coefficients are re-interpreted here as the partial molar spinel liquidus temperature of the glass components
Waste analysis plan for 222-S dangerous and mixed waste storage area
International Nuclear Information System (INIS)
Warwick, G.J.
1994-01-01
The 222-S Laboratory Complex, in the southeast corner of the 200 West Area, consists of the 222-S Laboratory, the 222-SA Standards Laboratory, and several ancillary facilities. Currently, 222-S Laboratory activities are in supporting efforts to characterize the waste stored in the 200 Areas single shell and double shell tanks. Besides this work, the laboratory also provides analytical services for waste-management processing plants, Tank Farms, B Plant, 242-A Evaporator Facility, Plutonium-Uranium Extraction Plant, Plutonium Finishing Plant, Uranium-Oxide Plant, Waste Encapsulation Storage Facility, environmental monitoring and surveillance programs, and activities involving essential materials and research and development. One part of the 222-SA Laboratory prepares nonradioactive standards for the 200 Area laboratories. The other section of the laboratory is used for cold (nonradioactive) process development work and standards preparation. The 219-S Waste Handling Facility has three storage tanks in which liquid acid waste from 222-S can be received, stored temporarily, and neutralized. From this facility, neutralized waste, containing radionuclides, is transferred to the Tank Farms. A 700-gallon sodium-hydroxide supply tank is also located in this facility. This plan provides the methods used to meet the acceptance criteria required by the 204-AR Waste Receiving Facility
Partial Molar Volumes of Air-Component Gases in Several Liquid n-Alkanes and 1-Alkanols at 313.15 K
Czech Academy of Sciences Publication Activity Database
Izák, Pavel; Cibulka, I.; Heintz, A.
1995-01-01
Roč. 109, č. 2 (1995), s. 227-234 ISSN 0378-3812 Keywords : data density * partial molar volume * gas -liquid mixture Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.024, year: 1995
Military Wastes-to-Energy Applications,
1980-11-01
6 Residual) and Used Oil ( Automotive Crankcase Drainings) .......... ........................ 109 60 Properties of Coal: Bituminous, Subbituminous...facilities Physical/Chemical e Biomass removal from forest land may upset the Environment natural balance of terrestrial, aquatic, and atmospheric...ripout wastes (asbestos), sand- blasting wasts (organotin), and welding wastes (acetylene sludge); * Miscellaneous aircraft repair wastes -- brake
Radiochemical separation of cadmium-109
International Nuclear Information System (INIS)
Egamediev, S.; Mukhtarov, A.; Nurbaeva, D.; Rakhmanov, A.
2006-01-01
Full text: Cadmium-109 has a half-life of 461.9 days and decays by electron capture to 109 Ag with the emission of 88 keV γ-ray (3.79%) along with the characteristic X-ray from the K level of Ag, with energy of 22.5 keV. This radionuclide has found widespread use as a photon source in x-ray fluorescence analysis devices employed in industry for numerous applications such as the direct determination of gold in ores, the analysis of metals and identification of steels. Other applications range from its use as an electron source for measurement of densities of air-pollution samples, to tracer studies in mushrooms and mice and rats. In the nuclear medicine field there is growing interest in employing 109 Cd in a 109 Cd/ 109mA g generator, as an alternative to other biomedical generators of ultra short-lived gamma emitters. There are several methods for the production of 109 Cd in literature: 1. Bombardment of silver cyclotron target via 109 Ag(d,2n) 109 Cd reaction with 16 MeV deuterons. 2. Bombardment of natural silver target via 109 Ag(p,n) 109 Cd reaction with 14 MeV protons. 3. Proton bombardment of natural indium target with 96 MeV protons. 4. Irradiation of enriched 107 Ag target in high-flux nuclear reactor at neutron flux 2x10 15 n·cm -2 ·s -1 via 107 Ag(n,γ) 108 Ag → 108 Cd (n,γ) 109 Cd reaction. 5. Irradiation of enriched 108 Cd target in nuclear reactor at neutron flux 1x10 14 n·cm -2 ·s -1 via 108 Cd (n,γ) 109 Cd reaction. The production of 109 Cd with proton beam via 109 Ag(p,n) 109 Cd reaction is ideal for the cyclotron U-150, since it is not required the change of the regime for the machine functioning. Because of its relatively long half-life the time required for separation is also not an important factor, but its use as an X-ray source requires a very high radiochemical purity. In the present work we studied two methods for separation of 109 Cd from model solution of silver targets. First method is based on precipitation of silver as
A comprehensive analysis of contaminant transport in the vadose zone beneath tank SX-109
International Nuclear Information System (INIS)
Ward, A.L.; Gee, G.W.; White, M.D.
1997-02-01
The Vadose Zone Characterization Project is currently investigating the subsurface distribution of gamma-emitting radionuclides in S and SX Waste Management Area (WMA-S-SX) located in the 200 West Area of the US Department of Energy's Hanford Site in southeastern Washington State. Spectral-gamma logging of boreholes has detected elevated 137 Cs concentrations as deep as 38 m, a depth considered excessive based on the assumed geochemistry of 137 Cs in Hanford sediments. Routine groundwater sampling under the Resource Conservation and Recovery Act (RCRA) have also detected elevated levels of site-specific contaminants downgradient of WMA-S-SX. The objective of this report is to explore the processes controlling the migration of 137 Cs, 99 Tc, and NO 3 through the vadose zone of WMA-S-SX, particularly beneath tank SX-109
Hazardous waste and environmental trade: China`s issues
Energy Technology Data Exchange (ETDEWEB)
Ma Jiang [National Research Center for Science and Technology for Development, Beijing (China)
1996-12-31
By presenting some case studies, this paper analyzes China`s situation with regard to hazardous waste: its environmental trade, treatment, and management. The paper describes China`s experiences with the environmental trade of hazardous waste in both the internal and international market. Regulations for managing the import of waste are discussed, as are China`s major approaches to the trading of hazardous waste both at home and overseas. The major reasons for setting up the Asian-Pacific Regional Training Center for Technology Transfer and Environmental Sound Management of Wastes in China and the activities involved in this effort are also described. 1 tab.
M.S.Sigyn - Simbol of Sweden waste transport success
International Nuclear Information System (INIS)
Gustavson, B.; Dibek, P.
1995-01-01
The article is devoted to the presently existing system in Sweden of spent nuclear fuel and radioactive wastes maritime transportation from NPPs to places of permanent and intermediate storage. Transport casks and penals, their maintenance and control system are described. Explanatory work with public is partially also considered. 1 tab
Erratum!- in paper volume 19, Supplement 1, Year 2015, pp. S109-S115, DOI:10.2298/TSCI15S1S09C
Directory of Open Access Journals (Sweden)
Editorial
2015-01-01
Full Text Available In the paper published in THERMAL SCIENCE Volume 19, Supplement 1, YEAR 2015, pp. S109-S115, DOI REFERENCE: 10.2298/TSCI15S1S09C Names and affiliations of the authors has been incorrectly written Istead of: THE DIFFUSION MODEL OF FRACTAL HEAT AND MASS TRANSFER IN FLUIDIZED BED A Local Fractional Arbitrary Euler-Lagrange Formula by Xu CHENG∗ and Xiao-Xun MA School of Chemical Engineering, Northwest University, Xi'an, Shaanxi, China Correctly has to be written: THE DIFFUSION MODEL OF FRACTAL HEAT AND MASS TRANSFER IN FLUIDIZED BED A Local Fractional Arbitrary Euler-Lagrange Formula by Xu CHENG1∗ and Lin Wang2 - 1School of Chemical Engineering, Northwest University, Xi'an, Shaanxi, China - 2Xi'an Modern Chemistry Research Institute, Xi'an, Shaanxi, China Link to the corrected article 10.2298/TSCI15S1S09C
International Nuclear Information System (INIS)
Hild, W.
1983-01-01
After a short description of the historical background of Eurochemic, its main tasks and the various operational phases, a detailed description of the waste management principles applied is presented. The practical experience in the waste treatment is reported for both the operational phase of the reprocessing plant and its decontamination and partial decommissioning after shutdown. Based on this experience and the presented data, an assessment of the practical operations is made and conclusions are drawn. Finally, recommendations are formulated both for the general waste management policy and the practical waste treatment processes in nuclear power reactors. (author)
Defense waste transportation: cost and logistics studies
International Nuclear Information System (INIS)
Andrews, W.B.; Cole, B.M.; Engel, R.L.; Oylear, J.M.
1982-08-01
Transportation of nuclear wastes from defense programs is expected to significantly increase in the 1980s and 1990s as permanent waste disposal facilities come into operation. This report uses models of the defense waste transportation system to quantify potential transportation requirements for treated and untreated contact-handled transuranic (CH-TRU) wastes and high-level defense wastes (HLDW). Alternative waste management strategies in repository siting, waste retrieval and treatment, treatment facility siting, waste packaging and transportation system configurations were examined to determine their effect on transportation cost and hardware requirements. All cost estimates used 1980 costs. No adjustments were made for future changes in these costs relative to inflation. All costs are reported in 1980 dollars. If a single repository is used for defense wastes, transportation costs for CH-TRU waste currently in surface storage and similar wastes expected to be generated by the year 2000 were estimated to be 109 million dollars. Recovery and transport of the larger buried volumes of CH-TRU waste will increase CH-TRU waste transportation costs by a factor of 70. Emphasis of truck transportation and siting of multiple repositories would reduce CH-TRU transportation costs. Transportation of HLDW to repositories for 25 years beginning in 1997 is estimated to cost $229 M in 1980 costs and dollars. HLDW transportation costs could either increase or decrease with the selection of a final canister configuration. HLDW transportation costs are reduced when multiple repositories exist and emphasis is placed on truck transport
Distal splenorenal shunt with partial spleen resection
Directory of Open Access Journals (Sweden)
Gajin Predrag
2007-01-01
Full Text Available Introduction: Hypersplenism is a common complication of portal hypertension. Cytopenia in hypersplenism is predominantly caused by splenomegaly. Distal splenorenal shunt (Warren with partial spleen resection is an original surgical technique that regulates cytopenia by reduction of the enlarged spleen. Objective. The aim of our study was to present the advantages of distal splenorenal shunt (Warren with partial spleen resection comparing morbidity and mortality in a group of patients treated by distal splenorenal shunt with partial spleen resection with a group of patients treated only by a distal splenorenal shunt. Method. From 1995 to 2003, 41 patients with portal hypertension were surgically treated due to hypersplenism and oesophageal varices. The first group consisted of 20 patients (11 male, mean age 42.3 years who were treated by distal splenorenal shunt with partial spleen resection. The second group consisted of 21 patients (13 male, mean age 49.4 years that were treated by distal splenorenal shunt only. All patients underwent endoscopy and assessment of oesophageal varices. The size of the spleen was evaluated by ultrasound, CT or by scintigraphy. Angiography was performed in all patients. The platelet and white blood cell count and haemoglobin level were registered. Postoperatively, we noted blood transfusion, complications and total hospital stay. Follow-up period was 12 months, with first checkup after one month. Results In the first group, only one patient had splenomegaly postoperatively (5%, while in the second group there were 13 patients with splenomegaly (68%. Before surgery, the mean platelet count in the first group was 51.6±18.3x109/l, to 118.6±25.4x109/l postoperatively. The mean platelet count in the second group was 67.6±22.8x109/l, to 87.8±32.1x109/l postoperatively. Concerning postoperative splenomegaly, statistically significant difference was noted between the first and the second group (p<0.05. Comparing the
Radioactive wastes. Management
International Nuclear Information System (INIS)
Guillaumont, R.
2001-01-01
Many documents (journal articles, book chapters, non-conventional documents..) deal with radioactive wastes but very often this topic is covered in a partial way and sometimes the data presented are contradictory. The aim of this article is to precise the definition of radioactive wastes and the proper terms to describe this topic. It describes the main guidelines of the management of radioactive wastes, in particular in France, and presents the problems raised by this activity: 1 - goal and stakes of the management; 2 - definition of a radioactive waste; 3 - radionuclides encountered; 4 - radio-toxicity and radiation risks; 5 - French actors of waste production and management; 6 - French classification and management principles; 7 - wastes origin and characteristics; 8 - status of radioactive wastes in France per categories; 9 - management practices; 10 - packages conditioning and fabrication; 11 - storage of wastes; 12 - the French law from December 30, 1991 and the opportunities of new ways of management; 13 - international situation. (J.S.)
48 CFR 1.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.
2010-10-01
...-related dollar thresholds-adjustment for inflation. 1.109 Section 1.109 Federal Acquisition Regulations..., Issuance 1.109 Statutory acquisition-related dollar thresholds—adjustment for inflation. (a) 41 U.S.C. 431a... the FAR for inflation, except as provided in paragraph (c) of this section. This adjustment is...
Use of wasted foundry sand (WFS) as a partial substitute for silica in a soda lime glass
International Nuclear Information System (INIS)
Martin, A.C.; Ueno, O.K.; Folgueras, M.V.
2016-01-01
The waste foundry sand (WFS) is the main waste generates in foundry industries. Studies in the literature suggest the use of WFS in different materials, such as concrete, brick or asphalt. This work aims to partially replace the silica of a soda-lime glass by the WFS. The waste foundry sand has in its composition elements such as iron and aluminum that can affect the glass quality, which justifies the residue processing to reduce the impurity content. The treatments, that included mechanical agitation and thermal treatment, resulted in a slight decrease in the percent of iron with consequent increase of the silica content. After treatment, some sands were incorporated into the glass, that showed green color but with lower absorption intensity for the sand with less iron content. It was observed that it's possible to obtain glasses using WFS, however, there is difficulty in color controlling. (author
Why are our children wasting: Determinants of wasting among under 5s in Ghana.
Darteh, Eugene Kofuor Maafo; Acquah, Evelyn; Darteh, Florie
2017-09-01
Wasting is one of the indicators of malnutrition known to contribute to the deaths occurring from childhood malnutrition. It is the measure of body mass in relation to body length used to explain recent nutritional status. This paper examines the determinants of wasting among under 5s in Ghana. Data were drawn from the 2014 Ghana Demographic and Health Survey children's records file to examine the determinants of wasting among children. A total of 2720 children under 5 years with valid anthropometric data were used. Data on wasting were collected by measuring the weight and height of all children under 5 years of age. Bi-variate and multi-variate statistics are used to examine the determinants of wasting. The bi-variate analysis showed significant differences ( p 5s according to age of the child, region, and wealth status. On the other hand, the multi-variate analysis revealed that the odds of wasting were lower among children aged 24-35 months (Odds ratio (OR) = 0.37; p 5s. Also, efforts should be made by the relevant government agencies and other stakeholders to strengthen the socio-economic status of mothers to enable them to provide adequate nutrition and improve access to health insurance for their children in order to reduce the incidence of wasting among these children.
The S-curve for forecasting waste generation in construction projects.
Lu, Weisheng; Peng, Yi; Chen, Xi; Skitmore, Martin; Zhang, Xiaoling
2016-10-01
Forecasting construction waste generation is the yardstick of any effort by policy-makers, researchers, practitioners and the like to manage construction and demolition (C&D) waste. This paper develops and tests an S-curve model to indicate accumulative waste generation as a project progresses. Using 37,148 disposal records generated from 138 building projects in Hong Kong in four consecutive years from January 2011 to June 2015, a wide range of potential S-curve models are examined, and as a result, the formula that best fits the historical data set is found. The S-curve model is then further linked to project characteristics using artificial neural networks (ANNs) so that it can be used to forecast waste generation in future construction projects. It was found that, among the S-curve models, cumulative logistic distribution is the best formula to fit the historical data. Meanwhile, contract sum, location, public-private nature, and duration can be used to forecast construction waste generation. The study provides contractors with not only an S-curve model to forecast overall waste generation before a project commences, but also with a detailed baseline to benchmark and manage waste during the course of construction. The major contribution of this paper is to the body of knowledge in the field of construction waste generation forecasting. By examining it with an S-curve model, the study elevates construction waste management to a level equivalent to project cost management where the model has already been readily accepted as a standard tool. Copyright © 2016 Elsevier Ltd. All rights reserved.
Continuous Partial Attention as a Problematic Technology Use: A Case of Educators
Firat, Mehmet
2013-01-01
Continuous Partial Attention is a current concept open to research which, besides multitasking, intensely occupies the agenda of education, communication and cognitive psychology. The purpose of the present study was to determine educators' continuous partial attention. In line with this purpose, the research data were collected from 109 educators…
Energy Technology Data Exchange (ETDEWEB)
Scheele, R.D.; Bredt, P.R.; Sell, R.L.
1996-09-01
Some of Hanford`s underground waste storage tanks contain Organic- bearing high level wastes that are high priority safety issues because of potentially hazardous chemical reactions of organics with inorganic oxidants in these wastes such as nitrates and nitrites. To ensure continued safe storage of these wastes, Westinghouse Hanford Company has placed affected tanks on the Organic Watch List and manages them under special rules. Because water content has been identified as the most efficient agent for preventing a propagating reaction and is an integral part of the criteria developed to ensure continued safe storage of Hanford`s organic-bearing radioactive tank wastes, as part of the Organic Tank Safety Program the Pacific Northwest National Laboratory developed and demonstrated a simple and easily implemented procedure to determine the equilibrium water content of these potentially reactive wastes exposed to the range of water vapor pressures that might be experienced during the wastes` future storage. This work focused on the equilibrium water content and did not investigate the various factors such as @ ventilation, tank surface area, and waste porosity that control the rate that the waste would come into equilibrium, with either the average Hanford water partial pressure 5.5 torr or other possible water partial pressures.
USE OF CANDEIA’S (Eremanthus erythropappus WASTE WOOD
Directory of Open Access Journals (Sweden)
Rosimeire Cavalcante dos Santos
2008-09-01
Full Text Available The candeia (Eremanthus erythropappus is a native forest species with multiple uses and specially utilized as essential oils source. The use of the candeia´s waste wood after oil extraction for particle panels production becomes a viable alternative, avoiding environmental problems and increasing the availability of these products in the consuming market. This work verified the viability of producing wood-cement panels using waste wood generated after the extraction of candeia’s oil, in association with pinus and eucalipto woods. The experiment was installed according to a completely randomized design with three repetitions. The treatments were arranged according to a factorial 2 x 3 scheme (two wooden species and three replacement percentages of the woods by candeia’s waste. The results of the physical and mechanical property tests showed high potentiality of candeia waste wood, after oil extraction, in association with pinus and eucalipto wood for manufacturing wood-cement panels.
A Review of Partial Replacement of Cement with some Agro Wastes
African Journals Online (AJOL)
user
INTRODUCTION. The high cost of cement, ... Research on alternative to cement, has so far centred on the partial ... MATERIALS AND METHODS .... 2 : Compound Composition of Acha Husk Ash (AHA) Mixed with Cement(C). Using. Bogue's ...
40 CFR 59.109 - Circumvention.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Circumvention. 59.109 Section 59.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Compound Emission Standards for Automobile Refinish Coatings § 59.109 Circumvention. Each manufacturer and...
Ferrocyanide safety project: Comparison of actual and simulated ferrocyanide waste properties
International Nuclear Information System (INIS)
Scheele, R.D.
1995-10-01
In 1995, available subsegment samples of wastes taken from the Hanford Site underground radioactive waste storage tanks 241-C-112 (C-112) and 241-C-109 (C-109) were reanalyzed to determine the nickel concentrations in the samples and to determine whether the use of a nickel crucible in the analytical sample preparation biased the reported nickel concentrations reported by Simpson and coworkers and in the original report that this report supplements. The reanalysis strategy to determine nickel was to use a sodium peroxide flux in a zirconium crucible instead of the previously used potassium hydroxide flux in a nickel crucible. This supplemental report provides the results of the reanalyses and updates tables from the original report which reflect the new nickel analyses. Nickel is important with respect to management of the potentially reactive ferrocyanide wastes as it is one of the key defining characteristics of the solids that resulted from scavenging radiocesium using ferrocyanides. In Hanford Site wastes, few other processes introduced nickel into the wastes other than radiocobalt scavenging, which was often coupled with the ferrocyanide-scavenging process. Thus the presence of nickel in a waste provides strong evidence that the original waste was or contained ferrocyanide waste at one time. Given the potential import of nickel as a defining characteristic and marker for ferrocyanide wastes, the Pacific Northwest Laboratory's (PNL) Analytical Chemistry Laboratory (ACL) reanalyzed available samples from tanks C-112 and C-109 using inductively coupled argon plasma/atomic emission spectrometry (ICP/AES) and an alternative sample preparation method which precluded contamination of the analytical samples with nickel
Waste minimization -- Hanford`s strategy for sustainability
Energy Technology Data Exchange (ETDEWEB)
Merry, D.S.
1998-01-30
The Hanford Site cleanup activity is an immense and challenging undertaking, which includes characterization and decommissioning of 149 single-shell storage tanks, treating waste stored in 28 double-shell tanks, safely disposing of over 2,100 metric tons of spent nuclear fuel stored onsite, removing thousands of structures, and dealing with significant solid waste, groundwater, and land restoration issues. The Pollution Prevention/Waste Minimization (P2/WMin) Program supports the Hanford Site mission to safely clean up and manage legacy waste and to develop and deploy science and technology in many ways. Once such way is through implementing and documenting over 231 waste reduction projects during the past five years, resulting in over $93 million in cost savings/avoidances. These savings/avoidances allowed other high priority cleanup work to be performed. Another way is by exceeding the Secretary of Energy`s waste reduction goals over two years ahead of schedule, thus reducing the amount of waste to be stored, treated and disposed. Six key elements are the foundation for these sustained P2/WMin results.
2010-07-01
... motor vehicle operators with appropriate instructions regarding the use and protection of credit cards... 38-MOTOR EQUIPMENT MANAGEMENT 38.8-Standard Form 149, U.S. Government National Credit Card § 109-38... the administrative control of fleet credit cards. Administrative control shall include, as a minimum...
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 109.2 Section 109.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS CRITERIA FOR STATE, LOCAL AND REGIONAL OIL REMOVAL CONTINGENCY PLANS § 109.2 Definitions. As used in these guidelines, the...
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false CMS. 500.109 Section 500.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRANSPORTATION INFRASTRUCTURE MANAGEMENT MANAGEMENT AND MONITORING SYSTEMS Management Systems § 500.109 CMS. (a) For purposes of this part, congestion means the level at...
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination. 109.6 Section 109.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS CRITERIA FOR STATE, LOCAL AND REGIONAL OIL REMOVAL CONTINGENCY PLANS § 109.6 Coordination. For the purposes of coordination...
2010-01-01
... 7 Agriculture 9 2010-01-01 2009-01-01 true Milk. 1160.109 Section 1160.109 Agriculture Regulations... Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order Definitions § 1160.109 Milk. Milk means any class of cow's milk produced in the United States. ...
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Information. 69.109 Section 69.109... Computation of Charges § 69.109 Information. (a) A charge shall be assessed upon all interexchange carriers..., the projected annual revenue requirement for the Information element shall be divided by 12 to compute...
Energy Technology Data Exchange (ETDEWEB)
Silva, A.R. da; Cabral, K.C.; Pinto, E.N. de M.G.l., E-mail: kleber.cabral@ufersa.edu.br [Universidade Federal Rural do Semi-Arido (UFERSA), Mossoro, RN (Brazil)
2016-07-01
The objective of this study is to analyze the pozzolanic activity of red ceramic residue on the partial replacement of Portland cement in mortars. The mortars were prepared by substituting 25% of the Portland cement for ground of ceramic residue with water cement’s factor of 0.48. The concrete used to construct the reference mortars and those with addiction was CPII-Z-32 (compound of Portland pozzolana cement). The chemical analysis and physical ceramic waste showed that this meets the requirements of NBR12653 (2014) for use as pozzolanic material. The pozzolanic activity index (IAP) obtained for the ceramic waste to twenty-eight days cure rate was 80.28%. (author)
2010-01-01
... Mammals Animal Health and Husbandry Standards § 3.109 Separation. Marine mammals, whenever known to be... in the same enclosure. Marine mammals must not be housed near other animals that cause them... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Separation. 3.109 Section 3.109...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 109.203 Section 109.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Tests, Drills, and Inspections § 109.203 Sanitation. (a) The master or person in charge shall insure that the accommodation...
Let’s limit our waste production and let’s’ sort it!
HSE Unit
2013-01-01
Let’s limit our waste production! – Why ? Preventing the production of waste is the best solution to avoid environmental issues, economic impacts and technical constraints. So, whenever you are involved in the design, manufacturing, distribution, use or dismantling of a product or an activity in general, always remember that the best waste is that which is not produced. The limitation of waste production being an HSE objective declared in 2013 by the CERN Director-General, we encourage everyone to help limit the amount of waste produced through CERN activities. Let’s sort it! – Why ? Since the 90s, CERN has implemented a policy to promote recovery of the waste* generated by its activities. Nowadays, CERN is committed to continuously improving its sorting and recovery and therefore various initiatives have been started by GS-IS to improve the recovery of waste (e.g. recovery of organic waste from restaurants; implementation of solar trash compactors - see Bulletin 27-...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery. 207.109 Section 207.109 Customs Duties... and Committee Proceedings § 207.109 Discovery. (a) Discovery methods. All parties may obtain discovery under such terms and limitations as the administrative law judge may order. Discovery may be by one or...
2010-04-01
... SWITZERLAND General Income Tax § 509.109 Interest. The rate of United States tax imposed by the Internal Revenue Code of 1954 upon interest on bonds, securities, notes, debentures, or on any other form of... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Interest. 509.109 Section 509.109 Internal...
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Settlements. 15.109 Section 15.109... Act of 1958 § 15.109 Settlements. (a) A publisher may not settle a claim with another party, for which... publisher submits a copy of the proposed settlement, and a statement justifying the settlement, to the Chief...
Wow Technology’s innovative radioactive liquid waste treatment
Energy Technology Data Exchange (ETDEWEB)
Marin, A.
2015-07-01
WOW presents its revolutionary technology and equipment for liquid radioactive waste treatment: outperforming ultimate water decontamination and purification process, enhanced sludge concentration, no secondary waste nor consumables, fully automated, remote controlled and self-decontaminating device. The WOW’s technology is based upon a never before observed discovery of fluid dynamics science: the possibility of performing a molecular separation between solute and suspended elements and the solvent. The combination of such a molecular separation process with a standard vacuum evaporation improves the abatement performances by thousands of times, with respect to those of the state of the art vacuum evaporators. In addition to this, no secondary waste is produced during the process, as no filters, membranes, resins or additives are used. WOW equipment, automated and remote controlled, self decontaminates after use and can be designed and constructed either tailored to the application needs or with a modular approach for enhanced transportability and application flexibility. After the preliminary verification by CNR, the Italian National Research Center, Wow Technology decontamination device was tested c/o LENA, the Laboratory of Applied Nuclear Energy of the University of Pavia, Italy with a simulated solution 6000 times more contaminated than the nuclear reactor’s cooling water of Fukushima-Daiichi NPP. In addition to that, WOW Technology was also used in a real case at the Radiochemistry laboratory of the Pavia’s University Chemistry department. Both the above mentioned contaminated fluids have been successfully decontaminated without production of additional or secondary waste WOW Technology has already performed on industrial scale c/o the Nuclear Repository of S.S.M. in Saluggia, Italy: 45000 liters of acid radioactive solution have been successfully decontaminated to a Decontamination Factor (DF) of 335000 for Cs-137 by one single evaporation step and
Nova Scotia's solid waste-resource management strategy
Energy Technology Data Exchange (ETDEWEB)
Friesen, B. [Nova Scotia Dept. of the Environment, Halifax, NS (Canada)
2000-07-01
The efforts that the province of Nova Scotia has made to establish a sustainable economy and environment were discussed. In 1989, the province of 930,000 people generated about 630,000 tonnes of municipal waste annually. At the time, there were no recycling or recovery facilities. The province's 1995 Solid Waste-Resource Management Strategy has changed this around with the following key measures: a commitment to 50 per cent diversion of solid waste by 2000, regionalisation to optimize costs, an expanded deposit-refund system for all beverage containers, increased disposal standards for landfilling/incineration, industry example for waste products, support for economic opportunities in resource recovery, and bans on the disposal of recyclable wastes. These measures have produced dramatic results in trying to balance resource supply with demand. The materials sectors which are examples of the strategy's success include fibre, used tires, plastics and composting.
International Nuclear Information System (INIS)
1995-01-01
The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission
Biomedical silver-109m isotope generator
Wanek, Philip M.; Steinkruger, Frederick J.; Moody, David C.
1987-01-01
A method, composition of matter, and apparatus for producing substantially pure Ag-109m for use in biomedical imaging techniques. Cd-109, which decays with a half-life of 453 days to Ag-109m is loaded onto an ion exchange column consisting of particulate tin phosphate. After secular equilibrium is reached in about ten minutes, Ag-109m may be selectively eluted from the column by means of a physiologically acceptable aqueous buffered eluent solution of sodium thiosulfate, and either ascorbic acid or dextrose. The breakthrough of toxic Cd-109 is on the order of 1.times.10.sup.-7, which is sufficiently low to permit administration of the Ag-109m-containing eluate, with but a minor pH adjustment, directly to a human patient within a matter of seconds.
Characterization of Vadose Zone Sediment: Borehole 41-09-39 in the S-SX Waste Management Area
Energy Technology Data Exchange (ETDEWEB)
Serne, R. Jeffrey; Last, George V.; Schaef, Herbert T.; Lanigan, David C.; Lindenmeier, Clark W.; Ainsworth, Calvin C.; Clayton, Ray E.; Legore, Virginia L.; O' Hara, Matthew J.; Brown, Christopher F.; Orr, Robert D.; Kutnyakov, Igor V.; Wilson, Teresa C.; Wagnon, Kenneth B.; Williams, Bruce A.; Burke, Deborah S.
2008-09-11
This report was revised in September 2008 to remove acid-extractable sodium data from Table 5.15. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in February 2002. The overall goal of the of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities. To meet this goal, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediment from within the S-SX Waste Management Area. This report is one in a series of four reports to present the results of these analyses. Specifically, this report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from borehole 41-09-39 installed adjacent to tank SX-109.
First observation of 109Te β+ and electron capture decay to levels of 109Sb
International Nuclear Information System (INIS)
Ressler, J.J.; Walters, W.B.; Shergur, J.; Davids, C.N.; Heinz, A.; Seweryniak, D.; Dean, D.J.; Hjorth-Jensen, M.
2002-01-01
Low-spin levels in 109 Sb populated by 109 Te beta decay are reported for the first time. Seven new levels are proposed, two below 1 MeV excitation energy. Spins and parities of (1/2 + ) and (3/2 + ,5/2 + ) are suggested for the low energy levels by comparison to beta feeding intensities and systematics. These results are compared with new calculated levels for 109 Sb
23 CFR 645.109 - Preliminary engineering.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Preliminary engineering. 645.109 Section 645.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS UTILITIES Utility Relocations, Adjustments, and Reimbursement § 645.109 Preliminary engineering. (a) As...
Energy Technology Data Exchange (ETDEWEB)
Jager, J.; Lohf, A.; Herr, C. [Institut WAR, Darmstadt (Germany)
1998-12-31
The technical code on municipal waste makes specific demands on waste to be deposited at landfills which can only be met if mechanical-biological conditioning of waste as well as thermal processing of partial waste fractions are continued also in the future. But waste that has undergone mechanical or mechanical-biological conditioning presents different combustion properties from those of unconditioned waste. In this second stage of the research project, the thermal processability of waste having undergone mechanical or mechanical-biological conditioning was studied. Together with the results from the first project stage, where the throughput represented exclusively mechanically conditioned material, the results of the latter measuring campaigns comprehensively demonstrate possibilities for the thermal processing of partial waste fractions having undergone biological-mechanical conditioning, and inform on changes in plant performance. (orig.) [Deutsch] Um die in der TA-Siedlungsabfall an den abzulagernden Restmuell gestellten Deponieeingangsbedingungen zu erfuellen, muss neben einer mechanisch-biologischen Aufbereitung bei Teilfraktionen auch weiterhin eine thermische Behandlung eingeplant werden. Die Verbrennungseigenschaften von mechanisch oder mechanisch-biologisch vorbehandeltem Restmuell weichen allerdings von denen von unbehandeltem Restmuell ab. In dieser zweiten Projektphase des Forschungsvorhabens wurde eine Untersuchung bezueglich der thermischen Behandelbarkeit von mechanisch und auch biologisch vorbehandeltem Muell durchgefuehrt. Die Ergebnisse der Messkampagnen bilden zusammen mit den Ergebnissen der ersten Projektphase, in der ausschliesslich mechanisch vorbehandeltes Material durchgesetzt wurde, eine umfassende Darstellung ueber Moeglichkeiten und veraenderte Anlagenverhalten bei der thermischen Behandlung von Teilfraktionen aus der biologisch-mechanisch Vorbehandlung. (orig.)
Ferrocyanide Safety Project: Comparison of actual and simulated ferrocyanide waste properties
International Nuclear Information System (INIS)
Scheele, R.D.; Burger, L.L.; Sell, R.L.; Bredt, P.R.; Barrington, R.J.
1994-09-01
In the 1950s, additional high-level radioactive waste storage capacity was needed to accommodate the wastes that would result from the production of recovery of additional nuclear defense materials. To provide this additional waste storage capacity, the Hanford Site operating contractor developed a process to decontaminate aqueous wastes by precipitating radiocesium as an alkali nickel ferrocyanide; this process allowed disposal of the aqueous waste. The radiocesium scavenging process as developed was used to decontaminate (1) first-cycle bismuth phosphate (BiPO 4 ) wastes, (2) acidic wastes resulting from uranium recovery operations, and (3) the supernate from neutralized uranium recovery wastes. The radiocesium scavenging process was often coupled with other scavenging processes to remove radiostrontium and radiocobalt. Because all defense materials recovery processes used nitric acid solutions, all of the wastes contained nitrate, which is a strong oxidizer. The variety of wastes treated, and the occasional coupling of radiostrontium and radiocobalt scavenging processes with the radiocesium scavenging process, resulted in ferrocyanide-bearing wastes having many different compositions. In this report, we compare selected physical, chemical, and radiochemical properties measured for Tanks C-109 and C-112 wastes and selected physical and chemical properties of simulated ferrocyanide wastes to assess the representativeness of stimulants prepared by WHC
Bari, Di M.A.; Nonno, R.; Castilla, J.; Augostino, D' C.; Pirisinu, L.; Riccardi, G.; Conte, M.; Richt, J.A.; Kunkle, R.; Langeveld, J.P.M.; Vaccari, G.; Agrimi, U.
2013-01-01
In order to assess the susceptibility of bank voles to chronic wasting disease (CWD), we inoculated voles carrying isoleucine or methionine at codon 109 (Bv109I and Bv109M, respectively) with CWD isolates from elk, mule deer and white-tailed deer. Efficient transmission rate (100%) was observed with
41 CFR 109-38.502 - Guidelines.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Guidelines. 109-38.502 Section 109-38.502 Public Contracts and Property Management Federal Property Management Regulations System... 38-MOTOR EQUIPMENT MANAGEMENT 38.5-Scheduled Maintenance § 109-38.502 Guidelines. ...
International Nuclear Information System (INIS)
Zaslawsky, M.; Kennedy, W.N.
1992-01-01
Mathematical solutions to the problem consisting of a partially-full waste tank subjected to seismic loading, embedded in soil, is classically difficult in that one has to address: soil-structure interaction, fluid-structure interaction, non-linear behavior of material, dynamic effects. Separating the problem and applying numerous assumptions will yield approximate solutions. This paper explores methods for generating these solutions accurately
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering. 105-1.109 Section 105-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.109 Numbering. ...
46 CFR 109.564 - Maneuvering characteristics.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Maneuvering characteristics. 109.564 Section 109.564 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.564 Maneuvering characteristics. (a) The master or person in charge of each...
7 CFR 1220.109 - Eligible organization.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1220.109 Section 1220.109... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.109 Eligible organization. The term eligible organization means any organization which has been certified by the Secretary pursuant to...
Ahmad, Shamsad; Hakeem, Ibrahim; Maslehuddin, Mohammed
2014-01-01
In the exploratory study presented in this paper, an attempt was made to develop different mixtures of ultrahigh performance concrete (UHPC) using various locally available natural and industrial waste materials as partial replacements of silica fume and sand. Materials such as natural pozzolana (NP), fly ash (FA), limestone powder (LSP), cement kiln dust (CKD), and pulverized steel slag (PSS), all of which are abundantly available in Saudi Arabia at little or no cost, were employed in the de...
Uncertainties in sealing a nuclear waste repository in partially saturated tuff
International Nuclear Information System (INIS)
Tillerson, J.R.; Fernandez, J.A.; Hinkebein, T.E.
1989-01-01
Sealing a nuclear waste repository in partially saturated tuff presents unique challenges to assuring performance of sealing components. Design and performance of components for sealing shafts, ramps, drifts, and exploratory boreholes depend on specific features of both the repository design and the site; of particular importance is the hydrologic environment in the unsaturated zone, including the role of fracture flow. Repository design features important to sealing of a repository include the size and location of shaft and ramp accesses, excavation methods, and the underground layout features such as grade (drainage direction) and location relative to geologic structure. Uncertainties about seal components relate to the postclosure environment for the seals, the emplacement methods, the material properties, and the potential performance of the components. An approach has been developed to reduce uncertainties and to increase confidence in seal performance; it includes gathering extensive site characterization data, establishing conservative design requirements, testing seal components in laboratory and field environments, and refining designs of both the seals and the repository before seals are installed. 9 refs., 5 figs., 2 tabs
Status of U.S. nuclear waste disposal programs
International Nuclear Information System (INIS)
Eastering, J.B.
1987-01-01
Since the days of the Manhattan Project in the early 1940's, the United States has recognized the need for a system of effective nuclear waste management. The evolution of that system has been directed by a series of legislative actions to determine responsibilities and develop procedures. Under these laws, the U.S. Department of Energy (DOE), as the lead agency, is required to plan and implement the programs that will ensure safe and efficient management of nuclear wastes from both civilian and defense activities. This overview paper describes the organization of these programs
46 CFR 109.577 - Helicopter fueling.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Helicopter fueling. 109.577 Section 109.577 Shipping... Miscellaneous § 109.577 Helicopter fueling. (a) The master or person in charge shall designate persons to conduct helicopter fueling operations. (b) Portable tanks are handled and stowed in accordance with...
46 CFR 109.555 - Propulsion boilers.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion boilers. 109.555 Section 109.555 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.555 Propulsion boilers. The master or person in charge and the engineer in charge shall...
14 CFR 417.109 - Ground safety.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...
49 CFR 229.109 - Safety valves.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Safety valves. 229.109 Section 229.109..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Steam Generators § 229.109 Safety valves. Every steam generator shall be equipped with at least two safety valves that have a...
41 CFR 109-43.001 - Definition.
2010-07-01
... PERSONAL PROPERTY § 109-43.001 Definition. DOE screening period means the period of time that reportable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definition. 109-43.001 Section 109-43.001 Public Contracts and Property Management Federal Property Management Regulations System...
2010-07-01
... 38-MOTOR EQUIPMENT MANAGEMENT 38.9-Federal Motor Vehicle Fleet Report § 109-38.902 Records. The... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Records. 109-38.902 Section 109-38.902 Public Contracts and Property Management Federal Property Management Regulations System...
49 CFR 1572.109 - Mental capacity.
2010-10-01
... intelligence, mental illness, incompetence, condition, or disease, is a danger to himself or herself or to... 49 Transportation 9 2010-10-01 2010-10-01 false Mental capacity. 1572.109 Section 1572.109... ASSESSMENTS Standards for Security Threat Assessments § 1572.109 Mental capacity. (a) An applicant has mental...
46 CFR 109.521 - Cranes: General.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: General. 109.521 Section 109.521 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Cranes § 109.521 Cranes: General. The master or person in charge shall ensure that each crane is operated and...
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII
47 CFR 97.109 - Station control.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station control. 97.109 Section 97.109... SERVICE Station Operation Standards § 97.109 Station control. (a) Each amateur station must have at least one control point. (b) When a station is being locally controlled, the control operator must be at the...
Waste treatability guidance program. User`s guide. Revision 0
Energy Technology Data Exchange (ETDEWEB)
Toth, C.
1995-12-21
DOE sites across the country generate and manage radioactive, hazardous, mixed, and sanitary wastes. It is necessary for each site to find the technologies and associated capacities required to manage its waste. One role of DOE HQ Office of Environmental Restoration and Waste Management is to facilitate the integration of the site- specific plans into coherent national plans. DOE has developed a standard methodology for defining and categorizing waste streams into treatability groups based on characteristic parameters that influence waste management technology needs. This Waste Treatability Guidance Program automates the Guidance Document for the categorization of waste information into treatability groups; this application provides a consistent implementation of the methodology across the National TRU Program. This User`s Guide provides instructions on how to use the program, including installations instructions and program operation. This document satisfies the requirements of the Software Quality Assurance Plan.
Waste Heat Recovery. Technology and Opportunities in U.S. Industry
Energy Technology Data Exchange (ETDEWEB)
Johnson, Ilona [BCS, Inc., Laurel, MD (United States); Choate, William T. [BCS, Inc., Laurel, MD (United States); Davidson, Amber [BCS, Inc., Laurel, MD (United States)
2008-03-01
This study was initiated in order to evaluate RD&D needs for improving waste heat recovery technologies. A bottomup approach is used to evaluate waste heat quantity, quality, recovery practices, and technology barriers in some of the largest energyconsuming units in U.S. manufacturing. The results from this investigation serve as a basis for understanding the state of waste heat recovery and providing recommendations for RD&D to advance waste heat recovery technologies.
MANAGING HANFORD'S LEGACY NO-PATH-FORWARD WASTES TO DISPOSITION
Energy Technology Data Exchange (ETDEWEB)
WEST LD
2011-01-13
The U.S. Department of Energy (DOE) Richland Operations Office (RL) has adopted the 2015 Vision for Cleanup of the Hanford Site. This vision will protect the Columbia River, reduce the Site footprint, and reduce Site mortgage costs. The CH2M HILL Plateau Remediation Company's (CHPRC) Waste and Fuels Management Project (W&FMP) and their partners support this mission by providing centralized waste management services for the Hanford Site waste generating organizations. At the time of the CHPRC contract award (August 2008) slightly more than 9,000 m{sup 3} of waste was defined as 'no-path-forward waste.' The majority of these wastes are suspect transuranic mixed (TRUM) wastes which are currently stored in the low-level Burial Grounds (LLBG), or stored above ground in the Central Waste Complex (CWC). A portion of the waste will be generated during ongoing and future site cleanup activities. The DOE-RL and CHPRC have collaborated to identify and deliver safe, cost-effective disposition paths for 90% ({approx}8,000 m{sup 3}) of these problematic wastes. These paths include accelerated disposition through expanded use of offsite treatment capabilities. Disposal paths were selected that minimize the need to develop new technologies, minimize the need for new, on-site capabilities, and accelerate shipments of transuranic (TRU) waste to the Waste Isolation Pilot Plant (WIPP) in Carlsbad, New Mexico.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 109.329 Section 109.329 Shipping COAST GUARD... of Safety Equipment § 109.329 Fire pumps. The master or person in charge shall insure that at least one of the fire pumps required in § 108.415 is ready for use on the fire main system at all times. ...
Annual report of waste generation and pollution prevention progress 1998
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-09-01
This seventh Annual Report presents and analyzes DOE Complex-wide waste generation and pollution prevention activities at 45 reporting sites from 1993 through 1998. This section summarizes Calendar Year 1998 Complex-wide waste generation and pollution prevention accomplishments. More detailed information follows this section in the body of the Report. In May 1996, the Secretary of Energy established a 50 percent Complex-Wide Waste Reduction Goal (relative to the 1993 baseline) for routine operations radioactive, mixed, and hazardous waste generation, to be achieved by December31, 1999. DOE has achieved its Complex-Wide Waste Reduction Goals for routine operations based upon a comparison of 1998 waste generation to the 1993 baseline. Excluding sanitary waste, routine operations waste generation decreased 67 percent overall from 1993 to 1998. However, for the first time since 1994, the total amount of materials recycled by the Complex decreased from 109,600 metric tons in 1997 to 92,800 metric tons in 1998. This decrease is attributed to the fact that in 1997, several large ''one-time only'' recycling projects were conducted throughout the Complex. In order to demonstrate commitment to DOE's Complex-wide recycling goal, it is important for sites to identify all potential large-scale recycling/reuse opportunities.
Management responsible for the radioactive waste in the University of Costa Rica
International Nuclear Information System (INIS)
Mora, P.; Varela, A.
2003-01-01
Through the University Plan de Seguridad Radiologica (PSR), established in 1990, radioactive wastes generated by the University of Costa Rica (UCR) personnel are handled. They are properly collected, stroraged and disposed. The waste room is used by the following centers: Laboratorio de Fisica Nuclear Aplicada, Instituto de Investigaciones en Salud, Centro de Biologia Celular y Molecular and Centro de Investigaciones en Contaminacion Ambiental. The PSR has prestorage procedures, internal controls inside the waste room, protocols for storage, withdraw of sources, and discharges to the environment according to national and international legislation. The main radioactive wastes in liquid or solid forms contain p 32 , I 125 , S 35 y C 14 that eventually be disposed as excempted materials. The waste room stores sources with the following radionuclides Cs 137 , U 238 , Th 232 , Sr 90 , Ra 226 , Cd 109 , Cf 252 and Am 241 . It has 96 permanent sources and 52 that will be disposed. The PSR allows the University to have a centralized facility for the safe management of all radioactive waste generated locally. (Author) [es
Immobilization of organic liquid wastes
International Nuclear Information System (INIS)
Greenhalgh, W.O.
1985-01-01
This report describes a portland cement immobilization process for the disposal treatment of radioactive organic liquid wastes which would be generated in a a FFTF fuels reprocessing line. An incineration system already on-hand was determined to be too costly to operate for the 100 to 400 gallons per year organic liquid. Organic test liquids were dispersed into an aqueous phosphate liquid using an emulsifier. A total of 109 gallons of potential and radioactive aqueous immiscible organic liquid wastes from Hanford 300 Area operations were solidified with portland cement and disposed of as solid waste during a 3-month test program with in-drum mixers. Waste packing efficiencies varied from 32 to 40% and included pump oils, mineral spirits, and TBP-NPH type solvents
Performance of concrete with partial replacement of fine aggregates ...
African Journals Online (AJOL)
The study investigated the level of replacement of fine aggregate with waste glass that will result in optimal compressive strength. A total of 36 cubes were cast. 6 cubes without waste glass (control) and 30 cubes containing waste glass as partial replacement for fine aggregates at 15%, 25%, 35%, 45%, and 50%.
Trends in U.S.A. on environmental assessment of the common industrial wastes
International Nuclear Information System (INIS)
Yamauchi, Kiyoshi
1994-01-01
In Japan, the waste materials are divided to two parts of radioactive wastes and common wastes according to the law on treatment and cleaning of the wastes, and the latter is divided further to two parts of life type wastes and business type wastes. Among them, a part of wastes called the industrial wastes in the business wastes causes some troubles. In Japan, maintenance of approval level of the wastes treatment was conducted by selection of treating method due to feature of the wastes, selection of treating matters due to the treating site and method, and environmental assessment of each treatment project program. However, in U.S.A., regulation on environmental impact due to various human actions has been executed since 1960, and environmental assessment is controlled by a law. And, regulations on the wastes, the treating facilities and the formed pollution were also determined by laws. Furthermore, technical field of the environmental assessment is already executed in U.S.A. but some parts are not in Japan. On the evaluation method, there are some differences between in U.S.A. and in Japan, but are some common points in technical informations, estimating methods and so on, where future technical cooperations and movements between them in environmental assessment on both common industrial wastes and high level radioactive wastes. (G.K.)
Cairo’s Contested Garbage: Sustainable Solid Waste Management and the Zabaleen’s Right to the City
Directory of Open Access Journals (Sweden)
Wael Fahmi
2010-06-01
Full Text Available Over the decades, the Zabaleen, the traditional waste (garbage collectors of Cairo, have created what is arguably one of the world’s most efficient and sustainable resource-recovery and waste-recycling systems. Yet the continuation of this intricate relationship between community, environment and livelihood is jeopardized by the official privatization of municipal solid waste (MSW services through contracts with technology-intensive multinational corporations which threatens the sustainability of the garbage collectors’ communities by removing access to their chief economic asset, waste or garbage. The situation is exacerbated by an official policy of moving the Zabaleen and their MSW sorting, recovery, trading and recycling activities further out of the city, on the grounds that this will turn their neighbourhoods into cleaner and healthier living environments. The consumption of Cairo’s sites of MSW collection and sorting open new socio-political spaces for conflict between multi-national companies and the Zabaleen’s traditional system. This is further indicated in the way Cairo’s waste materials have been subjected to new claims and conflict, as they are seen as a ‘commodity’ by global capital entrepreneurs and multi-national corporations, and as a source of ‘livelihood’ by the disadvantaged and marginalised Zabaleen population.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurizers. 109.3 Section 109.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STERILIZATION AND PASTEURIZATION AT...
46 CFR 109.525 - Cranes: Working loads.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Working loads. 109.525 Section 109.525 Shipping... Cranes § 109.525 Cranes: Working loads. The master or person in charge shall ensure that tables... working the crane. ...
36 CFR 406.104-406.109 - [Reserved
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.104-406.109 Section 406.104-406.109 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.104-406.109 [Reserved] ...
Full Focus Needed on Finishing Hanford's Waste Treatment Plant - 12196
Energy Technology Data Exchange (ETDEWEB)
Dahl, Suzanne; Biyani, Rabindra; Holmes, Erika [Washington State Department of Ecology, Richland, WA 99354 (United States)
2012-07-01
The United States Department of Energy's (US DOE's) Hanford Nuclear Site has 177 underground waste storage tanks located 19 to 24 km (12 to 15 miles) from the Columbia River in south-central Washington State. Hanford's tanks now hold about 212,000 cu m (56 million gallons) of highly radioactive and chemically hazardous waste. Sixty-seven tanks have leaked an estimated 3,785 cu m (1 million gallons) of this waste into the surrounding soil. Further releases to soil, groundwater, and the Columbia River are the inevitable result of the tanks continuing to age. The risk from this waste is recognized as a threat to the Northwest by both State and Federal governments. US DOE and Bechtel National, Inc., are building the Waste Treatment and Immobilization Plant (WTP) to treat and vitrify (immobilize in glass) the waste from Hanford's tanks. As is usual for any groundbreaking project, problems have arisen that must be resolved as they occur if treatment is to take place as specified in the court-enforceable Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) and the Consent Decree, entered into by US DOE, the U.S. Environmental Protection Agency, and the Washington State Department of Ecology (Ecology). At times, US DOE's approach to solving these critical issues seems to have caused undue wastes of time, energy, and, ultimately, public funds. Upon reviewing the history of Hanford's tank waste treatment project, Ecology hopes that constructive criticism of past failures and praise of successes will inspire US DOE to consider changing practices, be more transparent with regulatory agencies and the public, and take a 'lean production' approach to successfully completing this project. All three Tri-Party Agreement agencies share the goal of completing WTP on time, ensuring it is operational and in compliance with safety standards. To do this, Ecology believes US DOE should: - Maintain focus on the primary goal of
Directory of Open Access Journals (Sweden)
Dorivaldo da Silva Raupp
2004-06-01
Full Text Available Starch factories generate large amounts of cassava solid waste. A small amount is utilized for animal feed but most of it is discharged with deleterious effects to the envirounment. A edible food with a high content of insoluble dietary fiber (60.9%, named "partially hidrolyzed cassava waste" (PHCW, was prepared from industrial cassava solid waste by an enzymatic process. PHCW or wheat bran (WB were fed to model rats and both promoted digestive function effects, but PHCW produced the greatest effect. The insoluble fiber constituent from PHCW (and not the soluble fiber, promoted the greatest fecal bulking, fecal weight and defecation frequency in rats, as compared to WB. Such results indicate that the partially hydrolyzed cassava waste presents digestive function properties which allow it to be used as an adequate source of insoluble dietary fiber in the formulation of functional food for human nutrition.As fecularias e polvilheiras produzem grandes quantidades de bagaço de mandioca. A proposta dessa pesquisa consistiu determinar, em ratos modelo, a propriedade funcional-digestiva do produto alimentício bagaço de mandioca hidrolisado (BMH, um concentrado de fibra alimentar (60,9%, peso seco que foi obtido a partir do bagaço de mandioca da polvilheira e através de processo de hidrólise enzimática. O BMH produziu efeitos fisiológicos no trato digestivo dos ratos modelos mais acentuados que os efeitos produzidos pelo farelo de trigo (FT. Foram os componentes insolúveis da fibra alimentar do BMH, e não a fração solúvel, os que mais contribuíram para o maior volume e peso das fezes e, por conseguinte, para o maior número de defecações. Por isso, o BMH pode ser usado como fonte alternativa de fibra alimentar para a formulação de alimentos, principalmente os consumidos por indivíduos com a finalidade de regular ou manter normal a funcionalidade digestiva.
Characterization and energy potential of food waste from catering service in Hangzhou, China.
Guo, Xiao-Hui; Sun, Fa-Qian; Sun, Ying-Jun; Lu, Hao-Hao; Wu, Wei-Xiang
2014-08-01
Safe disposal of food waste is becoming an impending issue in China with the rapid increase of its production and the promotion of environmental awareness. Food waste from catering services in Hangzhou, China, was surveyed and characterized in this study. A questionnaire survey involving 632 units across the urban districts showed that 83.5% of the food waste was not properly treated. Daily food waste production from catering units was estimated to be 1184.5 tonnes. The ratio of volatile solid to total solid, easily biodegradable matter (including crude fat, crude protein and total starch) content in total solid and the ratio of total organic carbon to nitrogen varied in ranges of 90.1%-93.9%, 60.9%-72.1%, and 11.9-19.9, respectively. Based on the methane yield of 350 mL g VS(-1) in anaerobic batch tests, annual biogas energy of 1.0 × 10(9) MJ was estimated to be recovered from the food waste. Food waste from catering services was suggested to be an attractive clean energy source by anaerobic digestion. © The Author(s) 2014.
40 CFR 57.109 - Maintenance of pay.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Maintenance of pay. 57.109 Section 57.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PRIMARY NONFERROUS SMELTER ORDERS General § 57.109 Maintenance of pay. The Administrator will not approve...
41 CFR 109-27.5006 - Stores catalogs.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stores catalogs. 109-27.5006 Section 109-27.5006 Public Contracts and Property Management Federal Property Management...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5006 Stores...
45 CFR 2490.104-2490.109 - [Reserved
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.104-2490.109 Section 2490.104-2490.109 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.104-2490.109 [Reserved] ...
International Nuclear Information System (INIS)
Scheele, R.D.; Bredt, P.R.; Sell, R.L.
1997-02-01
Water content plays a crucial role in the strategy developed by Webb et al. to prevent propagating or sustainable chemical reactions in the organic-bearing wastes stored in the 20 Organic Tank Watch List tanks at the US Department of Energy's Hanford Site. Because of water's importance in ensuring that the organic-bearing wastes continue to be stored safely, Duke Engineering and Services Hanford commissioned the Pacific Northwest National Laboratory (PNNL) to investigate the effect of water partial pressure (P H2O ) on the water content of organic-bearing or representative wastes. Of the various interrelated controlling factors affecting the water content in wastes, P H2O is the most susceptible to being controlled by the and Hanford Site's environmental conditions and, if necessary, could be managed to maintain the water content at an acceptable level or could be used to adjust the water content back to an acceptable level. Of the various waste types resulting from weapons production and waste-management operations at the Hanford Site, Webb et al. determined that saltcake wastes are the most likely to require active management to maintain the wastes in a Conditionally Safe condition. A Conditionally Safe waste is one that satisfies the waste classification criteria based on water content alone or a combination of water content and either total organic carbon (TOC) content or waste energetics. To provide information on the behavior of saltcake wastes, two waste samples taken from Tank 241-BY-108 (BY-108) were selected for study, even though BY-108 is not on the Organic Tanks Watch List because of their ready availability and their similarity to some of the organic-bearing saltcakes
41 CFR 109-27.102-1 - Applicability.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...
41 CFR 109-27.102-51 - Policy.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline. 21.109 Section 21.109 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF... Gasoline. (a) Distillation range. When 100 ml of gasoline are distilled, none shall distill below 90 °F...
Energy Technology Data Exchange (ETDEWEB)
Martin, A.C.; Ueno, O.K.; Folgueras, M.V., E-mail: amandacarolinemartin@gmail.com [Universidade do Estado de Santa Catarina (CCT/UDESC), Joinville, SC (Brazil). Centro de Ciencias Tecnologicas
2016-07-01
The waste foundry sand (WFS) is the main waste generates in foundry industries. Studies in the literature suggest the use of WFS in different materials, such as concrete, brick or asphalt. This work aims to partially replace the silica of a soda-lime glass by the WFS. The waste foundry sand has in its composition elements such as iron and aluminum that can affect the glass quality, which justifies the residue processing to reduce the impurity content. The treatments, that included mechanical agitation and thermal treatment, resulted in a slight decrease in the percent of iron with consequent increase of the silica content. After treatment, some sands were incorporated into the glass, that showed green color but with lower absorption intensity for the sand with less iron content. It was observed that it's possible to obtain glasses using WFS, however, there is difficulty in color controlling. (author.
Responsible handling of the radioactive waste at the Universidad de Costa Rica
International Nuclear Information System (INIS)
Mora Rodriguez, Patricia; Varela, Alfonso
2006-01-01
The Radiation Safety Program (RSP) of the Universidad de Costa Rica established in 1990, handles the radioactive waste generated at the University. A centralized storage waste room is used by the Centro de Investigacion en Ciencias Atomicas, Nucleares y Moleculares, Instituto de Investigacion en Salud, Centro de Investigacion en Biologia Celular y Molecular, and the Centro de Investigacion en Contaminacion Ambiental. The RSP has pre-storage procedures, internal controls, protocols for storage, withdrawal of sources and discharges to the environment, according to national and international legislation. The main radionuclides in liquid and solid wastes are P32, I125, S35 y C14; which after a storage period will be disposed of as exempted materials. The waste room also permanently stores sources with the following radionuclides Cs137, U238, Th232, Sr90, Ra226, Cd109, Cf252 and Am241. It has 96 permanent sources and 52 that will be disposed of. The RSP allows the University to have a centralized facility for the safe management of all radioactive waste generated locally. (Author)
28 CFR 39.104-39.109 - [Reserved
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.104-39.109 Section 39.104-39.109 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.104-39.109 [Reserved] ...
46 CFR 109.347 - Pilot boarding equipment.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Pilot boarding equipment. 109.347 Section 109.347... OPERATIONS Operation and Stowage of Safety Equipment § 109.347 Pilot boarding equipment. (a) The master or person in charge shall ensure that pilot boarding equipment is maintained as follows: (1) The equipment...
10 CFR 9.109 - Report to Congress.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Report to Congress. 9.109 Section 9.109 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Government in the Sunshine Act Regulations § 9.109 Report to Congress. The Secretary shall annually report to the Congress regarding the Commission's compliance with the...
Directory of Open Access Journals (Sweden)
Ng Weng-Ian
2010-09-01
Full Text Available Abstract Background The effect of high glucose concentration on the transcription levels of the small RNA SgrS and the messenger RNA ptsG, (encoding the glucose transporter IICBGlc, was studied in both E. coli K-12 (MG1655 and JM109 and E. coli B (BL21. It is known that the transcription level of sgrS increases when E. coli K-12 (MG1655 and JM109 is exposed to the non-metabolized glucose alpha methyl glucoside (αMG or when the bacteria with a defective glycolysis pathway is grown in presence of glucose. The increased level of sRNA SgrS reduces the level of the ptsG mRNA and consequently lowers the level of the glucose transporter IICBGlc. The suggested trigger for this action is the accumulation of the corresponding phospho-sugars. Results In the course of the described work, it was found that E. coli B (BL21 and E. coli K-12 (JM109 and MG1655 responded similarly to αMG: both strains increased SgrS transcription and reduced ptsG transcription. However, the two strains reacted differently to high glucose concentration (40 g/L. E. coli B (BL21 reacted by increasing sgrS transcription and reducing ptsG transcription while E. coli K-12 (JM109 and MG1655 did not respond to the high glucose concentration, and, therefore, transcription of sgrS was not detected and ptsG mRNA level was not affected. Conclusions The results suggest that E. coli B (BL21 tolerates high glucose concentration not only by its more efficient central carbon metabolism, but also by controlling the glucose transport into the cells regulated by the sRNA SgrS, which may suggest a way to control glucose consumption and increase its efficient utilization.
2727-S Nonradioactive Dangerous Waste Storage Facility Closure Plan
International Nuclear Information System (INIS)
Wilczek, T.A.; Laws, J.R.; Izatt, R.D.
1992-01-01
This closure plan describes the activities for final closure of the 2727-S Nonradioactive Dangerous Waste Storage (NRDWS) Facility at the Hanford Site. The 2727-S NRDWS Facility provided container storage for nonradioactive dangerous and extremely hazardous wastes generated in the research and development laboratories, process operations, and maintenance and transportation functions throughout the Hanford Site. Storage operations began at the 2727-S NRDWS Facility March 14, 1983, and continued until December 30, 1986, when the last shipment of materials from the facility took place. These storage operations have been moved to the new 616 NRDWS Facility, which is an interim status unit located between the 200 East and 200 West Areas of the Hanford Site
The immobilization of organic liquid wastes
International Nuclear Information System (INIS)
Greenhalgh, W.O.
1986-01-01
This report describes a portland cement immobilization process for the disposal treatment of radioactive organic liquid wastes which would be generated in a FFTF fuels reprocessing line. An incineration system already on-hand was determined to be too costly to operate for the 100 to 400 gallons per year organic liquid. Organic test liquids were dispersed into an aqueous phosphate liquid using an emulsifier. A total of 109 gallons of potential and radioactive aqueous immiscible organic liquid wastes from Hanford 300 Area operations were solidified with portland cement and disposed of as solid waste during a 3 month test program with in-drum mixers. Waste packing efficiencies varied from 32 to 40% and included pump oils, mineral spirits, and TBP-NPH type solvents
46 CFR 109.437 - Crane record book.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Crane record book. 109.437 Section 109.437 Shipping... Reports, Notifications, and Records Records § 109.437 Crane record book. The master or person in charge shall ensure that the following are maintained in a crane record book: (a) Descriptive information which...
46 CFR 109.527 - Cranes: Operator designation.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Operator designation. 109.527 Section 109.527... OPERATIONS Cranes § 109.527 Cranes: Operator designation. (a) The master or person in charge shall designate, in writing, each crane operator. (b) The master or person in charge shall ensure that only designated...
50 CFR 14.109 - Care in transit.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.109 Section 14.109 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... Wild Mammals and Birds to the United States § 14.109 Care in transit. (a) During transportation to the...
41 CFR 109-45.303-3 - Delivery.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Delivery. 109-45.303-3 Section 109-45.303-3 Public Contracts and Property Management Federal Property Management Regulations..., ABANDONMENT, OR DESTRUCTION OF PERSONAL PROPERTY 45.3-Sale of Personal Property § 109-45.303-3 Delivery. (a...
49 CFR 28.104-28.109 - [Reserved
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.104-28.109 Section 28.104-28.109 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.104-28.109 [Reserved] ...
DEFF Research Database (Denmark)
Vergara, Sintana E.; Damgaard, Anders; Horvathc, Arpad
2011-01-01
How waste is managed – whether as a nuisance to be disposed of, or as a resource to be reused – directly affects local and global environmental quality. This analysis explores the GHG benefits of five treatment options for residual municipal solid waste (MSW) in California: Business As Usual...... landfills. Using two different waste LCA models, EASEWASTE (a Danish model) and WARM (a U.S. model), we find that improved biogenic waste management through anaerobic digestion and waste reduction can lead to life-cycle GHG savings when compared to Business As Usual. The magnitude of the benefits depends...... strongly on a number of model assumptions: the type of electricity displaced by waste-derived energy, how biogenic carbon is counted as a contributor to atmospheric carbon stocks, and the landfill gas collection rate. Assuming that natural gas is displaced by waste-derived energy, that 64% of landfill gas...
46 CFR 109.334 - Working over water.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Working over water. 109.334 Section 109.334 Shipping... Operation and Stowage of Safety Equipment § 109.334 Working over water. The master or person in charge shall insure that each person working over the water is wearing a life preserver or a buoyant work vest. ...
Waste-to-Energy Evaluation: U.S. Virgin Islands
Energy Technology Data Exchange (ETDEWEB)
Davis, J.; Hasse, S.; Warren, A.
2011-08-01
This NREL technical report evaluates the environmental impact and fundamental economics of waste-to-energy (WTE) technology based on available data from commercially operating WTE facilities in the United States. In particular, it considers life-cycle impacts of WTE as compared to landfill disposal and various forms of electrical generation, as well as WTE impacts on source reduction or recycling programs. In addition, it evaluates the economics and potential environmental impact of WTE in the U.S. Virgin Islands (USVI) based on existing USVI waste stream characterization data, recycling challenges unique to the USVI, and the results of cost and environmental modeling of four municipal solid waste (MSW) management options, including landfill, refuse-derived fuel (RDF) production, recycling, and gassification plus RDF.
Radioactive wastes: a comparison of U.S. military and civilian inventories
International Nuclear Information System (INIS)
Krugmann, H.; von Hippel, F.
1977-01-01
Contrary to widespread belief, the accumulated inventory of fission products generated by the still small U.S. civilian nuclear power industry may already be comparable to that generated in the past by U.S. military nuclear programs. Although the volumes of the military wastes are very large, they are on the average almost 100 times more dilute than projected commercial high-level wastes
Thirteenth annual U.S. DOE low-level radioactive waste management conference: Proceedings
Energy Technology Data Exchange (ETDEWEB)
NONE
1991-12-31
The 40 papers in this document comprise the proceedings of the Department of Energy`s Thirteenth Annual Low-Level Radioactive Waste Management Conference that was held in Atlanta, Georgia, on November 19--21, 1991. General subjects addressed during the conference included: disposal facility design; greater-than-class C low-level waste; public acceptance considerations; waste certification; site characterization; performance assessment; licensing and documentation; emerging low-level waste technologies; waste minimization; mixed waste; tracking and transportation; storage; and regulatory changes. Papers have been processed separately for inclusion on the data base.
Waste Handling in SVAFO's Hot Cell
International Nuclear Information System (INIS)
Moeller, Jennifer; Ekenborg, Fredrik; Hellsten, Erik
2016-01-01
The decommissioning and dismantling of nuclear installations entails the generation of significant quantities of radioactive waste that must be accepted for disposal. In order to optimise the use of the final repositories for radioactive waste it is important that the waste be sent to the correct repository; that is, that waste containing short-lived radionuclides not be designated as long-lived due to conservative characterisation procedures. The disposal of short-lived waste in a future Swedish repository for long-lived waste will result in increased costs, due to the higher volumetric cost of the disposal as well as costs associated with decades of interim storage before disposal can occur. SVAFO is a non-profit entity that is responsible for the decommissioning of nuclear facilities from historical research and development projects in Sweden. They provide interim storage for radioactive waste arising from research activities until the final repository for long-lived waste is available. SVAFO's offices and facilities are located on the Studsvik site on the east coast of Sweden near the town of Nykoeping. Some of the retired facilities that SVAFO is in the process of decommissioning are located elsewhere in Sweden. The HM facility is a small waste treatment plant owned and operated by SVAFO. The plant processes both liquid and solid radioactive wastes. The facility includes a hot cell equipped with a compactor, a saw and other tools as well as manipulators for the handling and packaging of waste with high dose rates. The cell is fitted with special systems for transporting waste in and passing it out in drums. As with most hot cells there has been an accumulation of surface contamination on the walls, floor and other surfaces during decades of operation. Until recently there has been no attempt to quantify or characterize this contamination. Current practices dictate that after waste is handled in the hot cell it is conservatively designated as long
Relationship Between Partial and Total Responses to Advertising with Application to U.S. Meats
Kinnucan, Henry W.; Myrland, Oystein
2002-01-01
Buse’s concept of total response is extended to advertising effects. Results suggest that partial advertising elasticities overstate advertising’s ability to increase market demand. One implication is that advertising bans (e.g., for alcohol and tobacco) are apt to be less effective than indicated by partial advertising elasticities estimated from econometric models. Extending the concept of total response to price effects, the total advertising “flexibility” sets the lower bound on the optim...
AdS Branes from Partial Breaking of Superconformal Symmetries
International Nuclear Information System (INIS)
Ivanov, E.A.
2005-01-01
It is shown how the static-gauge world-volume superfield actions of diverse superbranes on the AdS d+1 superbackgrounds can be systematically derived from nonlinear realizations of the appropriate AdS supersymmetries. The latter are treated as superconformal symmetries of flat Minkowski superspaces of the bosonic dimension d. Examples include the N = 1 AdS 4 supermembrane, which is associated with the 1/2 partial breaking of the OSp(1|4) supersymmetry down to the N = 1, d = 3 Poincare supersymmetry, and the T-duality related L3-brane on AdS 5 and scalar 3-brane on AdS 5 x S 1 , which are associated with two different patterns of 1/2 breaking of the SU(2, 2|1) supersymmetry. Another (closely related) topic is the AdS/CFT equivalence transformation. It maps the world-volume actions of the codimension-one AdS d+1 (super)branes onto the actions of the appropriate Minkowski (super)conformal field theories in the dimension d
Granite disposal of U.S. high-level radioactive waste.
Energy Technology Data Exchange (ETDEWEB)
Freeze, Geoffrey A.; Mariner, Paul E.; Lee, Joon H.; Hardin, Ernest L.; Goldstein, Barry; Hansen, Francis D.; Price, Ronald H.; Lord, Anna Snider
2011-08-01
This report evaluates the feasibility of disposing U.S. high-level radioactive waste in granite several hundred meters below the surface of the earth. The U.S. has many granite formations with positive attributes for permanent disposal. Similar crystalline formations have been extensively studied by international programs, two of which, in Sweden and Finland, are the host rocks of submitted or imminent repository license applications. This report is enabled by the advanced work of the international community to establish functional and operational requirements for disposal of a range of waste forms in granite media. In this report we develop scoping performance analyses, based on the applicable features, events, and processes (FEPs) identified by international investigators, to support generic conclusions regarding post-closure safety. Unlike the safety analyses for disposal in salt, shale/clay, or deep boreholes, the safety analysis for a mined granite repository depends largely on waste package preservation. In crystalline rock, waste packages are preserved by the high mechanical stability of the excavations, the diffusive barrier of the buffer, and favorable chemical conditions. The buffer is preserved by low groundwater fluxes, favorable chemical conditions, backfill, and the rigid confines of the host rock. An added advantage of a mined granite repository is that waste packages would be fairly easy to retrieve, should retrievability be an important objective. The results of the safety analyses performed in this study are consistent with the results of comprehensive safety assessments performed for sites in Sweden, Finland, and Canada. They indicate that a granite repository would satisfy established safety criteria and suggest that a small number of FEPs would largely control the release and transport of radionuclides. In the event the U.S. decides to pursue a potential repository in granite, a detailed evaluation of these FEPs would be needed to inform site
Taiwan: Overall Developments and Policy Issues in the 109th Congress
National Research Council Canada - National Science Library
Dumbaugh, Kerry
2008-01-01
U.S. officials saw relations with Taiwan as especially troubled during the 109th Congress in 2005-2006, beset by the increasing complexity and unpredictability of Taiwan's democratic political environment...
International Nuclear Information System (INIS)
Yeager, K.L.
1990-10-01
This paper attempts to provide the reader with essential information on the quantity and types of solid, hazardous and radioactive wastes being generated in the province and to introduce some of the existing and future management options being considered. As well, a number of possible issues are identified which may stimulate further interest in the future paths of waste management in Ontario. (author)
Energy Technology Data Exchange (ETDEWEB)
Yeager, K L
1990-10-01
This paper attempts to provide the reader with essential information on the quantity and types of solid, hazardous and radioactive wastes being generated in the province and to introduce some of the existing and future management options being considered. As well, a number of possible issues are identified which may stimulate further interest in the future paths of waste management in Ontario. (author).
49 CFR 224.109 - Inspection, repair, and replacement.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection, repair, and replacement. 224.109 Section 224.109 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD..., Inspection, and Maintenance of Retroreflective Material § 224.109 Inspection, repair, and replacement. (a...
7 CFR 1709.109 - Eligible projects.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Eligible projects. 1709.109 Section 1709.109... projects. Eligible projects are those that acquire, construct, extend, repair, upgrade or otherwise improve... are eligible. Projects providing or improving service to communities with extremely high energy costs...
7 CFR 900.109 - Mediation agreement.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Mediation agreement. 900.109 Section 900.109 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Mediation agreement. An agreement arrived at by mediation shall not become effective until approved by the...
41 CFR 109-38.5201 - Definition.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definition. 109-38.5201... System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.52-Watercraft § 109-38.5201 Definition. As used in this...
47 CFR 25.109 - Cross-reference.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cross-reference. 25.109 Section 25.109 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... licensed under this part: (a) Amateur Satellite Service, see 47 CFR part 97. (b) Ship earth stations in the...
48 CFR 2131.109 - Advance agreements.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Advance agreements. 2131... PRINCIPLES AND PROCEDURES Applicability 2131.109 Advance agreements. FAR 31.109 is applicable to FEGLI Program contracts, except that precontract costs and nonrecurring costs that exceed $100,000 will not be...
42 CFR 71.45 - Food, potable water, and waste: U.S. seaports and airports.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Food, potable water, and waste: U.S. seaports and... Inspection § 71.45 Food, potable water, and waste: U.S. seaports and airports. (a) Every seaport and airport..., or waste water or other polluting materials. Arriving aircraft shall discharge such matter only at...
IAEA's radioactive waste management programme a change in direction for the 1990's
International Nuclear Information System (INIS)
Saire, Donald E.
1991-01-01
The IAEA has been assisting Member States in the management and disposal of radioactive wastes for almost three decades. This assistance has largely been in the form of providing an international form for the exchange of information on subjects of mutual interest and in offering technical assistance from developed Member States to developing Member States. In the 1980's, the Agency's programme concentrated on the collection, review and publication of state-of-the-art technology covering such subject fields as handling and processing of wastes from nuclear power plants and fuel cycle facilities, gaseous waste management, near-surface disposal of low-and intermediate-level radioactive wastes, deep geological disposal of high-level and transuranic wastes, radiological and environmental effects of waste disposal and the decontamination and decommissioning of nuclear installations. While the Agency still plans to serve as the main forum for the exchange of information on radioactive waste management two new areas of activity will receive emphasis in the 1990's
In vitro characterization of the anti-bacterial activity of SQ109 against Helicobacter pylori.
Directory of Open Access Journals (Sweden)
Morris O Makobongo
frequency of resistance to SQ109 was low and electron microscopy studies revealed that SQ109 interacted with bacterial inner membrane and cytoplasmic content(s. Collectively, our in vitro data demonstrate that SQ109 is an effective monotherapy against susceptible and multi-drug resistant strains of H. pylori and may be useful alone or in combination with other antibiotics for development as a new class of anti-Helicobacter drugs.
Nuclear criticality safety analysis summary report: The S-area defense waste processing facility
International Nuclear Information System (INIS)
Ha, B.C.
1994-01-01
The S-Area Defense Waste Processing Facility (DWPF) can process all of the high level radioactive wastes currently stored at the Savannah River Site with negligible risk of nuclear criticality. The characteristics which make the DWPF critically safe are: (1) abundance of neutron absorbers in the waste feeds; (2) and low concentration of fissionable material. This report documents the criticality safety arguments for the S-Area DWPF process as required by DOE orders to characterize and to justify the low potential for criticality. It documents that the nature of the waste feeds and the nature of the DWPF process chemistry preclude criticality
Swain, Ranjita; Bhima Rao, R.
2018-04-01
In the present investigation, response surface methodology (RSM) is used for a quadratic model that continuously controls the process parameters. This model is used to optimize the removal of iron oxide from Partially Laterised Khondalite (PLK) rocks which is influenced by several independent variables namely acid concentration, time and temperature. Second order response functions are produced for leaching of iron oxide from PLK rocks-a bauxite mining waste. In RSM, Box-Behnken design is used for the process optimization to achieve maximum removal of iron oxide. The influence of the process variables of leaching of iron oxide is presented in the form of 3-D response graphs. The results of this investigation reveals that 3 M hydrochloric acid concentration, 240 min time and 373 K temperature are found to be the best conditions for removal of 99% Fe2O3. The product obtain at this condition contain 80% brightness which is suitable for ceramic and filler industry applications. The novelity of the work is that the waste can be a value added product after suitable physical beneficiation and chemical treatment.
Swain, Ranjita; Bhima Rao, R.
2017-08-01
In the present investigation, response surface methodology (RSM) is used for a quadratic model that continuously controls the process parameters. This model is used to optimize the removal of iron oxide from Partially Laterised Khondalite (PLK) rocks which is influenced by several independent variables namely acid concentration, time and temperature. Second order response functions are produced for leaching of iron oxide from PLK rocks-a bauxite mining waste. In RSM, Box-Behnken design is used for the process optimization to achieve maximum removal of iron oxide. The influence of the process variables of leaching of iron oxide is presented in the form of 3-D response graphs. The results of this investigation reveals that 3 M hydrochloric acid concentration, 240 min time and 373 K temperature are found to be the best conditions for removal of 99% Fe2O3. The product obtain at this condition contain 80% brightness which is suitable for ceramic and filler industry applications. The novelity of the work is that the waste can be a value added product after suitable physical beneficiation and chemical treatment.
20 CFR 653.109 - Data collection.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Data collection. 653.109 Section 653.109 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR SERVICES OF THE EMPLOYMENT... MSFWs who were served as to whether they were male, female, black, Hispanic, American Indian, Asian, or...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-40.5101... MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.51-Price-Anderson Coverage Certifications for Nuclear Shipments § 109-40.5101 Policy. Upon request of a carrier, an appropriate certification will be...
41 CFR 109-38.001 - Definitions.
2010-07-01
... Classification Group (FSCG) 38; material handling equipment set forth in FSCG 39; and fire fighting equipment set... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definitions. 109-38.001 Section 109-38.001 Public Contracts and Property Management Federal Property Management Regulations System...
41 CFR 109-27.102-50 - Systems contracting.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...
41 CFR 109-1.5108-3 - Stores inventories.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stores inventories. 109-1.5108-3 Section 109-1.5108-3 Public Contracts and Property Management Federal Property Management....51-Personal Property Management Standards and Practices § 109-1.5108-3 Stores inventories. Perpetual...
41 CFR 105-1.109-50 - General plan.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General plan. 105-1.109-50 Section 105-1.109-50 Public Contracts and Property Management Federal Property Management....109-50 General plan. Chapter 105 is divided into parts, subparts, and further subdivisions as...
46 CFR 109.209 - Appliances for watertight integrity.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Appliances for watertight integrity. 109.209 Section 109... OPERATIONS Tests, Drills, and Inspections § 109.209 Appliances for watertight integrity. (a) Before getting underway, the master or person in charge shall insure that each appliance for watertight integrity is...
33 CFR 127.109 - Lighting systems.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Lighting systems. 127.109 Section... Waterfront Facilities Handling Liquefied Natural Gas § 127.109 Lighting systems. (a) The marine transfer area for LNG must have a lighting system and separate emergency lighting. (b) All outdoor lighting must be...
41 CFR 109-38.903 - Reporting of data.
2010-07-01
..., AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.9-Federal Motor Vehicle Fleet Report § 109-38.903... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reporting of data. 109-38.903 Section 109-38.903 Public Contracts and Property Management Federal Property Management...
41 CFR 109-28.000-51 - Storage guidelines.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Storage guidelines. 109-28.000-51 Section 109-28.000-51 Public Contracts and Property Management Federal Property Management...-STORAGE AND DISTRIBUTION § 109-28.000-51 Storage guidelines. (a) Indoor storage areas should be arranged...
Outcome of 7-S, TQM technique for healthcare waste management.
Ullah, Junaid Habib; Ahmed, Rashid; Malik, Javed Iqbal; Khan, M Amanullah
2011-12-01
To assess the present waste management system of healthcare facilities (HCFs) attached with Shalamar Hospital, Lahore by applying the 7-S technique of Total Quality Management (TQM) and to find out the outcome after imparting training. Interventional quasi-experimental study. The Shalamar Hospital, Lahore, Punjab, Pakistan, November, 2009 to November, 2010. Mckinsey's 7-S, technique of TQM was applied to assess the 220 HCFs from Lahore, Gujranwala and Sheikhupura districts for segregation, collection, transportation and disposal (SCTD) of hospital waste. Direct interview method was applied. Trainings were provided in each institution. After one year action period, the status of four areas of concern was compared before and after training. The parameters studied were segregation, collection, transportation and disposal systems in the 220 HCFs. Each of these were further elaborated by strategy, structure, system, staff, skill, style and stakeholder/shared value factors. Standard error of difference of proportion was applied to assess significance using 95% confidence level. There was marked improvement in all these areas ranging from 20% to 77% following a training program of 3 months. In case of disposal of the waste strategy, structure and system an increase of 60%, 65% and 75% was observed after training. The 7-S technique played a vital role in assessing the hospital waste management system. Training for the healthcare workers played a significant role in healthcare facilities.
46 CFR 109.565 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 109.565 Section 109... OPERATIONS Miscellaneous § 109.565 Charts and nautical publications. The master or person in charge of a self...) Notices to mariners. (f) Tide Tables. (g) Current Tables. (h) All other nautical publications necessary. 1...
Waste. The political significance of the city’s suppressed other
Chrysanthe Constantinou
2015-01-01
MBeneath the city’s achievement as a grand machine of accumulation of matter, in invisibility lies the vast and vague sphere of waste accumulation. In invisibility, a huge network of waste flows is possibly rewriting economies as we know them, reproducing life conditions driven by the politics of wealth. In this parallel territory, recycling is a big business for the few.
CD109 is a component of exosome secreted from cultured cells
International Nuclear Information System (INIS)
Sakakura, Hiroki; Mii, Shinji; Hagiwara, Sumitaka; Kato, Takuya; Yamamoto, Noriyuki; Hibi, Hideharu; Takahashi, Masahide; Murakumo, Yoshiki
2016-01-01
Exosomes are 50–100-nm-diameter membrane vesicles released from various types of cells. Exosomes retain proteins, mRNAs and miRNAs, which can be transported to surrounding cells. CD109 is a glycosylphosphatidylinositol-anchored glycoprotein, and is released from the cell surface to the culture medium in vitro. Recently, it was reported that secreted CD109 from the cell surface downregulates transforming growth factor-β signaling in human keratinocytes. In this study, we revealed that CD109 is a component of the exosome in conditioned medium. FLAG-tagged human CD109 (FLAG-CD109) in conditioned medium secreted from HEK293 cells expressing FLAG-CD109 (293/FLAG-CD109) was immunoprecipitated with anti-FLAG affinity gel, and the co-precipitated proteins were analyzed by mass spectrometry and western blotting. Exosomal proteins were associated with CD109. We revealed the presence of CD109 in exosome fractions from conditioned medium of 293/FLAG-CD109. Moreover, the localization of CD109 in the exosome was demonstrated using immuno-electron microscopy. When we used HEK293 cells expressing FLAG-tagged truncated CD109, which does not contain the C-terminal region, the association of truncated CD109 with exosomes was not detected in conditioned medium. These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome. - Highlights: • CD109 is an exosomal protein. • The C-terminal region of CD109 is required for its presence in the exosome. • Part of the secreted CD109 is present in the exosome-free fraction in the conditioned medium.
CD109 is a component of exosome secreted from cultured cells
Energy Technology Data Exchange (ETDEWEB)
Sakakura, Hiroki [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Mii, Shinji [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Hagiwara, Sumitaka [Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Head and Neck Surgery, Aichi Cancer Center Hospital, Nagoya (Japan); Kato, Takuya [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Yamamoto, Noriyuki; Hibi, Hideharu [Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Takahashi, Masahide, E-mail: mtakaha@med.nagoya-u.ac.jp [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Murakumo, Yoshiki, E-mail: murakumo@med.kitasato-u.ac.jp [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Pathology, Kitasato University School of Medicine, Sagamihara, Kanagawa (Japan)
2016-01-22
Exosomes are 50–100-nm-diameter membrane vesicles released from various types of cells. Exosomes retain proteins, mRNAs and miRNAs, which can be transported to surrounding cells. CD109 is a glycosylphosphatidylinositol-anchored glycoprotein, and is released from the cell surface to the culture medium in vitro. Recently, it was reported that secreted CD109 from the cell surface downregulates transforming growth factor-β signaling in human keratinocytes. In this study, we revealed that CD109 is a component of the exosome in conditioned medium. FLAG-tagged human CD109 (FLAG-CD109) in conditioned medium secreted from HEK293 cells expressing FLAG-CD109 (293/FLAG-CD109) was immunoprecipitated with anti-FLAG affinity gel, and the co-precipitated proteins were analyzed by mass spectrometry and western blotting. Exosomal proteins were associated with CD109. We revealed the presence of CD109 in exosome fractions from conditioned medium of 293/FLAG-CD109. Moreover, the localization of CD109 in the exosome was demonstrated using immuno-electron microscopy. When we used HEK293 cells expressing FLAG-tagged truncated CD109, which does not contain the C-terminal region, the association of truncated CD109 with exosomes was not detected in conditioned medium. These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome. - Highlights: • CD109 is an exosomal protein. • The C-terminal region of CD109 is required for its presence in the exosome. • Part of the secreted CD109 is present in the exosome-free fraction in the conditioned medium.
46 CFR 109.585 - Use of auto pilot.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Use of auto pilot. 109.585 Section 109.585 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.585 Use of auto pilot. Except as provided in 33 CFR 164.15, when the automatic pilot is used...
Directory of Open Access Journals (Sweden)
David La
Full Text Available BACKGROUND: Infection by the pandemic influenza A (H1N1/09 virus resulted in significant pathology among specific ethnic groups worldwide. Natural Killer (NK cells are important in early innate immune responses to viral infections. Activation of NK cells, in part, depend on killer-cell immunoglobulin-like receptors (KIR and HLA class I ligand interactions. To study factors involved in NK cell dysfunction in overactive immune responses to H1N1 infection, KIR3DL1/S1 and KIR2DL2/L3 allotypes and cognate HLA ligands of H1N1/09 intensive-care unit (ICU patients were determined. METHODOLOGY AND FINDINGS: KIR3DL1/S1, KIR2DL2/L3, and HLA -B and -C of 51 H1N1/09 ICU patients and 105 H1N1-negative subjects (St. Theresa Point, Manitoba were characterized. We detected an increase of 3DL1 ligand-negative pairs (3DL1/S1(+ Bw6(+ Bw4(-, and a lack of 2DL1 HLA-C2 ligands, among ICU patients. They were also significantly enriched for 2DL2/L3 ligand-positive pairs (PVA, P=0.024, Pc=0.047; Odds Ratio:2.563, CI95%:1.109-5.923, 3DL1*00101 (Ab>VA, PSTh, P=0.034, Pc=0.268, and 3DL1*029 (Ab>STh, P=0.039, Pc=0.301. Aboriginal patients ligand-positive for 3DL1/S1 and 2DL1 had the lowest probabilities of death (R(d (R(d=28%, compared to patients that were 3DL1/S1 ligand-negative (R(d=52% or carried 3DL1*029 (R(d=52%. Relative to Caucasoids (CA, two allotypes were enriched among non-aboriginal ICU patients (NAb: 3DL1*00401 (NAb>CA, P<0.001, Pc<0.001 and 3DL1*01502 (CA
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reports. 109-45.5105... Foreign Areas § 109-45.5105 Reports. (a) Proposed sales of foreign surplus personal property having an acquisition cost of $250,000 or more shall be reported to the DPMO and should include all pertinent data...
TWRS privatization support project waste characterization database development
International Nuclear Information System (INIS)
1995-11-01
Pacific Northwest National Laboratory requested support from ICF Kaiser Hanford Company in assembling radionuclide and chemical analyte sample data and inventory estimates for fourteen Hanford underground storage tanks: 241-AN-102, -104, -105, -106, and -107, 241-AP-102, -104, and -105, 241-AW-101, -103, and -105, 241 AZ-101 and -102; and 241-C-109. Sample data were assembled for sixteen radionuclides and thirty-five chemical analytes. The characterization data were provided to Pacific Northwest National Laboratory in support of the Tank Waste Remediation Services Privatization Support Project. The purpose of this report is to present the results and document the methodology used in preparing the waste characterization information data set to support the Tank Waste Remediation Services Privatization Support Project. This report describes the methodology used in assembling the waste characterization information and how that information was validated by a panel of independent technical reviewers. Also, contained in this report are the various data sets created: the master data set, a subset, and an unreviewed data set. The master data set contains waste composition information for Tanks 241-AN-102 and -107, 241-AP-102 and -105, 241-AW-101; and 241-AZ-101 and -102. The subset contains only the validated analytical sample data from the master data set. The unreviewed data set contains all collected but unreviewed sample data for Tanks 241-AN-104, -105, and -106; 241-AP-104; 241-AW-103 and-105; and 241-C-109. The methodology used to review the waste characterization information was found to be an accurate, useful way to separate the invalid or questionable data from the more reliable data. In the future, this methodology should be considered when validating waste characterization information
International Nuclear Information System (INIS)
Devgun, J.S.; Larson, G.S.
1995-01-01
It has been fifteen years since responsibility for the disposal of commercially generated low-level radioactive waste (LLW) was shifted to the states by the United States Congress through the Low-Level Radioactive Waste Policy Act of 1980 (LLRWPA). In December 1985, Congress revisited the issue and enacted the Low-Level Radioactive Waste Policy Amendments Act of 1985 (LLRWPAA). No new disposal sites have opened yet, however, and it is now evident that disposal facility development is more complex, time-consuming, and controversial than originally anticipated. For a nation with a large nuclear power industry, the lack of availability of LLW disposal capacity coupled with a similar lack of high-level radioactive waste disposal capacity could adversely affect the future viability of the nuclear energy option. The U.S. nuclear power industry, with 109 operating reactors, generates about half of the LLW shipped to commercial disposal sites and faces dwindling access to waste disposal sites and escalating waste management costs. The other producers of LLW - industries, government (except the defense related research and production waste), academic institutions, and medical institutions that account for the remaining half of the commercial LLW - face the same storage and cost uncertainties. This paper will summarize the current status of U.S. low-level radioactive waste generation and the status of new disposal facility development efforts by the states. The paper will also examine the factors that have contributed to delays, the most frequently suggested alternatives, and the likelihood of change
Energy Technology Data Exchange (ETDEWEB)
J.D. Mousseau; S.C. Raish; F.M. Russo
2006-05-18
This paper provides an overview of the Department of Energy's (DOE) Advanced Mixed Waste Treatment Project (AMWTP) located at the Idaho National Laboratory (INL) and operated by Bechtel BWXT Idaho, LLC(BBWI) It describes the results to date in meeting the 6,000-cubic-meter Idaho Settlement Agreement milestone that was due December 31, 2005. The paper further describes lessons that have been learned from the project in the area of transuranic (TRU) waste processing and waste certification. Information contained within this paper would be beneficial to others who manage TRU waste for disposal at the Waste Isolation Pilot Plant (WIPP).
International Nuclear Information System (INIS)
2011-01-01
The Canadian Nuclear Society conference on Waste Management, Decommissioning and Environmental Restoration for Canada's Nuclear Activities was held in Toronto, Ontario, Canada on September 11-14, 2011. The conference provided a forum for discussion of the status and proposed future directions of technical, regularly, environmental, social and economic aspects of radioactive waste management, nuclear facility decommissioning, and environmental restoration activities for Canadian nuclear facilities. The conference included both plenary sessions and sessions devoted to more detailed technical issues. The plenary sessions were focussed on three broad themes: the overall Canadian program; low and intermediate waste; and, international perspectives. Topics of the technical sessions included: OPG's deep geologic repository for low and intermediate level waste; stakeholder interactions; decommissioning projects; uranium mine waste management; used fuel repository - design and safety assessment; federal policies, programs and oversight; regulatory considerations; aboriginal traditional knowledge; geological disposal - CRL site classification; geological disposal - modelling and engineered barriers; Port Hope Area Initiative; waste characterization; LILWM - treatment and processing; decommissioning projects and information management; international experience; environmental remediation; fuel cycles and waste processing.
Radioactivity assessment of the waste deposited in Candonga's lake after the FundÃO Dam's collapse
Energy Technology Data Exchange (ETDEWEB)
Freire, Carolina Braccini; Cuccia, Valeria; Lameiras, Fernando Soares; Rocha, Zildete, E-mail: cbf@cdtn.br, E-mail: vc@cdtn.br, E-mail: fsl@cdtn.br, E-mail: rochaz@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Santos, Talita Oliveira, E-mail: talitaolsantos@yahoo.com.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Anatomia e Imagem; Sales, Gabriel Lopes, E-mail: gabriellopessales@hotmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte (Brazil). Dept. de Engenharia Química
2017-07-01
The collapse of the Fundão dam on November 5{sup th} 2015 caused impacts along the hydrographic basin of Rio Doce. Renova Foundation has the mission to repair, restore and reconstruct the regions affected by this disaster. After the collapse, a huge amount of waste was deposited in Risoleta Neves Hydroelectric Power Plant’s lake (Candonga). This waste has been dredged out from the lake and deposited in a nearby pile. The use of the waste from this pile is being considered for civil construction. Samples of this waste pile were collected and they were characterized by X-rays diffraction and EDS analyses, which showed that it consists of 80% quartz, 11% hematite, 8% goethite and 1% clays, mainly kaolinite. There is also organic matter consisting of branches, roots and leaves of trees and plants. Previous radiological analyses made before the collapse showed that the radionuclide content of the waste deposited in Fundão dam was very low. However, the waste deposited in Candonga's lake has a new composition and it is important to evaluate its radioactivity assessment. The analyses results of the Candonda's waste samples will be presented and compared to the results obtained in the Fundão dam samples, before its collapse. (author)
Radioactivity assessment of the waste deposited in Candonga's lake after the FundÃO Dam's collapse
International Nuclear Information System (INIS)
Freire, Carolina Braccini; Cuccia, Valeria; Lameiras, Fernando Soares; Rocha, Zildete; Santos, Talita Oliveira; Sales, Gabriel Lopes
2017-01-01
The collapse of the Fundão dam on November 5 th 2015 caused impacts along the hydrographic basin of Rio Doce. Renova Foundation has the mission to repair, restore and reconstruct the regions affected by this disaster. After the collapse, a huge amount of waste was deposited in Risoleta Neves Hydroelectric Power Plant’s lake (Candonga). This waste has been dredged out from the lake and deposited in a nearby pile. The use of the waste from this pile is being considered for civil construction. Samples of this waste pile were collected and they were characterized by X-rays diffraction and EDS analyses, which showed that it consists of 80% quartz, 11% hematite, 8% goethite and 1% clays, mainly kaolinite. There is also organic matter consisting of branches, roots and leaves of trees and plants. Previous radiological analyses made before the collapse showed that the radionuclide content of the waste deposited in Fundão dam was very low. However, the waste deposited in Candonga's lake has a new composition and it is important to evaluate its radioactivity assessment. The analyses results of the Candonda's waste samples will be presented and compared to the results obtained in the Fundão dam samples, before its collapse. (author)
Waste. The political significance of the city’s suppressed other
Directory of Open Access Journals (Sweden)
Chrysanthe Constantinou
2015-03-01
Full Text Available MBeneath the city’s achievement as a grand machine of accumulation of matter, in invisibility lies the vast and vague sphere of waste accumulation. In invisibility, a huge network of waste flows is possibly rewriting economies as we know them, reproducing life conditions driven by the politics of wealth. In this parallel territory, recycling is a big business for the few.
International Nuclear Information System (INIS)
Bradford, A.H.; Esh, D.W.; Ridge, A.C.
2006-01-01
Section 3116 of the Ronald W. Reagan National Defense Authorization Act for Fiscal Year 2005 (NDAA) requires the U.S. Department of Energy (DOE) to consult with the U.S. Nuclear Regulatory Commission (NRC) for certain non-high level waste (HLW) determinations. Under the NDAA, NRC performs consultative technical reviews of DOE's waste determinations and monitors DOE's disposal actions for such waste, but the NRC does not have regulatory authority over DOE's waste disposal activities. The NDAA provides the criteria that must be met to determine that waste is not HLW. The criteria require that the waste does not need to be disposed of in a geologic repository, that highly radioactive radionuclides be removed to the maximum extent practical, and that the performance objectives of 10 CFR 61, Subpart C, be met. The performance objectives contain criteria for protection of the public, protection of inadvertent intruders, protection of workers, and stability of the disposal site after closure. This paper describes NRC's approach to implementing its responsibilities under the NDAA, as well as similar activities being performed for sites not covered by the NDAA. (authors)
Shale disposal of U.S. high-level radioactive waste.
Energy Technology Data Exchange (ETDEWEB)
Sassani, David Carl; Stone, Charles Michael; Hansen, Francis D.; Hardin, Ernest L.; Dewers, Thomas A.; Martinez, Mario J.; Rechard, Robert Paul; Sobolik, Steven Ronald; Freeze, Geoffrey A.; Cygan, Randall Timothy; Gaither, Katherine N.; Holland, John Francis; Brady, Patrick Vane
2010-05-01
This report evaluates the feasibility of high-level radioactive waste disposal in shale within the United States. The U.S. has many possible clay/shale/argillite basins with positive attributes for permanent disposal. Similar geologic formations have been extensively studied by international programs with largely positive results, over significant ranges of the most important material characteristics including permeability, rheology, and sorptive potential. This report is enabled by the advanced work of the international community to establish functional and operational requirements for disposal of a range of waste forms in shale media. We develop scoping performance analyses, based on the applicable features, events, and processes identified by international investigators, to support a generic conclusion regarding post-closure safety. Requisite assumptions for these analyses include waste characteristics, disposal concepts, and important properties of the geologic formation. We then apply lessons learned from Sandia experience on the Waste Isolation Pilot Project and the Yucca Mountain Project to develop a disposal strategy should a shale repository be considered as an alternative disposal pathway in the U.S. Disposal of high-level radioactive waste in suitable shale formations is attractive because the material is essentially impermeable and self-sealing, conditions are chemically reducing, and sorption tends to prevent radionuclide transport. Vertically and laterally extensive shale and clay formations exist in multiple locations in the contiguous 48 states. Thermal-hydrologic-mechanical calculations indicate that temperatures near emplaced waste packages can be maintained below boiling and will decay to within a few degrees of the ambient temperature within a few decades (or longer depending on the waste form). Construction effects, ventilation, and the thermal pulse will lead to clay dehydration and deformation, confined to an excavation disturbed zone within
System design description for Waste Information and Control System
International Nuclear Information System (INIS)
Harris, R.R.
1994-01-01
The Westinghouse Hanford Company (WHC) Hazardous Material Control Group (HMC) of the 222-S Laboratory has requested the development of a system to help resolve many of the difficulties associated with tracking and data collection of containers and drums of waste. This system has been identified as the Waste Information and Control System (WICS). WICS shall partially automate the procedure for acquisition, tracking and reporting of the container, drum, and waste data that is currently manually processed. The WICS project shall use handheld computer units (HCU) to collect laboratory data, a local database with an user friendly interface to import the laboratory data from the HCUs, and barcode technology with associated software and operational procedures. After the container, drum, and waste data has been collected and verified, WICS shall be manipulated to provide informal reports containing data required to properly document waste disposal. 8 refs, 82 figs, 69 tabs
Community based assessment on household management of waste ...
African Journals Online (AJOL)
Bernt Lindtjorn
Conclusion: in the study community household management of waste is in poor condition. Health-workers and local authorities must pay special emphasis to improve these conditions. Further in-depth studies should also be encouraged to look for improved interventions. [Ethiop. J. Health Dev. 2010;24(2):103-109].
41 CFR 109-28.000-50 - Policy.
2010-07-01
... industrial management practices and principles. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-28.000-50 Section 109-28.000-50 Public Contracts and Property Management Federal Property Management Regulations...
DOE`s integrated low-level waste management program and strategic planning
Energy Technology Data Exchange (ETDEWEB)
Duggan, G. [Dept. of Energy, Washington, DC (United States). Office of Environmental Restoration and Waste Management; Hwang, J. [Science Applications International Corp., Germantown, MD (United States)
1993-03-01
To meet the DOE`s commitment to operate its facilities in a safe, economic, and environmentally sound manner, and to comply with all applicable federal, state, and local rules, regulations, and agreements, DOE created the Office of Environmental Restoration and Waste Management (EM) in 1989 to focus efforts on controlling waste management and cleaning up contaminated sites. In the first few years of its existence, the Office of Waste Management (EM-30) has concentrated on operational and corrective activities at the sites. In 1992, the Office of Waste Management began to apply an integrated approach to managing its various waste types. Consequently, DOE established the Low-Level Waste Management Program (LLWMP) to properly manage its complex-wide LLW in a consistent manner. The objective of the LLWMP is to build and operate an integrated, safe, and cost-effective program to meet the needs of waste generators. The program will be based on acceptable risk and sound planning, resulting in public confidence and support. Strategic planning of the program is under way and is expected to take two to three years before implementation of the integrated waste management approach.
41 CFR 109-27.5106-5 - Assistance.
2010-07-01
...-INVENTORY MANAGEMENT 27.51-Management of Precious Metals § 109-27.5106-5 Assistance. The Business Center for... Management Branch, Oak Ridge Operations Office. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Assistance. 109-27.5106...
Two-fold sustainability – Adobe with sawdust as partial sand replacement
Jokhio, Gul A.; Syed Mohsin, Sharifah M.; Gul, Yasmeen
2018-04-01
Adobe is a material that is economic, environment friendly, and provides better indoor air quality. The material required for the preparation of adobe include clay, sand, and sometimes straw or other organic materials. These materials do not require industrial processing or transportation, however, sand mining has been recently posing a threat to the environment. Therefore, to enhance the existing sustainability of adobe, sand can be partially or fully replaced by other waste materials. This approach will not only solve the problem of excessive sand mining, it will also address the issue of waste management. Sawdust is one such waste material that can be used to partially replace sand in Adobe. This paper presents the results of compressive and flexural test carried out on Adobe samples with partial sand replacement by sawdust. The results show that about 4% sand replacement by volume produces higher compressive strength, whereas the flexural strength reduces with the use of sawdust. However, since flexural strength is not a critical property for adobe, it is concluded that replacing sand with sawdust by about 4% of volume will be beneficial.
Hydroceramics, a ''new'' cementitious waste form material for U.S. defense-type reprocessing waste
International Nuclear Information System (INIS)
Siemer, Darryl D.
2002-01-01
A ''hydroceramic'' (HC) is a concrete which possesses mineralogy similar to the zeolitized rock indigenous to the USA's current ''basis'' high level radioactive waste (HLW) repository site, Yucca Mountain (YM). It is made by curing a mixture of inorganic waste, calcined clay, vermiculite, Na 2 S, NaOH, plus water under hydrothermal conditions. The product differs from conventional Portland cement and/or slag-based concretes (''grouts'') in that it is primarily comprised of alkali aluminosilicate ''cage minerals'' (cancrinites, sodalites, and zeolites)rather than hydrated calcium silicates (C-S-H in cement-chemistry shorthand). Consequently it microencapsulates individual salt molecules thereby rendering them less leachable than they are from conventional grouts. A fundamental difference between the formulations of HCs and radwaste-type glasses is that the latter contain insufficient aluminum to form insoluble minerals with all of the alkali metals in them. This means that the imposition of worst-case ''repository failure'' (hydrothermal) conditions would cause a substantial fraction of such glasses to alter to water-soluble forms. Since the same conditions tend to reduce the solubility of HC concretes, they constitute a more rugged immobilization sub-system. This paper compares leach characteristics of HCs with those of radwaste-type glasses and points out why hydroceramic solidification makes more sense than vitrification for US defense-type reprocessing waste. (orig.)
Uptake and loss of dissolved 109Cd and 75Se in estuarine macroinvertebrates.
Alquezar, Ralph; Markich, Scott J; Twining, John R
2007-04-01
Semaphore crabs (Heloecius cordiformis), soldier crabs (Mictyris platycheles), ghost shrimps (Trypaea australiensis), pygmy mussels (Xenostrobus securis), and polychaetes (Eunice sp.), key benthic prey items of predatory fish commonly found in estuaries throughout southeastern Australia, were exposed to dissolved (109)Cd and (75)Se for 385 h at 30 k Bq/l (uptake phase), followed by exposure to radionuclide-free water for 189 h (loss phase). The whole body uptake rates of (75)Se by pygmy mussels, semaphore crabs and soldier crabs were 1.9, 2.4 and 4.1 times higher than (109)Cd, respectively. There were no significant (P>0.05) differences between the uptake rates of (75)Se and (109)Cd for ghost shrimps and polychaetes. The uptake rates of (109)Cd and (75)Se were highest in pygmy mussels; about six times higher than in soldier crabs for (109)Cd and in polychaetes for (75)Se - the organisms with the lowest uptake rates. The loss rates of (109)Cd and (75)Se were highest in semaphore crabs; about four times higher than in polychaetes for (109)Cd and nine times higher than in ghost shrimps for (75)Se - the organisms with the lowest loss rates. The loss of (109)Cd and (75)Se in all organisms was best described by a two (i.e. short and a longer-lived) compartment model. In the short-lived, or rapidly exchanging, compartment, the biological half-lives of (75)Se (16-39 h) were about three times greater than those of (109)Cd (5-12h). In contrast, the biological half-lives of (109)Cd in the longer-lived, or slowly exchanging compartment(s), were typically greater (1370-5950 h) than those of (75)Se (161-1500 h). Semaphore crabs had the shortest biological half-lives of both radionuclides in the long-lived compartment, whereas polychaetes had the greatest biological half-life for (109)Cd (5950 h), and ghost shrimps had the greatest biological half-life for (75)Se (1500 h). This study provides the first reported data for the biological half-lives of Se in estuarine decapod
41 CFR 109-26.501-1 - General.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General. 109-26.501-1 Section 109-26.501-1 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...
41 CFR 109-38.203 - Agency identification.
2010-07-01
... Administrative Services, Logistics Management Division, Headquarters, using DOE Form 4250.2, “Requisition for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Agency identification. 109-38.203 Section 109-38.203 Public Contracts and Property Management Federal Property Management...
Hanford Tank 241-S-112 Residual Waste Composition and Leach Test Data
Energy Technology Data Exchange (ETDEWEB)
Cantrell, Kirk J.; Krupka, Kenneth M.; Geiszler, Keith N.; Lindberg, Michael J.; Arey, Bruce W.; Schaef, Herbert T.
2008-08-29
This report presents the results of laboratory characterization and testing of two samples (designated 20406 and 20407) of residual waste collected from tank S-112 after final waste retrieval. These studies were completed to characterize the residual waste and assess the leachability of contami¬nants from the solids. This is the first report from this PNNL project to describe the composition and leach test data for residual waste from a salt cake tank. All previous PNNL reports (Cantrell et al. 2008; Deutsch et al. 2006, 2007a, 2007b, 2007c) describing contaminant release models, and characterization and testing results for residual waste in single-shell tanks were based on samples from sludge tanks.
Ahmad, Shamsad; Hakeem, Ibrahim; Maslehuddin, Mohammed
2014-01-01
In the exploratory study presented in this paper, an attempt was made to develop different mixtures of ultrahigh performance concrete (UHPC) using various locally available natural and industrial waste materials as partial replacements of silica fume and sand. Materials such as natural pozzolana (NP), fly ash (FA), limestone powder (LSP), cement kiln dust (CKD), and pulverized steel slag (PSS), all of which are abundantly available in Saudi Arabia at little or no cost, were employed in the development of the UHPC mixtures. A base mixture of UHPC without replacement of silica fume or sand was selected and a total of 24 trial mixtures of UHPC were prepared using different percentages of NP, FA, LSP, CKD, and PSS, partially replacing the silica fume and sand. Flow and 28-d compressive strength of each UHPC mixture were determined to finally select those mixtures, which satisfied the minimum flow and strength criteria of UHPC. The test results showed that the utilization of NP, FA, LSP, CKD, and PSS in production of UHPC is possible with acceptable flow and strength. A total of 10 UHPC mixtures were identified with flow and strength equal to or more than the minimum required.
Saravolatz, L D; Pawlak, J; Martin, H; Saravolatz, S; Johnson, L; Wold, H; Husbyn, M; Olsen, W M
2017-11-01
The development of new synthetic antimicrobial peptides like LTX-109 provides a new class of drugs for the treatment of Staphylococcus aureus infections. We evaluated LTX-109 and mupirocin for pharmacodynamic parameters against 10 methicillin-resistant S. aureus isolates. The postantibiotic effect (PAE) is defined as the length of time that bacterial growth is suppressed following a brief exposure to an antibiotic. We also determined the sub-MIC effect (SME) which measures the direct effect of subinhibitory levels on strains that have not previously been exposed to antibiotics. The postantibiotic sub-MIC effect (PA-SME) is a combination of the PAE and SME. LTX-109 had an average PAE of 5·51 h vs 1·04 h for mupirocin. The PA-SME of LTX-109 ranged from 2·51 to 9·33 h as the concentration increased from 0·2 to 0·4 times the minimal inhibitory concentration (MIC). The PA-SME range for mupirocin was 0·93-2·58 h. LTX-109, as compared to mupirocin, demonstrated prolonged time of effect for these pharmacodynamic parameters, which supports persistent activity for several hours after the drug is no longer present or is below the MIC. The pharmacodynamic parameters studied here suggest that LTX-109 is less likely than mupirocin to generate resistance to S. aureus. Resistant bacterial infections continue to be a challenge for clinicians. Identification of antibiotics with pharmacodynamic advantages may be beneficial in the treatment of these infections. An antibiotic with a longer postantibiotic effect may be able to be administered less frequently resulting in improved adherence. In this study, a new synthetic antimicrobial peptide, LTX-109, demonstrated a more prolonged time for LTX-109 than mupirocin against methicillin-resistant Staphylococcus aureus. © 2017 The Society for Applied Microbiology.
41 CFR 109-27.102 - Economic order quantity principle.
2010-07-01
... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...
41 CFR 105-1.109-51 - Arrangement.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Arrangement. 105-1.109-51 Section 105-1.109-51 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...
41 CFR 109-45.310 - Antitrust laws.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Antitrust laws. 109-45.310 Section 109-45.310 Public Contracts and Property Management Federal Property Management... Antitrust laws. DOE offices shall submit to the Deputy Assistant Secretary for Procurement and Assistance...
41 CFR 109-27.5004 - Sub-stores.
2010-07-01
... to the users, serve emergencies, provide economy in transportation, reduce shop and site stocks, and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Sub-stores. 109-27.5004 Section 109-27.5004 Public Contracts and Property Management Federal Property Management Regulations...
41 CFR 109-27.102-52 - Implementation.
2010-07-01
... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...
46 CFR 109.205 - Inspection of boilers and machinery.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Inspection of boilers and machinery. 109.205 Section 109... OPERATIONS Tests, Drills, and Inspections § 109.205 Inspection of boilers and machinery. The chief engineer or engineer in charge, before he assumes charge of the boilers and machinery of a unit shall inspect...
41 CFR 109-38.202-50 - Security.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Security. 109-38.202-50 Section 109-38.202-50 Public Contracts and Property Management Federal Property Management Regulations....202-50 Security. Unissued license tags shall be stored in a locked drawer, cabinet, or storage area...
DEFF Research Database (Denmark)
Thorlund, Jonas Bloch; Englund, Martin; Christensen, Robin
2017-01-01
OBJECTIVES: To compare patient reported outcomes from before surgery to 52 weeks after surgery between individuals undergoing arthroscopic partial meniscectomy for traumatic meniscal tears and those for degenerative meniscal tears. DESIGN: Comparative prospective cohort study. SETTING: Four public......-55, and undergoing arthroscopic partial meniscectomy for a traumatic or degenerative meniscal tear (defined by a combination of age and symptom onset). INTERVENTIONS: Both participant groups underwent arthroscopic partial meniscectomy for a meniscal tear, with operating surgeons recording relevant information......% women) with a traumatic or degenerative meniscal tear (n=141, mean age 38.7 years (standard deviation 10.9); n=256, 46.6 years (6.4); respectively) were included in the main analysis. At 52 weeks after arthroscopic partial meniscectomy, 55 (14%) patients were lost to follow-up. Statistically...
Extraction of CdS pigment from waste polyethylene
Wanrooij, P.H.P.; Agarwal, U.S.; Meuldijk, J.; Kasteren, van J.M.N.; Lemstra, P.J.
2006-01-01
Cadmium sulfide has often been used as a pigment in plastics such as high-density polyethylene (HDPE). Removal of CdS after the useful life of plastics is desired since it poses an environmental hazard in the waste phase of these plastics. In this study, a process is investigated to convert the
Properties of concrete containing foamed concrete block waste as fine aggregate replacement
Muthusamy, K.; Budiea, A. M. A.; Zaidan, A. L. F.; Rasid, M. H.; Hazimmah, D. S.
2017-11-01
Environmental degradation due to excessive sand mining dumping at certain places and disposal of foamed concrete block waste from lightweight concrete producing industry are issues that should be resolved for a better and cleaner environment of the community. Thus, the main intention of this study is to investigate the potential of foamed concrete block waste as partial sand replacement in concrete production. The foamed concrete waste (FCW) used in this research that were supplied by a local lightweight concrete producing industry. The workability and compressive strength of concrete containing various percentage of foamed concrete waste as partial sand replacement has been investigated. Prior to the use, the foamed concrete waste were crushed to produce finer particles. Six concrete mixes containing various content of crushed foamed concrete waste that are 0%, 10%, 20%, 30%, 40% and 50% were used in this experimental work. Then the prepared specimens were placed in water curing until the testing age. Compressive strength test and flexural strength tests were conducted at 7, 14 and 28 days. The result shows that integration of crushed foamed concrete waste as partial sand replacement in concrete reduces the mix workability. It is interesting to note that both compressive strength and flexural strength of concrete improves when 30% crushed foamed concrete waste is added as partial sand replacement.
Hanford Facility Dangerous Waste Permit Application, 222-S Laboratory Complex
International Nuclear Information System (INIS)
WILLIAMS, J.F.
2000-01-01
The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating treatment, storage, and/or disposal units, such as the 222-S Laboratory Complex (this document, DOE/RL-91-27). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needs defined by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the 222-S Laboratory Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this 222-S Laboratory Complex permit application documentation is current as of August 2000
An overview of U.S. plant performance improvement through effective radioactive waste management
International Nuclear Information System (INIS)
Sieberling, R.; Lyons, P.W.
1986-01-01
Radioactive waste volumes in the United States commercial nuclear power industry have declined over the last five years after increasing steadily in the late 1970's. This decline is considered to be especially significant because major backfits/modifications and major component repair/replacement at U.S. nuclear power stations have been accomplished during this period. This paper analyzes the key reasons for this performance and outlines the positive effects that this trend has upon overall nuclear plant performance. In reviewing plant performance data, there appears to be a direct correlation between overall plant performance and radioactive waste performance. For example, plants with high capacity factors, strong industrial safety programs, low collective man-rem, and good contamination controls, generally have a history of low radioactive waste volumes. The reasons for this excellent performance is the result of direct management and supervisory involvement in plant operations, implementation of high standards of performance, and monitoring performance against these standards. Using the techniques outlined in this paper, the U.S. nuclear power industry can continue to reduce the volume of low-level solid radioactive waste being generated
International Nuclear Information System (INIS)
1996-01-01
The spent fuel coming from Slovak NPPs have partially been transported to the former Soviet Union, and a part of it is stored in an interim spent fuel wet storage. In compliance with the worldwide practices, further medium-term possibilities of storing in dry storages are under preparation. Disposal of a spent fuel and other high-level active wastes in a deep geological formation repository is the final solution. At present, there are geological investigations of possible sites in progress in Slovakia. Mochovce repository is a factory for a final disposal of compacted low and intermediate level radioactive wastes coming from the Slovak NPPs. This is a near-surface facility of a construction similar to the one used for disposal of radioactive wastes in France, Spain, Japan, Czech Republic, U.S.A, etc. Quality of the design, construction and functioning of the Mochovce's repository was assessed by an international team of experts within a special IAEA programme (WATRP). Having familiarized with the final report of the IAEA mission, Nuclear Regulatory Authority of the Slovak Republic (NRA SR) issued its position early in 1995, in which NRA SR required additional adjustment of the repository itself. Based on the NRA SR's position, Mochovce NPP invited experts from a number of institutions in September 1995 to discuss the NRA SR's requirements. Following was recommended by the experts: (1) to perform a complementary engineering-geological investigation on the site, (2) to use geophysical methods to verify existence of geological faults. In the next part a radioactive wastes that were treated at radioactive waste treatment lines in 1995 are listed. In 1995, the Chief Inspector of NRA SR issued an instruction that radioactive waste department should start inspections of radioactive waste treatment right in hospitals, research institutes and industries. Therefore, a total of 14 such workplaces were incorporated into a plan of inspections in 1995
Overview of management programs for plutonium-contaminated solid waste in the U.S.A
International Nuclear Information System (INIS)
Ramsey, R.W. Jr.; Daly, G.H.
1975-01-01
Programs for transuranium-contaminated solid wastes (TRU) in the U.S.A. are emphasizing a reduction in waste generation and the development of appropriate treatments to reduce the volume of wastes requiring interim storage and final disposal. Research and Development is emphasizing the establishment of sufficient information on treatment, hazards and storage to adopt a standardized procedure for handling wastes during an interim retrievable period and for final disposal. Federal responsibility for TRU waste is being proposed except for minimum amounts acceptable for commercial burial
Actual problems of municipal cleaners waste waters
Directory of Open Access Journals (Sweden)
Konko¾ová Patrícia
2000-03-01
Full Text Available In paper are evaluated social and economical changes in water economy with emphasis on complex evaluation of municipal cleaners waste waters with respect of legislative, position of ownerskip relationskips and financial security of public experiences of water economy.
12 CFR 410.104-410.109 - [Reserved
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.104-410.109 Section 410.104-410.109 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...
Outcome of 7-S, TQM technique for health care waste management
International Nuclear Information System (INIS)
Ullah, J.H.; Malik, J.I.
2011-01-01
To assess the present waste management system of health care facilities (HCFs) attached with Shalamar Hospital, Lahore by applying the 7-S technique of Total Quality Management (TQM) and to find out the outcome after imparting training. Study Design: Interventional quasi-experimental study. Place and Duration of Study: The Shalamar Hospital, Lahore, Punjab, Pakistan, November, 2009 to November, 2010. Methodology: Mckinsey's 7-S, technique of TQM was applied to assess the 220 HCFs from Lahore, Gujranwala and Sheikhupura districts for segregation, collection, transportation and disposal (SCTD) of hospital waste. Direct interview method was applied. Trainings were provided in each institution. After one year action period, the status of four areas of concern was compared before and after training. The parameters studied were segregation, collection, transportation and disposal systems in the 220 HCFs. Each of these were further elaborated by strategy, structure, system, staff, skill, style and stake holder/shared value factors. Standard error of difference of proportion was applied to assess significance using 95% confidence level. Results: There was marked improvement in all these areas ranging from 20% to 77% following a training program of 3 months. In case of disposal of the waste strategy, structure and system an increase of 60%, 65% and 75% was observed after training. Conclusion: The 7-S technique played a vital role in assessing the hospital waste management system. Training for the health care workers played a significant role in health care facilities. (author)
Ackah, Michael
2017-11-01
Crude or primitive recycling practices are often adopted in material resource recovery from E-waste in developing nations. Significant human health and environmental impacts may occur because of such practices. Literature on metal(loid)s pollution during E-waste processing is fragmented. Here, I review the health and environmental impacts of E-waste recycling operations and transport pathways of metal(loid)s, dispersed during operations. This paper is organised into five sections. Section 1 relates to the background of global E-waste generation and legal/illegal trade, citing specific cases from Ghana and other developing nations. Section 2 provides a brief information on sources of metal(loid)s in E-waste. Section 3 describes characteristics of informal E-waste recycling operations in developing nations. Section 4 examines the health and environmental impacts in E-waste recycling while section 5 evaluates major transport pathways of metal(loid)s contaminants.
International Nuclear Information System (INIS)
Barariu, Gheorghe; Oprescu, Theodor; Filip, Mihaela; Sociu, Florin
2008-01-01
The paper presents the progress of the Radioactive Waste Management Plan which accompanies the Decommissioning Plan for research reactor WWR-S located in Magurele, Ilfov, near Bucharest, Romania. The new variant of the Decommissioning Plan was elaborated taking into account the IAEA recommendation concerning radioactive waste management. A new feasibility study for WWR-S decommissioning was also developed. The preferred safe management strategy for radioactive wastes produced by reactor decommissioning is outlined. The strategy must account for reactor decommissioning, as well as rehabilitation of the existing Radioactive Waste Treatment Plant and the upgrade of the Radioactive Waste Disposal Facility at Baita-Bihor. Furthermore, the final rehabilitation of the laboratories and reusing of cleaned reactor building is envisaged. An inventory of each type of radioactive waste is presented. The proposed waste management strategy is selected in accordance with the IAEA assistance. Environmental concerns are part of the radioactive waste management strategy. (authors)
International Nuclear Information System (INIS)
Gelbutovsky, A.B.; Kishkin, S.A.; Mochenov, M.I.; Troshev, A.V.; Cheremisin, P.I.; Chernichenko, A.A.
2006-01-01
The principal objective of the paper is to present operating experience in management of radioactive metal waste, originating at nuclear power facilities of the Russian Federation. Issues of radioactive metal waste recycling by melting, with the purpose of unrestricted re-use in industry, or restricted re-use within the nuclear industry, have been considered. The necessity for using a method of melting at the final stage of radioactive metal waste recycling has been proved. Priority measures to be taken and results achieved in the implementation of the Governmental purpose-oriented programme 'Radioactive Metal Waste Reprocessing and Utilization' have been considered, the CJSC ECOMET-S being the main contractor on the Programme. Main specifications and results of operating a commercial melting facility, owned by CJSC 'ECOMET-S' and used to recycle low-level radioactive metal waste originated at the Leningrad Nuclear Power Plant, have been presented. (author)
Continuous biohydrogen production from waste bread by anaerobic sludge.
Han, Wei; Huang, Jingang; Zhao, Hongting; Li, Yongfeng
2016-07-01
In this study, continuous biohydrogen production from waste bread by anaerobic sludge was performed. The waste bread was first hydrolyzed by the crude enzymes which were generated by Aspergillus awamori and Aspergillus oryzae via solid-state fermentation. It was observed that 49.78g/L glucose and 284.12mg/L free amino nitrogen could be produced with waste bread mass ratio of 15% (w/v). The waste bread hydrolysate was then used for biohydrogen production by anaerobic sludge in a continuous stirred tank reactor (CSTR). The optimal hydrogen production rate of 7.4L/(Ld) was achieved at chemical oxygen demand (COD) of 6000mg/L. According to the results obtained from this study, 1g waste bread could generate 0.332g glucose which could be further utilized to produce 109.5mL hydrogen. This is the first study which reports continuous biohydrogen production from waste bread by anaerobic sludge. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Craig, Robert B.; Rothermich, Nancy E.
1991-01-01
In May 1987 all mixed waste generated at the U.S. Department of Energy (DOE) facilities became jointly regulated by the U.S. Environmental Protection Agency (EPA) and DOE. The Department of Defense (DOD) generates hazardous wastes and is also regulated by the EPA. To maintain or attain compliance, both DOE and DOD have initiated compliance activities on all hazardous and mixed waste streams. This compliance includes the development of innovative technologies and processes to avoid the generation of hazardous and mixed wastes, development of technologies to treat the process wastes that are unavoidably generated, development of technologies to restore the environment where wastes have been released to the environment, the cleanup of asbestos and the monitoring of radon in federal facilities, the completion of remedial investigation/feasibility studies, and development of the data systems that are necessary to compile this information. This paper will describe each of these activities as they relate to compliance with the Resource Conservation and Recovery Act and/or CERCLA and their implementing regulations
The U.S. Nuclear Regulatory Commission's role in the management of radioactive wastes
International Nuclear Information System (INIS)
Bernero, R.M.; Kalman, K.L.
1991-01-01
This paper discusses the U.S. Nuclear Regulatory Commission's (NRC's) role in the management of radioactive waste. It provides an overview of the NRC's programs for the management of High-Level and Low-Level radioctive wastes and uranium mill tailings. (author) 7 refs
Continuous Partial Attention as a Problematic Technology Use: A Case Of Educators
Directory of Open Access Journals (Sweden)
Dr. Mehmet Firat
2013-07-01
Full Text Available Continuous Partial Attention is a current concept open to research which, besides multitasking, intensely occupies the agenda of education, communication and cognitive psychology. The purpose of the present study was to determine educators’ continuous partial attention. In line with this purpose, the research data were collected from 109 educators in higher education from different age groups and from four different countries with the use of a questionnaire made up of two sections and seven questions. The findings obtained in the study revealed that the educators’ Continuous Partial Attention did not significantly differ with respect to their technology use efficacies, their ages or their countries. In addition, it was found out that the educators’ Continuous Partial Attention differed statistically significantly depending on the fields they worked in. Based on this, it could be stated that educators working in the field of educational technologies encounter with Continuous Partial Attention more frequently than educators working in other fields. At the end of the study, several suggestions were put forward.
Directory of Open Access Journals (Sweden)
Shamsad Ahmad
2014-01-01
Full Text Available In the exploratory study presented in this paper, an attempt was made to develop different mixtures of ultrahigh performance concrete (UHPC using various locally available natural and industrial waste materials as partial replacements of silica fume and sand. Materials such as natural pozzolana (NP, fly ash (FA, limestone powder (LSP, cement kiln dust (CKD, and pulverized steel slag (PSS, all of which are abundantly available in Saudi Arabia at little or no cost, were employed in the development of the UHPC mixtures. A base mixture of UHPC without replacement of silica fume or sand was selected and a total of 24 trial mixtures of UHPC were prepared using different percentages of NP, FA, LSP, CKD, and PSS, partially replacing the silica fume and sand. Flow and 28-d compressive strength of each UHPC mixture were determined to finally select those mixtures, which satisfied the minimum flow and strength criteria of UHPC. The test results showed that the utilization of NP, FA, LSP, CKD, and PSS in production of UHPC is possible with acceptable flow and strength. A total of 10 UHPC mixtures were identified with flow and strength equal to or more than the minimum required.
Kinematics of SNRs CTB 109 and G206.9+2.3
Rosado, Margarita; Sánchez-Cruces, Mónica; Ambrocio-Cruz, Patricia
2017-11-01
We present results of optical observations in the lines of Hα and [SII] (λ 6717 and 6731 Å) obtained with the UNAM Scanning Fabry-Perot Interferometer PUMA (Rosado et al. 1995,RMxAASC, 3, 263 ) aimed at obtaining the kinematical distance, shock velocity and other important parameters of two supernova remnants (SNRs) with optical counterparts. We discuss on how kinematical distances thus obtained fit with other distance determinations. The studied SNRs are CTB 109 (SNR G109.1 - 1.0) hosting a magnetar (Sánchez-Cruces et al. 2017, in preparation) and the SNR G206.9 + 2.3 (Ambrocio-Cruz et al. 2014,RMxAA, 50, 323), a typical supernova remnant, to have a comparison. In Fig. 1 is depicted the [SII] line emission of two filaments of the optical counterpart of SNR CTB 109. We find complex radial velocity profiles obtained with the Fabry-Perot interferometer, revealing the presence of different velocity components. From these velocity profiles we obtain the kinematical distance, an expansion velocity of 188 km/s and an initial energy of 8.1 x 1050 ergs. These values are rather typical of other SNRs regardless that SNR CTB 109 hosts a magnetar. Thus, the mechanical energy delivered in the supernova explosion forming the magnetar does not seem to impact more than other SNe explosions the interstellar medium. This work has been funded by grants IN103116 and 253085 from DGAPA-UNAM and CONACYT, respectively.
Le, Aurora B; Hoboy, Selin; Germain, Anne; Miller, Hal; Thompson, Richard; Herstein, Jocelyn J; Jelden, Katelyn C; Beam, Elizabeth L; Gibbs, Shawn G; Lowe, John J
2018-02-01
The recent Ebola outbreak led to the development of Ebola virus disease (EVD) best practices in clinical settings. However, after the care of EVD patients, proper medical waste management and disposal was identified as a crucial component to containing the virus. Category A waste-contaminated with EVD and other highly infectious pathogens-is strictly regulated by governmental agencies, and led to only several facilities willing to accept the waste. A pilot survey was administered to determine if U.S. medical waste facilities are prepared to handle or transport category A waste, and to determine waste workers' current extent of training to handle highly infectious waste. Sixty-eight percent of survey respondents indicated they had not determined if their facility would accept category A waste. Of those that had acquired a special permit, 67% had yet to modify their permit since the EVD outbreak. This pilot survey underscores gaps in the medical waste industry to handle and respond to category A waste. Furthermore, this study affirms reports a limited number of processing facilities are capable or willing to accept category A waste. Developing the proper management of infectious disease materials is essential to close the gaps identified so that states and governmental entities can act accordingly based on the regulations and guidance developed, and to ensure public safety. Copyright © 2018 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Benally, A.B.
1997-01-01
This Sampling and Analysis Plan (SAP) establishes the requirements and guidelines to be used by the Waste Management Federal Services of Hanford, Inc. personnel in characterizing liquid waste generated at the 222-S Laboratory Complex. The characterization process to verify the accuracy of process knowledge used for designation and subsequent management of wastes consists of three steps: to prepare the technical rationale and the appendix in accordance with the steps outlined in this SAP; to implement the SAP by sampling and analyzing the requested waste streams; and to compile the report and evaluate the findings to the objectives of this SAP. This SAP applies to portions of the 222-S Laboratory Complex defined as Generator under the Resource Conservation and Recovery Act (RCRA). Any portion of the 222-S Laboratory Complex that is defined or permitted under RCRA as a treatment, storage, or disposal (TSD) facility is excluded from this document. This SAP applies to the liquid waste generated in the 222-S Laboratory Complex. Because the analytical data obtained will be used to manage waste properly, including waste compatibility and waste designation, this SAP will provide directions for obtaining and maintaining the information as required by WAC173-303
Directory of Open Access Journals (Sweden)
Gustavo Barreto de Melo
2003-12-01
Full Text Available OBJETIVO: Avaliar os efeitos do omeprazol e do pantoprazol sobre a regeneração hepática após hepatectomia parcial. MÉTODOS: Cinqüenta e oito ratos Wistar machos foram divididos em 4 grupos: Grupo SHAM, Grupo HP, Grupo PANTO e Grupo OMEP. Eles foram submetidos a hepatectomia parcial de 67% (Grupos HP, PANTO e OMEP ou laparotomia (Grupo SHAM. Os fígados foram removidos 32 e 56 horas após a operação. Depois, os animais foram sacrificados. Em todos os grupos, as substâncias (solução salina, omeprazol e pantoprazol foram aplicadas diariamente a partir do momento em que foram operados até o sacrifício. RESULTADOS: O índice de mitose no Grupo SHAM não foi significativo. Trinta e duas horas após a hepatectomia, a contagem de mitoses foi de 1,2 ± 1,09 para o Grupo HP, 1,2 ± 1,6 para o Grupo OMEP e 2,6 ± 3,2 para o Grupo PANTO. Na análise após 56 horas, os valores foram 1,6 ± 0,89 para o HP, 2 ± 1,8 para o OMEP e 2,6 ± 0,54 para o PANTO. Esses resultados não foram estatisticamente significativos. CONCLUSÃO: O omeprazol e o pantoprazol, agentes inibidores da bomba de prótons (H+, K+-ATPase, não interferem na regeneração hepática 32 e 56 horas após hepatectomia parcial a 67% em ratos.PURPOSE: To assess the effects of omeprazole and pantoprazole on liver regeneration after partial hepatectomy. METHODS: Fifty eight male Wistar rats were divided into 4 groups: SHAM, HP, PANTO and OMEP Groups. They were submitted to 67% partial hepatectomy (HP, PANTO and OMEP Groups or laparotomy (SHAM Group. Their livers were removed 32 and 56 hours after the operation. Then, the animals were sacrificed. In all groups, the substances (saline solution, omeprazole and pantoprazole were injected once daily from the moment they were operated on until the time of sacrifice. RESULTS: In SHAM Group the mitotic index was not significant. Thirty two hours after hepatectomy, the mitosis index was 1.2 ± 1.09 in HP Group, 1.2 ± 1.6 in OMEP Group and 2
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-07-01
The U.S. Department of Energy (DOE) has established the Mixed Waste Focus Area (MWFA), which represents a national effort to develop and coordinate treatment solutions for mixed waste among all DOE facilities. The hazardous waste component of mixed waste is regulated under the Resource Conservation and Recovery Act (RCRA), while the radioactive component is regulated under the Atomic Energy Act, as implemented by the DOE, making mixed waste one of the most complex types of waste for the DOE to manage. The MWFA has the mission to support technologies that meet the needs of the DOE`s waste management efforts to characterize, treat, and dispose of mixed waste being generated and stored throughout the DOE complex. The technologies to be supported must meet all regulatory requirements, provide cost and risk improvements over available technologies, and be acceptable to the public. The most notable features of the DOE`s mixed-waste streams are the wide diversity of waste matrices, volumes, radioactivity levels, and RCRA-regulated hazardous contaminants. Table 1-1 is constructed from data from the proposed site treatment plans developed by each DOE site and submitted to DOE Headquarters. The table shows the number of mixed-waste streams and their corresponding volumes. This table illustrates that the DOE has a relatively small number of large-volume mixed-waste streams and a large number of small-volume mixed-waste streams. There are 1,033 mixed-waste streams with volumes less than 1 cubic meter; 1,112 mixed-waste streams with volumes between 1 and 1,000 cubic meters; and only 61 mixed-waste streams with volumes exceeding 1,000 cubic meters.
Mat Aris, S.; Muthusamy, K.; Uzer, A.; Ahmad, S. Wan
2018-04-01
Environmental pollution caused by the disposal of solid wastes generated from both palm oil industry and cockle shell trade has motivated researches to explore the potential of these wastes. Integrating these wastes in production of construction material is one of the ways to reduce amount of waste thrown at dumping area. Thus, the present investigation investigates the performance of palm oil fuel ash (POFA) cement sand brick containing pulverized cockle shell as partial fine aggregate replacement. All mixes used contain 20% of POFA as partial cement replacement. Total of six mixes were prepared by adding a range of pulverized cockle shell that is 0%, 10%, 20%, 30%, 40% and 50% as partial sand replacement. The mixes were prepared in form of brick. All the water cured samples were tested for compressive strength and flexural strength until 28 days. Findings show that brick produced using 20% pulverized cockle shell exhibit the highest compressive strength and flexural strength also the lowest water absorption value.
A chiral quark model for meson electroproduction in the S11 partial wave
International Nuclear Information System (INIS)
Golli, B.; Sirca, S.
2011-01-01
We calculate the meson scattering and electroproduction amplitudes in the S11 partial wave in a coupled-channel approach that incorporates quasi-bound quark-model states. Using the quark wave functions and the quark-meson interaction from the Cloudy Bag Model, we obtain a good overall agreement with the available experimental results for the partial widths of the N(1535) and the N(1650) resonances as well as for the pion, eta and kaon electroproduction amplitudes. Our model is consistent with the N(1535) resonance being dominantly a genuine three-quark state rather than a quasi-bound state of mesons and baryons. (orig.)
41 CFR 109-26.501-54 - Communications equipment.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Communications equipment. 109-26.501-54 Section 109-26.501-54 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...
Autoimmune Hepatitis with Distal Renal Tubular Acidosis and Small Bowel Partial Malrotation.
Kanaiyalal Modi, Tejas; Parikh, Hardik; Sadalge, Abhishek; Gupte, Amit; Bhatt, Pratin; Shukla, Akash
2015-01-01
Renal tubular acidosis (RTA) is not uncommon in patient with chronic autoimmune hepatitis (AIH), but usually remains latent. Here, we report a case of renal tubular acidosis RTA who presented with AIH. She was also diagnosed to have partial bowel malrotation. A 9-year-old girl, a case of distal RTA, presented with jaundice, abdominal distension and altered sensorium. She was diagnosed to be AIH, which was successfully treated with steroids and azathioprine. Coexistent midgut partial malrotation with volvulus was diagnosed during the treatment. She was treated successfully with anti-tuberculous treatment for cervical lymphadenitis. Autoimmune hepatitis should not be ruled out in each case of RTA presenting with jaundice. Modi TK, Parikh H, Sadalge A, Gupte A, Bhatt P, Shukla A. Autoimmune Hepatitis with Distal Renal Tubular Acidosis and Small Bowel Partial Malrotation. Euroasian J Hepato-Gastroenterol 2015;5(2):107-109.
Evaluation of S-type fiberglass composites for use in high-level radioactive waste environments
International Nuclear Information System (INIS)
Parra, S.A.
1996-01-01
Two types of S-type fiberglass materials were evaluated for use in a high-level radioactive waste environment. The S-type fiberglass composites tested were in the form of tubes and were exposed to a simulated high-level radioactive waste environment consisting of corrosive chemicals, high gamma radiation, and elevated temperatures. The physical properties of the exposed and unexposed tube samples were compared to determine the effects of the simulated environment on the S-type fiberglass composites
Assessment of the microscreen phage-induction assay for screening hazardous wastes (1989)
Energy Technology Data Exchange (ETDEWEB)
Houk, V.S.; DeMarini, D.M.
1989-01-01
The Microscreen phage-induction assay, which quantitatively measures the induction of prophage Lambda in Escherichia coli WP2s(Lambda), was used to test 14 crude (unfractionated) hazardous industrial-waste samples for genotoxic activity in the presence and absence of metabolic activation. Eleven of the 14 wastes induced prophage, and induction was observed at concentrations as low as 0.4 picograms per ml. Comparisons of the mutagenic activity of these waste samples in Salmonella and their ability to induce prophage Lambda indicate that the phage-induction assay was a more-sensitive indicator of genetic damage for this group of wastes. All but one of the wastes that were mutagenic to Salmonella were detected by the phage-induction assay, and 5 wastes not mutagenic to Salmonella were genetically active in the phage assay. The enhanced ability of the phage-induction assay to detect genotoxic activity may be related to the constituents comprising these waste samples. Partial chemical characterizations of the wastes showed high concentrations of carcinogenic metals, solvents, and chlorinated compounds, most of which are detected poorly by the Salmonella assay.
International Nuclear Information System (INIS)
Mueller, C.; Nabelssi, B.; Roglans-Ribas, J.
1995-04-01
This report contains the Appendices for the Analysis of Accident Sequences and Source Terms at Waste Treatment and Storage Facilities for Waste Generated by the U.S. Department of Energy Waste Management Operations. The main report documents the methodology, computational framework, and results of facility accident analyses performed as a part of the U.S. Department of Energy (DOE) Waste Management Programmatic Environmental Impact Statement (WM PEIS). The accident sequences potentially important to human health risk are specified, their frequencies are assessed, and the resultant radiological and chemical source terms are evaluated. A personal computer-based computational framework and database have been developed that provide these results as input to the WM PEIS for calculation of human health risk impacts. This report summarizes the accident analyses and aggregates the key results for each of the waste streams. Source terms are estimated and results are presented for each of the major DOE sites and facilities by WM PEIS alternative for each waste stream. The appendices identify the potential atmospheric release of each toxic chemical or radionuclide for each accident scenario studied. They also provide discussion of specific accident analysis data and guidance used or consulted in this report
Energy Technology Data Exchange (ETDEWEB)
Mueller, C.; Nabelssi, B.; Roglans-Ribas, J. [and others
1995-04-01
This report contains the Appendices for the Analysis of Accident Sequences and Source Terms at Waste Treatment and Storage Facilities for Waste Generated by the U.S. Department of Energy Waste Management Operations. The main report documents the methodology, computational framework, and results of facility accident analyses performed as a part of the U.S. Department of Energy (DOE) Waste Management Programmatic Environmental Impact Statement (WM PEIS). The accident sequences potentially important to human health risk are specified, their frequencies are assessed, and the resultant radiological and chemical source terms are evaluated. A personal computer-based computational framework and database have been developed that provide these results as input to the WM PEIS for calculation of human health risk impacts. This report summarizes the accident analyses and aggregates the key results for each of the waste streams. Source terms are estimated and results are presented for each of the major DOE sites and facilities by WM PEIS alternative for each waste stream. The appendices identify the potential atmospheric release of each toxic chemical or radionuclide for each accident scenario studied. They also provide discussion of specific accident analysis data and guidance used or consulted in this report.
Chen, Size; Chen, Xuemei; Li, Yuqi; Yang, Shu; Mo, Xianyi; Zhang, Fan; Mo, Kailan; Ding, Ying
2015-06-01
To investigate the effect of 17-AAG combined with paclitaxel (PTX) on the proliferation and apoptosis of esophageal squamous cell carcinoma cell line Eca-109 in vitro. Eca-109 cells were treated with 17-AAG and PTX either alone or in combination. The proliferation of Eca-109 cells was detected by MTT assay, and the cell cycle changes and cell apoptosis were determined by flow cytometry. Compared with the control group, both 17-AAG and PTX significantly inhibited the proliferation of Eca-109 cells. A combined treatment of the cells with 0.5 µmol/L PTX and 0.625 µmol/L 17-AAG produced an obviously stronger inhibitory effect on the cell proliferation than either of the agents used alone (PAAG and PTX used alone caused Eca-109 cell cycle arrest in G2/M phase and S phase, respectively, and their combined use caused cell cycle arrest in both G2/M and S phases. The cell apoptosis rates of Eca-109 cells treated with 17-AAG, PTX and their combination were 4.52%, 10.91%, and 29.88%, respectively, all significantly higher than that in the control group (1.32%); the combined treatment resulted in a distinct apoptotic peak that was significantly higher than that caused by either of the agents alone. 17-AAG and PTX can inhibit cell proliferation and promote apoptosis of Eca-109 cells, and their combination produces stronger effects in inhibiting cell proliferation and increasing cell apoptosis.
International Nuclear Information System (INIS)
Cheung, S.C.H.; Chan, T.
1983-07-01
In the geological disposal of nuclear fuel waste, one option is to emplace the waste container in a borehole drilled into the floor of the underground vault. In the borehole, the waste container is surrounded by a compacted soil material known as the buffer. A finite-element simulation has been performed to study the effect of localized partial failure of the waste container on the steady-state radionuclide transport by diffusion from the container through the buffer to the surrounding rock and/or backfill. In this study, the radionuclide concentration at the buffer-backfill interface is assumed to be zero. Two cases are considered at the interface between the buffer and the rock. In case 1, a no-flux boundary condition is used to simulate intact rock. In case 2, a constant radionuclide concentration condition is used to simulate fractured rock with groundwater flow. The results show that the effect of localized partial failure of the waste container on the total flux is dependent on the boundary condition at the buffer-rock interface. For the intact rock condition, the total flux is mainly dependent on the location of the failure. The total flux increases as the location changes from the bottom to the top of the emplaced waste container. For a given localized failure of the waste container, the total flux remains unaffected by the area of failed surface below the top of the failure. For fractured rock, the total flux is directly proportional to the failed surface area of the waste container regardless of the failure location
41 CFR 109-26.501-51 - Used vehicles.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Used vehicles. 109-26.501-51 Section 109-26.501-51 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...
41 CFR 109-40.302 - Standard routing principle.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Standard routing principle. 109-40.302 Section 109-40.302 Public Contracts and Property Management Federal Property... Standard routing principle. (a) Shipments shall be routed using the mode of transportation, or individual...
41 CFR 109-38.502-50 - DOE guidelines.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false DOE guidelines. 109-38.502-50 Section 109-38.502-50 Public Contracts and Property Management Federal Property Management... guidelines. (a) Whenever practicable and cost effective, commercial service facilities shall be utilized for...
Managing America`s solid waste
Energy Technology Data Exchange (ETDEWEB)
1998-03-02
This report presents an historical overview of the federal role in municipal solid waste management from 1965 to approximately 1995. Attention is focuses on the federal role in safeguarding public health, protecting the environment, and wisely using material and energy resources. It is hoped that this report will provide important background for future municipal solid waste research and development initiatives.
Waste management project’s alternatives: A risk-based multi-criteria assessment (RBMCA) approach
International Nuclear Information System (INIS)
Karmperis, Athanasios C.; Sotirchos, Anastasios; Aravossis, Konstantinos; Tatsiopoulos, Ilias P.
2012-01-01
Highlights: ► We examine the evaluation of a waste management project’s alternatives. ► We present a novel risk-based multi-criteria assessment (RBMCA) approach. ► In the RBMCA the evaluation criteria are based on the quantitative risk analysis of the project’s alternatives. ► Correlation between the criteria weight values and the decision makers’ risk preferences is examined. ► Preference to the multi-criteria against the one-criterion evaluation process is discussed. - Abstract: This paper examines the evaluation of a waste management project’s alternatives through a quantitative risk analysis. Cost benefit analysis is a widely used method, in which the investments are mainly assessed through the calculation of their evaluation indicators, namely benefit/cost (B/C) ratios, as well as the quantification of their financial, technical, environmental and social risks. Herein, a novel approach in the form of risk-based multi-criteria assessment (RBMCA) is introduced, which can be used by decision makers, in order to select the optimum alternative of a waste management project. Specifically, decision makers use multiple criteria, which are based on the cumulative probability distribution functions of the alternatives’ B/C ratios. The RBMCA system is used for the evaluation of a waste incineration project’s alternatives, where the correlation between the criteria weight values and the decision makers’ risk preferences is analyzed and useful conclusions are discussed.
40 CFR 26.109 - IRB review of research.
2010-07-01
... 26.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA Policy for Protection of Subjects in Human Research Conducted or Supported by EPA § 26.109 IRB... subjects when in the IRB's judgment the information would meaningfully add to the protection of the rights...
41 CFR 105-1.109-52 - Cross-references.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Cross-references. 105-1.109-52 Section 105-1.109-52 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...
49 CFR 1522.109 - TSA review and approval.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false TSA review and approval. 1522.109 Section 1522.109..., DEPARTMENT OF HOMELAND SECURITY SECURITY RULES FOR ALL MODES OF TRANSPORTATION TSA-APPROVED VALIDATION FIRMS AND VALIDATORS TSA-Approved Validation Firms and Validators for the Certified Cargo Screening Program...
19 CFR 10.9 - Articles exported for processing.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles exported for processing. 10.9 Section 10... THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. General Provisions Articles Exported and Returned § 10.9 Articles exported for processing. (a) Except as otherwise provided for in this...
41 CFR 109-50.402 - Submission of proposals.
2010-07-01
... for any proposed charge to DOE for amortizing the cost of plant and equipment items; (3) Recapture of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Submission of proposals. 109-50.402 Section 109-50.402 Public Contracts and Property Management Federal Property Management...
Globicatella sanguinis bacteraemia identified by partial 16S rRNA gene sequencing
DEFF Research Database (Denmark)
Abdul-Redha, Rawaa Jalil; Balslew, Ulla; Christensen, Jens Jørgen
2007-01-01
Globicatella sanguinis is a gram-positive coccus, resembling non-haemolytic streptococci. The organism has been isolated infrequently from normally sterile sites of humans. Three isolates obtained by blood culture could not be identified by Rapid 32 ID Strep, but partial sequencing of the 16S r......RNA gene revealed the identity of the isolated bacteria, and supplementary biochemical tests confirmed the species identification. The cases histories illustrate the dilemma of finding relevant, newly recognized, opportunistic pathogens and the identification achievement (s) that can be obtained by using...
Energy Technology Data Exchange (ETDEWEB)
Smith, Gary L.; Kim, Dong-Sang; Schweiger, Michael J.; Marra, James C.; Lang, Jesse B.; Crum, Jarrod V.; Crawford, Charles L.; Vienna, John D.
2014-05-22
The cold crucible induction melter (CCIM) is an alternative technology to the currently deployed liquid-fed, ceramic-lined, Joule-heated melter for immobilizing of U.S. tank waste generated from defense related reprocessing. In order to accurately evaluate the potential benefits of deploying a CCIM, glasses must be developed specifically for that melting technology. Related glass formulation efforts have been conducted since the 1990s including a recent study that is first documented in this report. The purpose of this report is to summarize the silicate base glass formulation efforts for CCIM testing of U.S. tank wastes. Summaries of phosphate based glass formulation and phosphate and silicate based CCIM demonstration tests are reported separately (Day and Ray 2013 and Marra 2013, respectively). Combined these three reports summarize the current state of knowledge related to waste form development and process testing of CCIM technology for U.S. tank wastes.
One project`s waste is another project`s resource
Energy Technology Data Exchange (ETDEWEB)
Short, J.
1997-02-01
The author describes the efforts being made toward pollution prevention within the DOE complex, as a way to reduce overall project costs, in addition to decreasing the amount of waste to be handled. Pollution prevention is a concept which is trying to be ingrained into project planning. Part of the program involves the concept that ultimately the responsibility for waste comes back to the generator. Parts of the program involve efforts to reuse materials and equipment on new projects, to recycle wastes to generate offsetting revenue, and to increase awareness, accountability and incentives so as to stimulate action on this plan. Summaries of examples are presented in tables.
32 CFR 701.109 - Privacy Act (PA) appeals.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Privacy Act (PA) appeals. 701.109 Section 701... OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.109 Privacy Act (PA) appeals. (a... commence when the appeal reaches the office of the review authority having jurisdiction over the record...
Suitability of Polyvinyl Waste Powder as Partial Replacement for ...
African Journals Online (AJOL)
B Up to 50% by weight of cement was replaced with PWP at interval of 10%. The parameters investigated are: the chemical composition of polyvinyl waste powder (PWP) and the setting times of cement-polyvinyl paste. Also investigated in concrete containing polyvinyl powder were: workability, density, compressive strength ...
SPEEDUP simulation of liquid waste batch processing. Revision 1
International Nuclear Information System (INIS)
Shannahan, K.L.; Aull, J.E.; Dimenna, R.A.
1994-01-01
The Savannah River Site (SRS) has accumulated radioactive hazardous waste for over 40 years during the time SRS made nuclear materials for the United States Department of Energy (DOE) and its predecessors. This waste is being stored as caustic slurry in a large number of 1 million gallon steel tanks, some of which were initially constructed in the early 1950's. SRS and DOE intend to clean up the Site and convert this waste into stable forms which then can be safely stored. The liquid waste will be separated into a partially decontaminated low-level and radioactive high-level waste in one feed preparation operation, In-Tank Precipitation. The low-level waste will be used to make a concrete product called saltstone in the Saltstone Facility, a part of the Defense Waste Processing Facility (DWPF). The concrete will be poured into large vaults, where it will be permanently stored. The high-level waste will be added to glass-formers and waste slurry solids from another feed preparation operation, Extended Sludge Processing. The mixture will then be converted to a stable borosilicate glass by a vitrification process that is the other major part of the DWPF. This glass will be poured into stainless steel canisters and sent to a temporary storage facility prior to delivery to a permanent underground storage site
40 CFR 600.109-78 - EPA driving cycles.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false EPA driving cycles. 600.109-78 Section... Model Year Automobiles-Test Procedures § 600.109-78 EPA driving cycles. (a) The driving cycle to be... driving cycle to be utilized for generation of the highway fuel economy data is specified in this...
Valdez, A.
2000-01-01
This is the Engineering Test Report, Radiated Emissions and SARR, SARP, DCS Receivers, Link Frequencies EMI Sensitive Band Test Results, AMSU-A1, S/N 109, for the Integrated Advanced Microwave Sounding Unit-A (AMSU-A).
Abdulmughni, Ammar; Jóźwik, Ilona K; Putkaradze, Natalia; Brill, Elisa; Zapp, Josef; Thunnissen, Andy-Mark W H; Hannemann, Frank; Bernhardt, Rita
2017-02-10
In this study the ability of CYP109E1 from Bacillus megaterium to metabolize vitamin D 3 (VD 3 ) was investigated. In an in vitro system using bovine adrenodoxin reductase (AdR) and adrenodoxin (Adx 4-108 ), VD 3 was converted by CYP109E1 into several products. Furthermore, a whole-cell system in B. megaterium MS941 was established. The new system showed a conversion of 95% after 24h. By NMR analysis it was found that CYP109E1 catalyzes hydroxylation of VD 3 at carbons C-24 and C-25, resulting in the formation of 24(S)-hydroxyvitamin D 3 (24S(OH)VD 3 ), 25-hydroxyvitamin D 3 (25(OH)VD 3 ) and 24S,25-dihydroxyvitamin D 3 (24S,25(OH) 2 VD 3 ). Through time dependent whole-cell conversion of VD 3 , we identified that the formation of 24S,25(OH) 2 VD 3 by CYP109E1 is derived from VD 3 via the intermediate 24S(OH)VD 3 . Moreover, using docking analysis and site-directed mutagenesis, we identified important active site residues capable of determining substrate specificity and regio-selectivity. HPLC analysis of the whole-cell conversion with the I85A-mutant revealed an increased selectivity towards 25-hydroxylation of VD 3 compared with the wild type activity, resulting in an approximately 2-fold increase of 25(OH)VD 3 production (45mgl -1 day -1 ) compared to wild type (24.5mgl -1 day -1 ). Copyright © 2017 Elsevier B.V. All rights reserved.
Environmental evaluation of municipal waste prevention
DEFF Research Database (Denmark)
Gentil, Emmanuel; Gallo, Daniele; Christensen, Thomas Højlund
2011-01-01
society, using life-cycle thinking. The partial prevention of unsolicited mail, beverage packaging and food waste is tested for a “High-tech” waste management system relying on high energy and material recovery and for a “Low-tech” waste management system with less recycling and relying on landfilling......Waste prevention has been addressed in the literature in terms of the social and behavioural aspects, but very little quantitative assessment exists of the environmental benefits. Our study evaluates the environmental consequences of waste prevention on waste management systems and on the wider....... Prevention of 13% of the waste mass entering the waste management system generates a reduction of loads and savings in the waste management system for the different impacts categories; 45% net reduction for nutrient enrichment and 12% reduction for global warming potential. When expanding our system...
This is the enforcement alert for Hazardous Waste Management Practices at Mineral Processing Facilities Under Scrutiny by U.S. EPA; EPA Clarifies 'Bevill Exclusion' Wastes and Establishes Disposal Standards
U.S. Army Corps of Engineers Waste Experiences: More Than You May Think
International Nuclear Information System (INIS)
Hays, D. C.; Honerlah, H. B.
2003-01-01
U.S. Army Corps of Engineers (USACE) works with other federal, and state agencies through several different programs on numerous Hazardous, Toxic, and Radioactive Waste (HTRW) sites. Formerly Utilized Sites Remediation Program (FUSRAP), Formerly Used Defense Sites (FUDS), EPA Superfund, Installation Restoration, Army Deactivated Nuclear Reactor Program, and many other programs present hazardous, radioactive, and mixed waste issues. While the USACE has a reputation of excellent dirt movers, little is discussed of our other waste management experiences. This paper discusses some of the challenges facing the Health Physics (HP) staff of the USACE. The HP staff is currently organized as one team, the Radiation Safety Support Team (RSST), comprised of 15 individuals at 6 locations across the country. With typical RSST missions including HP consultation to USACE activities world wide, many waste challenges arise. These challenges have involved radioactive wastes of all classifications and stability. Sealed and unsealed sources; instruments and dials; contaminated earth and debris; liquids; lab, reactor, and medical wastes are all successfully managed by the USACE. USACE also develops, evaluates, and utilizes waste treatment Types of radioactive waste at HTRW sites include: Low Level Radioactive Wastes (LLRW) (class A, B, C, and greater than C), 11e.(2), Transuranic (TRU), Mixed, and Naturally Occurring (NORM/TENORM)
A comparative study on per capita waste generation according to a waste collecting system in Korea.
Oh, Jung Hwan; Lee, Eui-Jong; Oh, Jeong Ik; Kim, Jong-Oh; Jang, Am
2016-04-01
As cities are becoming increasingly aware of problems related to conventional mobile collection systems, automated pipeline-based vacuum collection (AVAC) systems have been introduced in some densely populated urban areas. The reasons are that in addition to cost savings, AVAC systems can be efficient, hygienic, and environmentally friendly. Despite difficulties in making direct comparisons of municipal waste between a conventional mobile collection system and an AVAC system, it is meaningful to measure the quantities in each of these collection methods either in total or on a per capita generation of waste (PCGW, g/(day*capita)) basis. Thus, the aim of this study was to assess the difference in per capita generation of household waste according to the different waste collection methods in Korea. Observations on household waste show that there were considerable differences according to waste collection methods. The value of per capita generation of food waste (PCGF) indicates that a person in a city using AVAC produces 60 % of PCGF (109.58 g/(day*capita)), on average, compared with that of a truck system (173.10 g/(day*capita)) as well as 23 %p less moisture component than that with trucks. The value of per capita generation of general waste (PCGG) in a city with an AVAC system showed 147.73 g/(day*capita), which is 20 % less than that with trucks delivered (185 g/(day*capita)). However, general waste sampled from AVAC showed a 35 %p increased moisture content versus truck delivery.
40 CFR 600.109-08 - EPA driving cycles.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false EPA driving cycles. 600.109-08 Section... Model Year Automobiles-Test Procedures § 600.109-08 EPA driving cycles. (a) The FTP driving cycle is prescribed in § 86.115 of this chapter. (b) The highway fuel economy driving cycle is specified in this...
Waste generated by the future decommissioning of the Magurele VVR-S Research Reactor
International Nuclear Information System (INIS)
Dragolici, F.; Turcanu, C.N.; Dragolici, A.C.
2001-01-01
Nuclear Research Reactor WWR-S from the National Institute of Research and Development for Physics and Nuclear Engineering 'Horia Hulubei', Bucharest-Magurele, was commissioned in July 1957 and it was shut down in December 1997. At the moment the reactor is in conservation state. During its operation this reactor worked at an average power of 2MW, almost 3216 h/year, producing a total thermal power of 230 x 10 3 MWh. No major modifications or improvements were made during the 40 years of operation to the essential parts of the reactor, respective to the primary cooling system, reactor vessel, active core and electronic devices. So, all components of the measure, control and protection systems are old, generally at the technical level of the 1950s, therefore a reason why in December 1997 the operation was ceased. At present, the reactor can be considered, by IAEA definition in the first stage (reactor shut down, but the vital functions are maintained and monitored). The survey is related to the second stage - restrictive use of the area. To develop a real decommissioning project, it was first necessary to evaluate the volume and the characteristics of the radioactive waste which will be generated. Radioactive waste generated during the decommissioning of Magurele WR-S research reactor may be classified as: Activated wastes (internal structures, horizontal channels and thermal column, biological shield); Contaminated wastes (primary circuit non-activated components, hot cells, some technological rooms as main hall, pumps room, radioactive material transfer areas, ventilation building and stack); Possibly contaminated materials from any area of reactor building and ventilation building. After 40 years of nuclear research activities, all such areas are suspected of contamination. The volume of wastes that will result from WWR-S Research Reactor decommissioning is summarized
41 CFR 109-40.103-2 - Disqualification and suspension of carriers.
2010-07-01
... suspension of carriers. 109-40.103-2 Section 109-40.103-2 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-2 Disqualification and suspension of carriers. Disqualification and suspension are...
41 CFR 109-38.204-50 - Records of exempted motor vehicles.
2010-07-01
... motor vehicles. 109-38.204-50 Section 109-38.204-50 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-50 Records of exempted motor vehicles. The Director, Office of...
Properties of radioactive wastes and waste containers
International Nuclear Information System (INIS)
Arora, H.S.; Dayal, R.
1984-01-01
Major tasks in this NRC-sponsored program include: (1) an evaluation of the acceptability of low-level solidified wastes with respect to minimizing radionuclide releases after burial; and (2) an assessment of the influence of pertinent environmental stresses on the performance of high-integrity radwaste container (HIC) materials. The waste form performance task involves studies on small-scale laboratory specimens to predict and extrapolate: (1) leachability for extended time periods; (2) leach behavior of full-size forms; (3) performance of waste forms under realistic leaching conditions; and (4) leachability of solidified reactor wastes. The results show that leach data derived from testing of small-scale specimens can be extrapolated to estimate leachability of a full-scale specimen and that radionuclide release data derived from testing of simulants can be employed to predict the release behavior of reactor wastes. Leaching under partially saturated conditions exhibits lower releases of radionuclides than those observed under the conventional IAEA-type or ANS 16.1 leach tests. The HIC assessment task includes the characterization of mechanical properties of Marlex CL-100, a candidate radwaste high density polyethylene material. Tensile strength and creep rupture tests have been carried out to determine the influence of specific waste constituents as well as gamma irradiation on material performance. Emphasis in ongoing tests is being placed on studying creep rupture while the specimens are in contact with a variety of chemicals including radiolytic by-products of irradiated resin wastes. 12 references 6 figures, 2 tables
Managing wastes from the atomic age and into the future: programs, plans and challenges
International Nuclear Information System (INIS)
Miller, J.M.
2011-01-01
Various types of waste are generated at Atomic Energy of Canada Limited (AECL) nuclear sites from diversified operations, including research reactor operations, radioisotope production, hot cell operations, nuclear fuel fabrication, research and development activities, facility decommissioning, environmental restoration, etc. AECL is responsible for the safe storage and long-term management of waste generated by Chalk River Laboratories (CRL), Whiteshell Laboratories (WL) and the three partially decommissioned prototype reactors, as well as for the radioactive waste received from off-site waste generators on a fee-for-service basis. As the home for the first nuclear reactor in Canada and nuclear research facilities, CRL has been a pioneer in the management of nuclear waste. Since the dawn of the nuclear era in the 1940s, CRL's waste management facilities have evolved from storage in simple sand trenches to below-ground concrete storage, to above-ground facilities offering multiple barriers of containment. To continuously improve the waste management at AECL, a formal Waste Management Program has been introduced. An important component of this Program is a focus on waste reduction and appropriate waste characterization to ensure wastes are being handled, stored and/or disposed in the most cost-effective manner. In 2006, AECL began implementing the Government of Canada-funded Nuclear Legacy Liabilities Program (NLLP) to deal with nuclear legacy liabilities at AECL sites. Approximately 200,000 to 300,000 cubic metres of waste from earlier operations at AECL requires management through the NLLP, with a yearly increase of several thousand cubic metres. Several of the NLLP projects currently underway are focused on improving the robustness of earlier management practices, as older facilities reach the end of their design life. An important element of the NLLP is the development of an Integrated Waste Plan to ensure optimal selection of enabling facilities and their
Release to the gas phase of metals, S and Cl during combustion of dedicated waste fractions
DEFF Research Database (Denmark)
Pedersen, Anne Juul; van Lith, Simone Cornelia; Frandsen, Flemming
2010-01-01
The release to the gas phase of inorganic elements such as alkali metals. Cl, S, and heavy metals in Waste-to-Energy (WtE) boilers is a challenge. Besides the risk of harmful emissions to the environment, inorganic elements released from the grate may cause severe ash deposition and corrosion...... and the link to the formation of fly ash and aerosols in full-scale waste incinerators. The release of metals, S and Cl from four dedicated waste fractions was quantified as a function of temperature in a lab-scale fixed-bed reactor. The waste fractions comprised chromated copper arsenate (CCA) impregnated....... The lab-scale release results were then compared with results from a related, full-scale partitioning study, in which test runs with the addition of similar, dedicated waste fractions to a base-load waste had been performed in a grate-fired WtE boiler. In general, the elements Al, Ca, Cr, Cu, Fe, Mg, Si...
NEXT GENERATION MELTER(S) FOR VITRIFICATION OF HANFORD WASTE: STATUS AND DIRECTION
International Nuclear Information System (INIS)
Ramsey, W.G.; Gray, M.F.; Calmus, R.B.; Edge, J.A.; Garrett, B.G.
2011-01-01
Vitrification technology has been selected to treat high-level waste (HLW) at the Hanford Site, the West Valley Demonstration Project and the Savannah River Site (SRS), and low activity waste (LAW) at Hanford. In addition, it may potentially be applied to other defense waste streams such as sodium bearing tank waste or calcine. Joule-heated melters (already in service at SRS) will initially be used at the Hanford Site's Waste Treatment and Immobilization Plant (WTP) to vitrify tank waste fractions. The glass waste content and melt/production rates at WTP are limited by the current melter technology. Significant reductions in glass volumes and mission life are only possible with advancements in melter technology coupled with new glass formulations. The Next Generation Melter (NGM) program has been established by the U.S. Department of Energy's (DOE's), Environmental Management Office of Waste Processing (EM-31) to develop melters with greater production capacity (absolute glass throughput rate) and the ability to process melts with higher waste fractions. Advanced systems based on Joule-Heated Ceramic Melter (JHCM) and Cold Crucible Induction Melter (CCIM) technologies will be evaluated for HLW and LAW processing. Washington River Protection Solutions (WRPS), DOE's tank waste contractor, is developing and evaluating these systems in cooperation with EM-31, national and university laboratories, and corporate partners. A primary NGM program goal is to develop the systems (and associated flowsheets) to Technology Readiness Level 6 by 2016. Design and testing are being performed to optimize waste glass process envelopes with melter and balance of plant requirements. A structured decision analysis program will be utilized to assess the performance of the competing melter technologies. Criteria selected for the decision analysis program will include physical process operations, melter performance, system compatibility and other parameters.
van Lieshout, Remko; Pisters, Martijn F.; Vanwanseele, Benedicte; de Bie, Rob A.; Wouters, Eveline J.; Stukstette, Mirelle J.
2016-01-01
Background Partial weight bearing is frequently instructed by physical therapists in patients after lower-limb trauma or surgery. The use of biofeedback devices seems promising to improve the patient’s compliance with weight-bearing instructions. SmartStep and OpenGo-Science are biofeedback devices that provide real-time feedback. For a successful implementation, usability of the devices is a critical aspect and should be tested from a user’s perspective. Aim To describe the usability from the physical therapists’ and a patients’ perspective of Smartstep and OpenGo-Science to provide feedback on partial weight bearing during supervised rehabilitation of patients after lower-limb trauma or surgery. Methods In a convergent mixed-methods design, qualitative and quantitative data were collected. Usability was subdivided into user performance, satisfaction and acceptability. Patients prescribed with partial weight bearing and their physical therapists were asked to use SmartStep and OpenGo-Science during supervised rehabilitation. Usability was qualitatively tested by a think-aloud method and a semi-structured interview and quantitatively tested by the System-Usability-Scale (SUS) and closed questions. For the qualitative data thematic content analyses were used. Results Nine pairs of physical therapists and their patients participated. The mean SUS scores for patients and physical therapists were for SmartStep 70 and 53, and for OpenGo-Science 79 and 81, respectively. Scores were interpreted with the Curved Grading Scale. The qualitative data showed that there were mixed views and perceptions from patients and physical therapists on satisfaction and acceptability. Conclusion This study gives insight in the usability of two biofeedback devices from the patient’s and physical therapist’s perspective. The overall usability from both perspectives seemed to be acceptable for OpenGo-Science. For SmartStep, overall usability seemed only acceptable from the
Ecological risk of reprocessing of uranium wastes of the Gafurov's tailing pit
International Nuclear Information System (INIS)
Khakimov, N.; Nazarov, Kh.M.; Kamalov, D.D.; Mirsaidov, U.M.
2010-01-01
Present article is devoted to assessment ecological risk of reprocessing of uranium wastes of the Gafurov's tailing pit. Authors set as their purpose the investigation of ecological risk of reprocessing of uranium wastes of the Gafurov-city's tailing pit. Having carried out their investigations, the authors came to the conclusion that the effect of radon gas during reprocessing to workers and specialists is minimal if they follow all the required safety rules.
Evaluation the microwave heating of spinel crystals in high-level waste glass
Energy Technology Data Exchange (ETDEWEB)
Christian, J. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River Ecology Lab. (SREL); Washington, A. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River Ecology Lab. (SREL)
2015-08-18
In this report, the microwave heating of a crystal-free and a partially (24 wt%) trevorite-crystallized waste glass simulant were evaluated. The results show that a 500 mg piece of partially crystallized waste glass can be heated from room-temperature to above 1600 °C (as measured by infrared radiometry) within 2 minutes using a single mode, highly focused, 2.45 GHz microwave, operating at 300 W. X-ray diffraction measurements show that the partially crystallized glass experiences an 87 % reduction in trevorite following irradiation and thermal quenching. When a crystal-free analogue of the same waste glass simulant composition is exposed to the same microwave radiation it could not be heated above 450 °C regardless of the heating time.
Potential benefits of waste transmutation to the U.S. high-level waste respository
Energy Technology Data Exchange (ETDEWEB)
Michaels, G.E. [Oak Ridge National Laboratory, TN (United States)
1995-10-01
This paper reexamines the potential benefits of waste transmutation to the proposed U.S. geologic repository at the Yucca Mountain site based on recent progress in the performance assessment for the Yucca Mountain base case of spent fuel emplacement. It is observed that actinides are assumed to have higher solubility than in previous studies and that Np and other actinides now dominate the projected aqueous releases from a Yucca Mountain repository. Actinides are also indentified as the dominant source of decay heat in the repository, and the effect of decay heat in perturbing the hydrology, geochemistry, and thermal characteristics of Yucca Mountain are reviewed. It is concluded that the potential for thermally-driven, buoyant, gas-phase flow at Yucca Mountain introduces data and modeling requirements that will increase the costs of licensing the site and may cause the site to be unattractive for geologic disposal of wastes. A transmutation-enabled cold repository is proposed that might allow licensing of a repository to be based upon currently observable characteristics of the Yucca Mountain site.
41 CFR 109-26.501-53 - Acquisitions by transfer.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Acquisitions by transfer. 109-26.501-53 Section 109-26.501-53 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...
International Nuclear Information System (INIS)
Biwer, B.M.; Monette, F.A.; Chen, S.Y.
1995-04-01
This report documents the risk assessment performed for the on-site transportation of radioactive wastes in the U.S. Department of Energy (DOE) Waste Management (WM) Programmatic Environmental Impact Statement (PEIS). Risks for the routine shipment of wastes and the impacts from potential accidental releases are analyzed for operations at the Hanford Site (Hanford) near Richland, Washington. Like other large DOE sites, Hanford conducts waste management operations for all wastes types; consequently, the impacts calculated for Hanford are expected to be greater than those for smaller sites. The risk assessment conducted for on-site transportation is intended to provide an estimate of the magnitude of the potential risk for comparison with off-site transportation risks assessed for the WM PEIS
High-Level waste process and product data annotated bibliography
International Nuclear Information System (INIS)
Stegen, G.E.
1996-01-01
The objective of this document is to provide information on available issued documents that will assist interested parties in finding available data on high-level waste and transuranic waste feed compositions, properties, behavior in candidate processing operations, and behavior on candidate product glasses made from those wastes. This initial compilation is only a partial list of available references
Penerapan PSAK No.109 atas Pengungkapan Wajib dan Sukarela
Directory of Open Access Journals (Sweden)
Yulifa Puspitasari
2013-12-01
Full Text Available The purpose of this research was to understand the impact of PSAK No. 109 about Akuntansi Zakat and Infaq/Sedekah on mandatory and voluntary disclosure. This study employed a case study method and comparative literature/documentary studies between financial statements of BAZNAS and financial statements of Yayasan Yatim Mandiri. The findings indicated that there was incompliance of disclosure with PSAK No.109. There were also some wakaf issues that have not been accommodated by PSAK No.109, which ultimately affected the disclosure of LAZ. The existence non-halal funds contrary to Sharia must be removed.
Striegl, Robert G.
1988-01-01
The unsaturated zone is a medium that provides pneumatic communication for the movement of gases from wastes buried in landfills to the atmosphere, biota, and groundwater. Gases in unsaturated glacial and eolian deposits near a waste-disposal trench at the low-level radioactive-waste disposal site near Sheffield, Bureau County, Illinois, were identified, and the spatial and temporal distributions of the partial pressures of those gases were determined for the period January 1984 through January 1986. Methods for the collection and analyses of the gases are described, as are geologic and hydrologic characteristics of the unsaturated zone that affect gas transport. The identified gases, which are of natural and of waste origin, include nitrogen, oxygen, and argon, carbon dioxide, methane, propane, butane, tritiated water vapor, 14carbon dioxide, and 222 radon. Concentrations of methane and 14carbon dioxide originated at the waste, as shown by partial-pressure gradients of the gases; 14carbon dioxide partial pressures exceeded natural background partial pressures by factors greater than 1 million at some locations. Variations in partial pressures of oxygen and carbon dioxide were seasonal among piezometers because of increased root and soil-microbe respiration during summer. Variations in methane and 14carbon dioxide partial pressures were apparently related to discrete releases from waste sources at unpredictable intervals of time. No greater than background partial pressures for tritiated water vapor or 222 radon were measured. (USGS)
Materials in the U.S. Municipal Waste Stream, 1960 to 2012 (in tons)
U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) has collected and reported data on the generation and disposal of waste in the United States for more than 30 years....
New multidimensional partially integrable generalization of S-integrable N-wave equation
International Nuclear Information System (INIS)
Zenchuk, A. I.
2007-01-01
This paper develops a modification of the dressing method based on the inhomogeneous linear integral equation with integral operator having nonempty kernel. The method allows one to construct the systems of multidimensional partial differential equations having differential polynomial structure in any dimension n. The associated solution space is not full, although it is parametrized by certain number of arbitrary functions of (n-1) variables. We consider four-dimensional generalization of the classical (2+1)-dimensional S-integrable N-wave equation as an example
International Nuclear Information System (INIS)
1977-05-01
A scope of work and a venture guidance appraisal were prepared for a conceptual process and plant facilities for the solidification and long-term storage of radioactive wastes removed from underground storage tanks in the 241 F and H Areas at the Savannah River Plant. Conceptual design was based on incorporating the highly radioactive waste components in a borosilicate type glass. The scope of work describes facilities for: reclaiming liquid and sludge wastes from F and H area tank farms; separating the sludge from the liquid salt solution by physical processes; removing radioactive cesium from the salt solution by ion exchange techniques; incorporating the dried sludge and cesium in a borosilicate glass in stainless steel containers; evaporating the liquid salt solution and encapsulating the resulting salt cake in a stainless steel container; and storing two years' worth of glass and salt containing cyclinders in separate retrievable surface storage facilities. Operations are to be located in a new area, designated the 200-S area. A full complement of power, general, and service facilities are provided. The venture guidance appraisal based on FY 82 authorization and FY 87 turnover is $2,900,000,000. The figure is suitable for planning purposes only. The Glass-form Waste Case is a variation of the concrete-form waste case (or the Reference Plant Case) reported in DPE--3410. The new venture guidance appraisal for the concrete-form case (updated to a consistent time basis with the glass-form case) is $2,900,000,000, indicating no apparent cost advantage between the two waste product forms
The effect of operating conditions on aquatic worms eating waste sludge
Hendrickx, T.L.G.; Temmink, H.; Elissen, H.J.H.; Buisman, C.J.N.
2009-01-01
Several techniques are available for dealing with the waste sludge produced in biological waste water treatment. A biological approach uses aquatic worms to consume and partially digest the waste sludge. In our concept for a worm reactor, the worms (Lumbriculus variegatus) are immobilised in a
ANSTO's waste forms for the 31. century
Energy Technology Data Exchange (ETDEWEB)
Vance, E.R.; Begg, B. D.; Day, R. A.; Moricca, S.; Perera, D. S.; Stewart, M. W. A.; Carter, M. L.; McGlinn, P. J.; Smith, K. L.; Walls, P. A.; Robina, M. La
2004-07-01
ANSTO waste form development for high-level radioactive waste is directed towards practical applications, particularly problematic niche wastes that do not readily lend themselves to direct vitrification. Integration of waste form chemistry and processing method is emphasised. Some longstanding misconceptions about titanate ceramics are dealt with. We have a range of titanate-bearing waste form products aimed at immobilisation of tank wastes and sludges, actinide-rich wastes, INEEL calcines and Na-bearing liquid wastes, Al-rich wastes arising from reprocessing of Al-clad fuels, Mo-rich wastes arising from reprocessing of U-Mo fuels, partitioned Cs-rich wastes, and {sup 99}Tc. Waste form production techniques cover hot isostatic and uniaxial pressing, sintering, and cold-crucible melting, and these are strongly integrated into waste form design. Speciation and leach resistance of Cs and alkalis in cementitious products and geo-polymers are being studied. Recently we have embarked on studies of candidate inert matrix fuels for Pu burning. We also have a considerable program directed at basic understanding of the waste forms in regard to crystal chemistry, dissolution behaviour in aqueous media, radiation damage effects and optimum processing techniques. (authors)
41 CFR 109-26.501-4 - Submission of orders.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Submission of orders. 109-26.501-4 Section 109-26.501-4 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...
U.S. policy and current practices for blending low-level radioactive waste for disposal
Energy Technology Data Exchange (ETDEWEB)
Kessel, David S.; Kim, Chang Lak [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)
2016-09-15
In the near future, many countries, including the Republic of Korea, will face a significant increase in low level radioactive waste (LLW) from nuclear power plant decommissioning. The purpose of this paper is to look at blending as a method for enhancing disposal options for low-level radioactive waste from the decommissioning of nuclear reactors. The 2007 U.S. Nuclear Regulatory Commission strategic assessment of the status of the U.S. LLW program identified the need to move to a risk-informed and performance-based regulatory approach for managing LLW. The strategic assessment identified blending waste of varying radionuclide concentrations as a potential means of enhancing options for LLW disposal. The NRC's position is that concentration averaging or blending can be performed in a way that does not diminish the overall safety of LLW disposal. The revised regulatory requirements for blending LLW are presented in the revised NRC Branch Technical Position for Concentration Averaging and Encapsulation (CA BTP 2015). The changes to the CA BTP that are the most significant for NPP operation, maintenance and decommissioning are reviewed in this paper and a potential application is identified for decommissioning waste in Korea. By far the largest volume of LLW from NPPs will come from decommissioning rather than operation. The large volumes in decommissioning present an opportunity for significant gains in disposal efficiency from blending and concentration averaging. The application of concentration averaging waste from a reactor bio-shield is also presented.
29 CFR 794.109 - Statutory basis for inclusion of activities in enterprise.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Statutory basis for inclusion of activities in enterprise... Act The âenterpriseâ § 794.109 Statutory basis for inclusion of activities in enterprise. The “enterprise” for purposes of enterprise coverage under section 3(s) and the exemption provision in section 7(b...
109Ag nuclear magnetic resonance studies of organic and inorganic silver complexes
International Nuclear Information System (INIS)
Jucker, K.; Sahm, W.; Schwenk, A.
1976-01-01
The NMR lines of 109 Ag have been investigated in solutions of several silver salts in acetonitrile, propionitrile, pyridine, and ethylenediamine, and also in aqueous solutions of Na 2 S 2 O 3 and ethylamine. In these solvents the Ag + -ions form one or several complexes. In any case a single NMR line was to be detected, i.e.a. rapid chemical exchange between different complexes in a sample may be assumed. In two samples of AgNO 3 dissolved in organic solvents, the ratio ν ( 109 Ag)/ν ( 107 Ag) = 1.149640 (1) was measured in good agreement with the value from silver salts in aqueous solutions; i.e. no primary isotopic effect was to be detected within these limits of error (0.9 ppm). (orig./WBU) [de
International Nuclear Information System (INIS)
Anderson, S.H.; Dodson, G.J.; Van Hook, R.I.
1975-01-01
Tissue distribution of the radionuclides were found in the groups given the chronic exposure. Under chronic exposure to 60 Co, 109 Cd, and 137 Cs, quail rapidly accumulated these radioisotopes and the respective body burden concentrations began to level off after 11, 21, and 21 days of exposure. The biological half-lives for radioisotopes accumulated during the chronic feedings were 13 days for 60 Co, 8 days for 109 Cd, and 11 days for 137 Cs. In contrast, biological half-lives for these radioisotopes under acute feeding conditions (single four-hour feeding) were 15 days for 60 Co, 3 days for 109 Cd, and 10 days for 137 Cs. These results indicate that food chain behavior of 60 Co and 137 Cs in Bobwhite is similar following either acute or chronic exposure to contaminated food. For 109 Cd, biological retention in Bobwhite was longer under chronic exposure conditions. (U.S.)
Process and apparatus for emissions reduction from waste incineration
International Nuclear Information System (INIS)
Khinkis, M.J.; Abbasi, H.A.; Lisauskas, R.A.; Itse, D.C.
1991-01-01
This paper describes a process for waste combustion. It comprises: introducing the waste into a drying zone within a combustion chamber; supplying air to the drying zone for preheating, drying, and partially combusting the waste; advancing the waste to a combustion zone within the combustion chamber; supplying air to the combustion zone for further advancing the waste to a burnout zone with the combustion chamber; supplying air to the burnout zone for final burnout of organics in the waste; and injecting fuel and recirculated glue gases into the combustion chamber above the waste to create a reducing secondary combustion zone
Zhao, Ya-E; Wu, Li-Ping
2012-09-01
To confirm phylogenetic relationships in Demodex mites based on mitochondrial 16S rDNA partial sequences, mtDNA 16S partial sequences of ten isolates of three Demodex species from China were amplified, recombined, and sequenced and then analyzed with two Demodex folliculorum isolates from Spain. Lastly, genetic distance was computed, and phylogenetic tree was reconstructed. MEGA 4.0 analysis showed high sequence identity among 16S rDNA partial sequences of three Demodex species, which were 95.85 % in D. folliculorum, 98.53 % in Demodex canis, and 99.71 % in Demodex brevis. The divergence, genetic distance, and transition/transversions of the three Demodex species reached interspecies level, whereas there was no significant difference of the divergence (1.1 %), genetic distance (0.011), and transition/transversions (3/1) of the two geographic D. folliculorum isolates (Spain and China). Phylogenetic trees reveal that the three Demodex species formed three separate branches of one clade, where D. folliculorum and D. canis gathered first, and then gathered with D. brevis. The two Spain and five China D. folliculorum isolates did not form sister clades. In conclusion, 16S mtDNA are suitable for phylogenetic relationship analysis in low taxa (genus or species), but not for intraspecies determination of Demodex. The differentiation among the three Demodex species has reached interspecies level.
Ettringite and C-S-H Portland cement phases for waste ion immobilization: A review
International Nuclear Information System (INIS)
Gougar, M.L.D.; Scheetz, B.E.; Roy, D.M.
1996-01-01
The formation, structure and chemistry of the ettringite and C-S-H phases of Portland cement have been reviewed as they relate to waste ion immobilization. The purpose of this review was to investigate the use of Portland cement as a host for priority metallic pollutants as identified by the Environmental Protection Agency and as a host for radioactive waste ions as identified in 40 CFR 191. Ettringite acts as host to a number of these ions in both the columnar and channel sections of the crystal structure. Substitutions have been made at the calcium, aluminum, hydroxide and sulfate sites. C-S-H also hosts a number of the waste species in both ionic and salt form. Immobilization mechanisms for C-S-H include sorption, phase mixing and substitution. The following ions have not apparently been reported as specifically immobilized by one of these phases: Ag, Am, Np, Pu, Ra, Tc, Th and Sn; however, some of these ions are immobilized by Portland cement
41 CFR 115-1.109 - Numbering in FPMR system.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering in FPMR system. 115-1.109 Section 115-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...
41 CFR 101-1.109 - Numbering in FPMR System.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Numbering in FPMR System. 101-1.109 Section 101-1.109 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101...
41 CFR 109-27.5002 - Stores inventory turnover ratio.
2010-07-01
... turnover ratio. 109-27.5002 Section 109-27.5002 Public Contracts and Property Management Federal Property....5002 Stores inventory turnover ratio. Comparison of investment in stores inventories to annual issues... comparison may be expressed either as a turnover ratio (dollar value of issues divided by dollar value of...
Energy Technology Data Exchange (ETDEWEB)
French, David M. [LANL EES-12, Carlsbad, NM, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Hayes, Timothy A. [LANL EES-12, Carlsbad, NM, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Pope, Howard L. [Aspen Resources Ltd., Inc., P.O. Box 3038, Boulder, CO 80307 (United States); Enriquez, Alejandro E. [LANL NCO-4, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Carson, Peter H. [LANL NPI-7, Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States)
2013-07-01
In times of continuing fiscal constraints, a management and operation tool that is straightforward to implement, works as advertised, and virtually ensures compliant waste packaging should be carefully considered and employed wherever practicable. In the near future, the Department of Energy (DOE) will issue the first major update to DOE Order 435.1, Radioactive Waste Management. This update will contain a requirement for sites that do not have a Waste Isolation Pilot Plant (WIPP) waste certification program to use two newly developed technical standards: Contact-Handled Defense Transuranic Waste Packaging Instructions and Remote-Handled Defense Transuranic Waste Packaging Instructions. The technical standards are being developed from the DOE O 435.1 Notice, Contact-Handled and Remote-Handled Transuranic Waste Packaging, approved August 2011. The packaging instructions will provide detailed information and instruction for packaging almost every conceivable type of transuranic (TRU) waste for disposal at WIPP. While providing specificity, the packaging instructions leave to each site's own discretion the actual mechanics of how those Instructions will be functionally implemented at the floor level. While the Technical Standards are designed to provide precise information for compliant packaging, the density of the information in the packaging instructions necessitates a type of Rosetta Stone that translates the requirements into concise, clear, easy to use and operationally practical recipes that are waste stream and facility specific for use by both first line management and hands-on operations personnel. The Waste Generator Instructions provide the operator with step-by-step instructions that will integrate the sites' various operational requirements (e.g., health and safety limits, radiological limits or dose limits) and result in a WIPP certifiable waste and package that can be transported to and emplaced at WIPP. These little known but widely
Alcohol-free alkoxide process for containing nuclear waste
Pope, James M.; Lahoda, Edward J.
1984-01-01
Disclosed is a method of containing nuclear waste. A composition is first prepared of about 25 to about 80%, calculated as SiO.sub.2, of a partially hydrolyzed silicon compound, up to about 30%, calculated as metal oxide, of a partially hydrolyzed aluminum or calcium compound, about 5 to about 20%, calculated as metal oxide, of a partially hydrolyzed boron or calcium compound, about 3 to about 25%, calculated as metal oxide, of a partially hydrolyzed sodium, potassium or lithium compound, an alcohol in a weight ratio to hydrolyzed alkoxide of about 1.5 to about 3% and sufficient water to remove at least 99% of the alcohol as an azeotrope. The azeotrope is boiled off and up to about 40%, based on solids in the product, of the nuclear waste, is mixed into the composition. The mixture is evaporated to about 25 to about 45% solids and is melted and cooled.
International Nuclear Information System (INIS)
1995-11-01
The U.S. Department of Energy (DOE) is currently evaluating low-level radioactive waste management alternatives at the West Valley Demonstration Project (WVDP) located on the Western New York Nuclear Service Center (WNYNSC) near West Valley, New York. The WVDP's mission is to vitrify high-level radioactive waste resulting from commercial fuel reprocessing operations that took place at the WNYNSC from 1966 to 1972. During the process of high-level waste vitrification, low-level radioactive waste (LLW) and mixed low-level waste (MILLW) will result and must be properly managed. It is estimated that the WVDP's LLW storage facilities will be filled to capacity in 1996. In order to provide sufficient safe storage of LLW until disposal options become available and partially fulfill requirements under the Federal Facilities Compliance Act (FFCA), the DOE is proposing to use U.S. Nuclear Regulatory Commission-licensed and permitted commercial facilities in Oak Ridge, Tennessee; Clive, Utah; and Houston, Texas to treat (volume-reduce) a limited amount of Class A LLW and MLLW generated from the WVDP. Alternatives for ultimate disposal of the West Valley LLW are currently being evaluated in an environmental impact statement. This proposed action is for a limited quantity of waste, over a limited period of time, and for treatment only; this proposal does not include disposal. The proposed action consists of sorting, repacking, and loading waste at the WVDP; transporting the waste for commercial treatment; and returning the residual waste to the WVDP for interim storage. For the purposes of this assessment, environmental impacts were quantified for a five-year operating period (1996 - 2001). Alternatives to the proposed action include no action, construction of additional on-site storage facilities, construction of a treatment facility at the WVDP comparable to commercial treatment, and off-site disposal at a commercial or DOE facility
14 CFR 1221.109 - Use of the NASA Seal.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Seal. 1221.109 Section 1221.109 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...
Nuclear Waste Vitrification in the U.S.: Recent Developments and Future Options
International Nuclear Information System (INIS)
Vienna, John D.
2010-01-01
Nuclear power plays a key role in maintaining current world wide energy growth while minimizing the greenhouse gas emissions. A disposition path for used nuclear fuel (UNF) must be found for this technology to achieve its promise. One likely option is the recycling of UNF and immobilization of the high-level waste (HLW) by vitrification. Vitrification is the technology of choice for immobilizing HLW from defense and commercial fuel reprocessing around the world. Recent advances in both recycling technology and vitrification show great promise in closing the nuclear fuel cycle in an efficient and economical fashion. This article summarizes the recent trends developments and future options in waste vitrification for both defense waste cleanup and closing the nuclear fuel cycle in the U.S.
suitability of burnt and crushed cow bones as partial replacement
African Journals Online (AJOL)
HOD
3 mix ratio measuring 150x150x150mm were tested for the compressive strength at 7, 14, 21 and 28 days respectively. ... the suitability of using waste products to produce lightweight ... suitability of machine crushed animal bones as partial or.
Review of the Scientific Understanding of Radioactive Waste at the U.S. DOE Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Peterson, Reid A.; Buck, Edgar C.; Chun, Jaehun; Daniel, Richard C.; Herting, Daniel L. [Washington River Protection Solutions, Richland, Washington 99354, United States; Ilton, Eugene S.; Lumetta, Gregg J.; Clark, Sue B. [Chemistry
2018-01-02
This paper reviews the origin and chemical and rheological complexity of radioactive waste at the U.S. Department of Energy’s Hanford Site. The waste, stored in underground tanks, was generated via three distinct processes over decades of plutonium extraction operations. Although close records were kept of original waste disposition, tank-to-tank transfers and conditions that impede equilibrium complicate our understanding of the chemistry, phase composition, and rheology of the waste. Tank waste slurries comprise particles and aggregates from nano to micron scales, with varying densities, morphologies, heterogeneous compositions, and complicated responses to flow regimes and process conditions. Further, remnant or changing radiation fields may affect the stability and rheology of the waste. These conditions pose challenges for transport through conduits or pipes to treatment plants for vitrification. Additionally, recalcitrant boehmite degrades glass quality and must be reduced prior to vitrification, but dissolves much more slowly than predicted given surface normalized rates. Existing empirical models based on ex situ experiments and observations lack true predictive capabilities. Recent advances in in situ microscopy, aberration corrected TEM, theoretical modeling across scales, and experimental methods for probing the physics and chemistry at mineral-fluid and mineral-mineral interfaces are being implemented to build robustly predictive physics-based models.
A Bold New Timeless Classic: Fukunaga’s Partial Reading of Jane Eyre
Directory of Open Access Journals (Sweden)
John Engle
2012-07-01
Full Text Available With its first person narrator, radical tonal changes, and wild blend of genres (autobiography, romance, Gothic melodrama, Christian exemplum, etc., Brontë’s Jane Eyre is a case study in the difficulties of cinematic adaptation, as the filmmaker attempts to balance "fidelity" with contemporary relevance and entertainment value. This article examines Cary Fukunaga’s 2011 version, and in particular certain orientations animating his necessarily "partial" reading of the novel. Chief among these is the decision to begin the film when Jane leaves Thornfield; recounting much of the story in discontinuous flashback, the film manages simultaneously to admit Jane’s narrative voice while eliminating its potentially distracting nature. Fukunaga’s other choices include the toning down of the novel’s lurid Gothic quality, its overt romanticism, and—today an overly familiar romantic comedy stereotype—the teasing interplay between the two protagonists. Communicating in a compact language of visual symbol, he also uses the original’s "religious plot" as a tool for modern character analysis.
Boni, Maria Rosaria; Sbaffoni, Silvia; Tuccinardi, Letizia
2013-06-01
The aim of this study was to evaluate the influence of slaughterhouse waste (SHW; essentially the skin, fats, and meat waste of pork, poultry, and beef) in a fermentative co-digestion process for H2 production from pre-selected organic waste taken from a refectory (food waste [FW]). Batch tests under mesophilic conditions were conducted in stirred reactors filled with different proportions of FW and SHW. The addition of 60% and 70% SHW to a mixture of SHW and FW improved H2 production compared to that in FW only, reaching H2-production yields of 145 and 109 ml g VS 0(-1), respectively, which are 1.5-2 times higher than that obtained with FW alone. Although the SHW ensured a more stable fermentative process due to its high buffering capacity, a depletion of H2 production occurred when SHW fraction was higher than 70%. Above this percentage, the formation of foam and aggregated material created non-homogenous conditions of digestion. Additionally, the increasing amount of SHW in the reactors may lead to an accumulation of long chain fatty acids (LCFAs), which are potentially toxic for anaerobic microorganisms and may inhibit the normal evolution of the fermentative process. Copyright © 2013 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-03-01
This document contains 69 papers that were presented at the Fourteenth Annual U.S. Department of Energy Low-Level Radioactive Waste Management Conference, November 18--20, 1992, in Phoenix, Arizona. The papers address the following general topics: (a) Performance Management Track: risk assessment; waste characterization; site characterization; facility design; groundwater modeling; monitoring and modeling; and regulatory requirements; (b) Technical Track: waste minimization; new technologies; international perspectives; licensing issues; hot topics; commercial storage; DOE storage; treatment technologies; and mixed waste; and (c) Institutional Track: status report; changes in orders, regulations, and guidance; regulatory compliance issues; communicating risk; hot topics; and storage impacts. Papers have been processed separately for inclusion on the data base.
Separation efficiency of two waste polymer fibers for oily water treatment
Directory of Open Access Journals (Sweden)
Sokolović Dunja S.
2016-01-01
Full Text Available This work is concerned with the efficiency of two different waste polymeric materials as the filter media in a laboratory-scale bed coalescer in the horizontal fluid flow mode, operating in a steady-state regime. The applied materials are: waste polyethylene terephthalate from textile industry, BA1 and waste polypropylene from carpet industry, PP. Using these compressible fiber polymeric materials, high bed porosity (up to 98% could be obtained. The investigation was carried out over a wide range of working conditions. Bed permeability was varied in the range from 0.18•10-9 to 5.389•10-9 m2. Operating fluid velocity was varied from 19 to 80 m/h, until the critical velocity was reached. Different oily wastewaters were used in the experiments. Oily wastewater is defined as the oil-inwater emulsion model prepared using mineral oils of different physico-chemical characteristics: crude oil (A from Vojvodina region, two vacuum distillation fractions (A1, A4, and blended petroleum product with a high paraffinic content (P1. Both applied polymeric materials, BA1 and PP, showed high separation efficiency for treatment of all investigated oily wastewater. However, the BA1 material showed higher efficiency in a wider range of bed permeability and physico-chemical characteristics of oil. [Projekat Ministarstva nauke Republike Srbije, br. 172022
Managing America's solid waste
Energy Technology Data Exchange (ETDEWEB)
Phillips, J. A.
1998-09-15
This report presents an historical overview of the federal role in municipal solid waste management from 1965 to approximately 1995. Attention is focuses on the federal role in safeguarding public health, protecting the environment, and wisely using material and energy resources. It is hoped that this report will provide important background for future municipal solid waste research and development initiatives.
PROGER - Management program for radioactive wastes in research institutions
International Nuclear Information System (INIS)
Ferreira, Rubemar S.; Costa, Maria Regina Ferro; Ramos Junior, Anthenor C.; Esposito, Irapoan; Vaz, Solange dos Reis e; Pontedeiro, Elizabeth May; Gomes, Carlos de Almeida
1997-01-01
This article demonstrates the feasibility of a program, denominated PROGER, and aimed at the improvement of radioactive waste management activities in research institutions in Brazil. This program involves implementation, correction and updating of waste management techniques in those institutions that already possess a waste management system or its full set-up for the institutions where it is non-existent. Partial results are presented, concerning characteristics and quantities of wastes, and the methodology utilized by PROGER discussed
Waste encapsulation storage facility (WESF) standards/requirements identification document (S/RIDS)
Energy Technology Data Exchange (ETDEWEB)
Maddox, B.S., Westinghouse Hanford
1996-07-29
This Standards/Requirements Identification Document (S/RID) sets forth the Environmental Safety and Health (ES{ampersand}H) standards/requirements for the Waste Encapsulation Storage Facility (WESF). This S/RID is applicable to the appropriate life cycle phases of design, construction, operation, and preparation for decommissioning. These standards/requirements are adequate to ensure the protection of the health and safety of workers, the public, and the environment.
5 CFR 3101.109 - Additional rules for Office of Thrift Supervision employees.
2010-01-01
... any disagreement with the issuer that may cast doubt on the covered OTS employee's ability to remain... Supervision employees. 3101.109 Section 3101.109 Administrative Personnel DEPARTMENT OF THE TREASURY SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE DEPARTMENT OF THE TREASURY § 3101.109 Additional...
Strategies for high-level radioactive waste management: the U.S. experience
International Nuclear Information System (INIS)
Cotton, T.A.
1984-01-01
Technology exists or is under development for the safe, retrievable storage of spent fuel from commercial nuclear reactors and high-level waste from reprocessing that fuel, for many decades, and no insuperable scientific obstacles to permanent disposal of spent fuel or high-level waste in geologic repositories have been identified. However, there are significant institutional obstacles to developing such repositories: strong local opposition to siting and the requirement for a sustained commitment of money and skilled manpower over a period of decades. These create strong incentives to defer the political and economic costs of developing disposal facilities by using less expensive interim storage; yet continued deferral may affect the acceptability of nuclear power. Thus the principal strategic policy issue in high-level waste management is how rapidly to develop disposal facilities. Some countries plan decades of storage before choosing a repository site or a disposal technology, while the United States has enacted a law requiring operation of a geologic repository by 1998. This paper discusses waste management strategic issues and major provisions of the U.S. law, emphasizing those measures dealing with the institutional obstacles to developing geologic repositories. (author)
18th U.S. Department of Energy Low-Level Radioactive Waste Management Conference. Program
Energy Technology Data Exchange (ETDEWEB)
None
1997-05-20
This conference explored the latest developments in low-level radioactive waste management through presentations from professionals in both the public and the private sectors and special guests. The conference included two continuing education seminars, a workshop, exhibits, and a tour of Envirocare of Utah, Inc., one of America's three commercial low-level radioactive waste depositories.
Consequences of the partial restoration of chiral symmetry in an AdS/QCD model
International Nuclear Information System (INIS)
Kim, Youngman; Lee, Hyun Kyu
2008-01-01
Chiral symmetry is an essential concept in understanding QCD at low energy. We treat the chiral condensate, which measures the spontaneous breaking of chiral symmetry, as a free parameter to investigate the effect of partially restored chiral symmetry on the physical quantities in the framework of an AdS/QCD model. We observe an interesting scaling behavior among the nucleon mass, pion decay constant, and chiral condensate. We propose a phenomenological way to introduce the temperature dependence of a physical quantity in the AdS/QCD model with the thermal AdS metric.
Education and Training in Radiation, Transport and Waste Safety Newsletter, No. 4, August 2014
International Nuclear Information System (INIS)
2014-08-01
IAEA’s Division of Radiation, Transport and Waste Safety is assisting Member States to develop national strategies for education and training in radiation, transport and waste safety via the regional projects on “Strengthening Education and Training Infrastructure, and Building Competence in Radiation Safety” (RAF/9/04, RAS/9/066, RER/9/109 and RLA/9/070). The regional workshops conducted in 2012 in this area and the results achieved were presented in the previous issues of this newsletter focussing specifically on each region of the Technical Cooperation Programme (Africa, Asia and the Pacific, Europe and Latin America). In the course of 2013, a new cycle of Regional Workshops was conducted. The workshops held in the regions of Africa, Asia and the Pacific, and Europe mainly focussed on Sharing Experience and Progress made in establishing a National Strategy for Education and Training in Radiation, Transport and Waste Safety (pages 2-5). The workshop held in the region of Latin America mainly focussed on Developing and Implementing Education and Training programmes. An overview on the results achieved by participating Member States for the period 2012-2013 is provided
41 CFR 109-27.5008 - Control of drug substances and potable alcohol.
2010-07-01
..., and Guidelines § 109-27.5008 Control of drug substances and potable alcohol. Effective procedures and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Control of drug substances and potable alcohol. 109-27.5008 Section 109-27.5008 Public Contracts and Property Management...
41 CFR 109-38.301-1.53 - Responsibilities of motor vehicle operators.
2010-07-01
... motor vehicle operators. 109-38.301-1.53 Section 109-38.301-1.53 Public Contracts and Property... MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.3-Official Use of Government Motor Vehicles § 109-38.301-1.53 Responsibilities of motor vehicle operators...
14 CFR 1245.109 - Assignment of title to NASA.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Assignment of title to NASA. 1245.109... INTELLECTUAL PROPERTY RIGHTS Patent Waiver Regulations § 1245.109 Assignment of title to NASA. (a) The instrument of waiver set forth in § 1245.115(c) shall be voided by NASA with respect to the domestic title to...
International Nuclear Information System (INIS)
Dodge, Robert L.; Montoya, Andy M.
2003-01-01
By the time the Waste Isolation Pilot Plant (WIPP) completes its Disposal Phase in FY 2034, the Department of Energy (DOE) will have disposed of approximately 109,378 cubic meters (m3) of Transuranic (TRU) waste in WIPP (1). If DOE adheres to its 2005 Pollution Prevention Goal of generating less than 141m3/yr of TRU waste, approximately 5000 m3 (4%) of that TRU waste will be newly generated (2). Because of the overwhelming majority (96%) of TRU waste destined for disposal at WIPP is legacy waste, the characterization and certification requirements were developed to resolve those issues related to legacy waste. Like many other DOE facilities Los Alamos National Laboratory (LANL) has a large volume (9,010m3) of legacy Transuranic Waste in storage (3). Unlike most DOE facilities LANL will generate approximately 140m3 of newly generated TRU waste each year3. LANL's certification program was established to meet the WIPP requirements for legacy waste and does not take advantage of the fundamental differences in waste knowledge between newly generated and legacy TRU waste
International Nuclear Information System (INIS)
Scheele, R.D.; Bredt, P.R.; Sell, R.L.
1996-09-01
Some of Hanford's underground waste storage tanks contain Organic- bearing high level wastes that are high priority safety issues because of potentially hazardous chemical reactions of organics with inorganic oxidants in these wastes such as nitrates and nitrites. To ensure continued safe storage of these wastes, Westinghouse Hanford Company has placed affected tanks on the Organic Watch List and manages them under special rules. Because water content has been identified as the most efficient agent for preventing a propagating reaction and is an integral part of the criteria developed to ensure continued safe storage of Hanford's organic-bearing radioactive tank wastes, as part of the Organic Tank Safety Program the Pacific Northwest National Laboratory developed and demonstrated a simple and easily implemented procedure to determine the equilibrium water content of these potentially reactive wastes exposed to the range of water vapor pressures that might be experienced during the wastes' future storage. This work focused on the equilibrium water content and did not investigate the various factors such as at sign ventilation, tank surface area, and waste porosity that control the rate that the waste would come into equilibrium, with either the average Hanford water partial pressure 5.5 torr or other possible water partial pressures
33 CFR 100.109 - Winter Harbor Lobster Boat Race, Winter Harbor, ME.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Winter Harbor Lobster Boat Race, Winter Harbor, ME. 100.109 Section 100.109 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY REGATTAS AND MARINE PARADES SAFETY OF LIFE ON NAVIGABLE WATERS § 100.109 Winter Harbor...
suitability of electric arc furnace (eaf) slag as partial replacement for ...
African Journals Online (AJOL)
Administrator
investigated for use as a partial replacement for cement in sandcrete blocks. The tests ... some economic benefit and as well mitigate the negative impact of this waste on the environment. ... course of production of steel typically in the ratio.
PROGER - radioactive waste management in Brazilian research institutions
International Nuclear Information System (INIS)
Pontedeiro, E.; Ramos, A.C.; Reis e Vaz, S.; Ferreira, R.S.
1998-01-01
This article demonstrates the feasibility of a programme, called PROGER, which is aimed at improving the radioactive waste management activities of research institutions in Brazil. PROGER involves the implementation, correction and updating of waste management techniques in those institutions where a waste management system is already being carried out or the introduction and full deployment of such a system in those where a system does not exist. The methodology utilized by the PROGER programme is discussed, and partial results are presented bearing in mind the characteristics and quantities of wastes. (author)
STS-55 crewmembers repair waste water tank under OV-102's middeck subfloor
1993-01-01
STS-55 Pilot Terence T. Henricks uses a spotlight and pen to point out a possible problem area on a waste water tank in the bilge area below Columbia's, Orbiter Vehicle (OV) 102's, middeck. Mission Specialist 1 (MS1) and Payload Commander (PLC) Jerry L. Ross records the activity with a video camcorder. The crewmembers are participating in an inflight maintenance (IFM) exercise to counter problems experienced with the waste water tank.
Half-lives of isomeric levels of 107mAg, 109mAg and 103mRh photoactivated by 60Co γ-ray irradiation
International Nuclear Information System (INIS)
Yoshida, Eiji; Kobayashi, Takashige; Kojima, Yasuaki; Shizuma, Kiyoshi
2000-01-01
Photoactivation by γ-rays from 60 Co of 10 kCi has been performed for isomers of 107m Ag, 109m Ag and 103m Rh and half-lives of these isomers were determined. Gamma-rays emitted from 107m Ag and 109m Ag were measured with a low-background Ge detector and internal conversion electrons from 103m Rh were measured with a 2π gas flow counter. The half-lives obtained are: 107m Ag: 44.5±0.8 s, 109m Ag: 38.0±1.2 s and 103m Rh: 54.8±3.8 min. The results are in agreement with previous values obtained by different excitation methods
ANSTO`s radioactive waste management policy. Preliminary environmental review
Energy Technology Data Exchange (ETDEWEB)
Levins, D.M.; Airey, P.; Breadner, B.; Bull, P.; Camilleri, A.; Dimitrovski, L.; Gorman, T.; Harries, J.; Innes, R.; Jarquin, E.; Jay, G.; Ridal, A.; Smith, A.
1996-05-01
For over forty years, radioactive wastes have been generated by ANSTO (and its predecessor, the AAEC) from the operation of nuclear facilities, the production of radioisotopes for medical and industrial use, and from various research activities. the quantities and activities of radioactive waste currently at Lucas Heights are very small compared to many other nuclear facilities overseas, especially those in countries with nuclear power program. Nevertheless, in the absence of a repository for nuclear wastes in Australia and guidelines for waste conditioning, the waste inventory has been growing steadily. This report reviews the status of radioactive waste management at ANSTO, including spent fuel management, treatment of effluents and environmental monitoring. It gives details of: relevant legislative, regulatory and related requirements; sources and types of radioactive waste generated at ANSTO; waste quantities and activities (both cumulative and annual arisings); existing practices and procedures for waste management and environmental monitoring; recommended broad strategies for dealing with radioactive waste management issues. Detailed proposals on how the recommendations should be implemented is the subject of a companion internal document, the Radioactive Waste Management Action Plan 1996-2000 which provides details of the tasks to be undertaken, milestones and resource requirements. 44 refs., 2 tabs., 18 figs.
SKB`s planning of the EIA in connection with the final disposal of nuclear waste
Energy Technology Data Exchange (ETDEWEB)
Thegerstroem, C.; Forsstroem, H. [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden)
1995-12-01
The plans for the final disposal of Swedish nuclear waste are summarized. The legal requirements on Environmental Impact Statements (EIS) and their role in the program for the final disposal of nuclear waste are described. SKB`s view of the purpose of the Environmental Impact Assessment is described in the light of the experience which now exists from the work on an encapsulation facility and a deep repository. In order to obtain an adequate basis for decision-making, the EIS is of central importance. In SKB`s view, with regard to the final disposal of nuclear waste in Sweden, there is a very good possibility of fulfilling the requirements on the EIS which should be made within modern environmental protection work. 8 refs, 5 figs.
Emissions from small-scale burns of simulated deployed U.S. military waste.
Woodall, Brian D; Yamamoto, Dirk P; Gullett, Brian K; Touati, Abderrahmane
2012-10-16
U.S. military forces have historically relied on open burning as an expedient method of volume reduction and treatment of solid waste during the conflicts in Afghanistan and Iraq. This study is the first effort to characterize a broad range of pollutants and their emission factors during the burning of military waste and the effects that recycling efforts, namely removing plastics, might have on emissions. Piles of simulated military waste were constructed, burned, and emissions sampled at the U.S. Environmental Protection Agency (EPA) Open Burn Testing Facility (OBTF), Research Triangle Park, NC. Three tests contained polyethylene terephthalate (PET #1 or PET) plastic water bottles and four did not. Emission factors for polycyclic aromatic hydrocarbons (PAHs), volatile organic compounds (VOCs), particulate matter (PM(10), PM(2.5)), polychlorinated and polybrominated dioxins/furans (PCDD/F and PBDD/F), and criteria pollutants were determined and are contained within. The average PCDD/F emission factors were 270 ng-toxic equivalency (TEQ) per kg carbon burned (ng-TEQ/kg Cb), ranging from 35 to 780 ng-TEQ/kg Cb. Limited testing suggests that targeted removal of plastic water bottles has no apparent effect on reducing pollutants and may even promote increased emissions.
41 CFR 109-50.204 - Limitations.
2010-07-01
... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.204 Limitations. (a) Excess and... (or unlimited) level of authority. (d) Gifts shall be serviceable and in working order. Disposal...
Materials Discarded in the U.S. Municipal Waste Stream, 1960 to 2009 (in tons)
U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) has collected and reported data on the generation and disposal of waste in the United States for more than 30 years....
2011-03-31
... the 2008-9 study on Quantitative Risk Assessment of the State Licensed Radioactive Waste Disposal Area... of vitrified high-level radioactive waste (HLW); determination of waste classification of the melter... NUCLEAR WASTE TECHNICAL REVIEW BOARD Board Meeting: April 27, 2011--Amherst, New York; the U.S...
2012-01-03
... definition of ``affected business,'' and are not covered by today's notice. They consist of any business that.... Certain businesses, however, do not meet the definition of ``affected business,'' and are not covered by... Businesses Assert Business Confidentiality Claims Regarding Waste Import and Export AGENCY: Environmental...
Investigations of trace element profiles in e-waste by EDXRF
International Nuclear Information System (INIS)
Joseph, Daisy; Polumi; Kale, S.K.
2010-01-01
Full text: Electronic waste, e-waste, e-scrap, or Waste Electrical and Electronic Equipment (WEEE) which means loosely discarded, surplus, obsolete, or broken electrical or electronic devices is good source of toxins in atmosphere. Environmental groups claim that the informal processing of electronic waste in developing countries causes serious health and pollution problems. Some electronic scrap components, contain contaminants such as lead, cadmium, beryllium, mercury, and brominated flame retardants. Activists claim that even in developed countries recycling and disposal of e-waste may involve significant risk to workers and communities and great care must be taken to avoid unsafe exposure in recycling operations and leaching of material such as heavy metals. Scrap industry and USA EPA officials agree that materials should be managed with caution, but that environmental dangers of unused electronics have been exaggerated by groups which benefit from increased regulation. To solve this debatable issue we have carried out EDXFR of e-waste for trace elemental profile investigations. E-waste from IT industry in the form of powder was analyzed by 109 Cd induced Energy Dispersive X-ray fluorescence. Elements such as Ca, Fe, Br, Sr and Zr were seen. The trace element significance of e-waste and its correlation to environmental toxicity is being looked into
41 CFR 109-26.501 - Purchase of new motor vehicles.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Purchase of new motor vehicles. 109-26.501 Section 109-26.501 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...
41 CFR 109-1.5205 - Personal property management system changes.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Personal property management system changes. 109-1.5205 Section 109-1.5205 Public Contracts and Property Management Federal... Personal property management system changes. Any proposed significant change to a designated contractor's...
2010-01-01
... EMPLOYEES OF THE FARM CREDIT SYSTEM INSURANCE CORPORATION § 4001.109 Waivers. The DAEO may grant a written waiver from any provision of this part based on a determination that the waiver is not inconsistent with... programs are administered. A waiver under this paragraph may impose appropriate conditions, such as...
2010-04-01
...) Betterments, only where clearly economically justified to prevent future recurring damage. Economic justification must weigh the cost of betterment against the risk of eligible recurring damage and the cost of... a betterment for the purpose of 23 CFR 668.109(b)(6); and (9) Repair of toll facilities when the...
2010-01-01
... REGULATORY COMMISSION DOMESTIC LICENSING OF PRODUCTION AND UTILIZATION FACILITIES Backfitting § 50.109... design under appendix N of this part; or (vii) The date of issuance of a combined license under subpart C... requirements or to achieve adequate protection, then cost may be a factor in selecting the way, provided that...
The regulation on commercial reactors and the management of high-level radioactive wastes in U.S
International Nuclear Information System (INIS)
Shimomura, Hidetsugu
2013-01-01
This article shows U.S. NRC's substantial and procedural regulations regarding commercial reactors and radioactive wastes. The commercial reactor's regulations are analyzed from an ensuring safety, and the radioactive waste' management is done from a locating a disposal site. (author)
International Nuclear Information System (INIS)
Tirado-Soto, Magda Martina; Zamberlan, Fabio Luiz
2013-01-01
Highlights: ► In the marketing of recyclable materials, the waste-pickers are the least wins. ► It is proposed creating a network of recycling cooperatives to achieve viability. ► The waste-pickers contribute to waste management to the city. - Abstract: The objective of this study is to discuss the role of networks formed of waste-picker cooperatives in ameliorating problems of final disposal of solid waste in the city of Rio de Janeiro, since the city’s main landfill will soon have to close because of exhausted capacity. However, it is estimated that in the city of Rio de Janeiro there are around five thousand waste-pickers working in poor conditions, with lack of physical infrastructure and training, but contributing significantly by diverting solid waste from landfills. According to the Sustainable Development Indicators (IBGE, 2010a,b) in Brazil, recycling rates hover between 45% and 55%. In the municipality of Rio de Janeiro, only 1% of the waste produced is collected selectively by the government (COMLURB, 2010), demonstrating that recycling is mainly performed by waste-pickers. Furthermore, since the recycling market is an oligopsony that requires economies of scale to negotiate directly with industries, the idea of working in networks of cooperatives meets the demands for joint marketing of recyclable materials. Thus, this work presents a method for creating and structuring a network of recycling cooperatives, with prior training for working in networks, so that the expected synergies and joint efforts can lead to concrete results. We intend to demonstrate that it is first essential to strengthen the waste-pickers’ cooperatives in terms of infrastructure, governance and training so that solid waste management can be environmentally, socially and economically sustainable in the city of Rio de Janeiro
Energy Technology Data Exchange (ETDEWEB)
Tirado-Soto, Magda Martina, E-mail: magda@pep.ufrj.br [Program of Production Engineering, School and Research in Engineering, Federal University of Rio de Janeiro (Brazil); Zamberlan, Fabio Luiz, E-mail: fabio@pep.ufrj.br [Program of Production Engineering, School and Research in Engineering, Federal University of Rio de Janeiro (Brazil)
2013-04-15
Highlights: ► In the marketing of recyclable materials, the waste-pickers are the least wins. ► It is proposed creating a network of recycling cooperatives to achieve viability. ► The waste-pickers contribute to waste management to the city. - Abstract: The objective of this study is to discuss the role of networks formed of waste-picker cooperatives in ameliorating problems of final disposal of solid waste in the city of Rio de Janeiro, since the city’s main landfill will soon have to close because of exhausted capacity. However, it is estimated that in the city of Rio de Janeiro there are around five thousand waste-pickers working in poor conditions, with lack of physical infrastructure and training, but contributing significantly by diverting solid waste from landfills. According to the Sustainable Development Indicators (IBGE, 2010a,b) in Brazil, recycling rates hover between 45% and 55%. In the municipality of Rio de Janeiro, only 1% of the waste produced is collected selectively by the government (COMLURB, 2010), demonstrating that recycling is mainly performed by waste-pickers. Furthermore, since the recycling market is an oligopsony that requires economies of scale to negotiate directly with industries, the idea of working in networks of cooperatives meets the demands for joint marketing of recyclable materials. Thus, this work presents a method for creating and structuring a network of recycling cooperatives, with prior training for working in networks, so that the expected synergies and joint efforts can lead to concrete results. We intend to demonstrate that it is first essential to strengthen the waste-pickers’ cooperatives in terms of infrastructure, governance and training so that solid waste management can be environmentally, socially and economically sustainable in the city of Rio de Janeiro.
Directory of Open Access Journals (Sweden)
Michele Angelo Di Bari
2013-03-01
Full Text Available In order to assess the susceptibility of bank voles to chronic wasting disease (CWD, we inoculated voles carrying isoleucine or methionine at codon 109 (Bv109I and Bv109M, respectively with CWD isolates from elk, mule deer and white-tailed deer. Efficient transmission rate (100% was observed with mean survival times ranging from 156 to 281 days post inoculation. Subsequent passages in Bv109I allowed us to isolate from all CWD sources the same vole-adapted CWD strain (Bv(109ICWD, typified by unprecedented short incubation times of 25-28 days and survival times of ∼35 days. Neuropathological and molecular characterisation of Bv(109ICWD showed that the classical features of mammalian prion diseases were all recapitulated in less than one month after intracerebral inoculation. Bv(109ICWD was characterised by a mild and discrete distribution of spongiosis and relatively low levels of protease-resistant PrP(Sc (PrP(res in the same brain regions. Despite the low PrP(res levels and the short time lapse available for its accumulation, end-point titration revealed that brains from terminally-ill voles contained up to 10(8,4 i.c. ID50 infectious units per gram. Bv(109ICWD was efficiently replicated by protein misfolding cyclic amplification (PMCA and the infectivity faithfully generated in vitro, as demonstrated by the preservation of the peculiar Bv(109ICWD strain features on re-isolation in Bv109I. Overall, we provide evidence that the same CWD strain was isolated in Bv109I from the three-cervid species. Bv(109ICWD showed unique characteristics of "virulence", low PrP(res accumulation and high infectivity, thus providing exceptional opportunities to improve basic knowledge of the relationship between PrP(Sc, neurodegeneration and infectivity.
International Nuclear Information System (INIS)
Lazaro, M.A.; Policastro, A.J.; Hartmann, H.M.
1995-04-01
This report, a supplement to Appendix E (Transportation Risk) of the U.S. Department of Energy Waste Management Programmatic Environmental Impact Statement (WM PEIS), provides additional information supporting the accident data for chemical risk assessment and health risk methodology described in that appendix (Part II), as well as providing the uncertainty analysis and on-site risk calculations. This report focuses on hazardous material truck accident rates, release probabilities, and release quantities; provides the toxicological values derived for each hazardous chemical assessed in the WM PEIS and further details on the derivation of health criteria; describes the method used in the transportation risk assessments to address potential additivity of health effects from simultaneous exposure to several chemicals and the method used to address transportation risks for maximally exposed individuals; presents an expanded discussion of the uncertainty associated with transportation risk calculations; and includes the results of the on-site transportation risk analysis. In addition, two addenda are provided to detail the risk assessments conducted for the hazardous components of low-level mixed waste (Addendum I) and transuranic waste (Addendum II)
10 CFR 51.52 - Environmental effects of transportation of fuel and waste-Table S-4.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Environmental effects of transportation of fuel and waste... Environmental effects of transportation of fuel and waste—Table S-4. Under § 51.50, every environmental report... detailed analysis of the environmental effects of transportation of fuel and wastes to and from the reactor...
Energy Technology Data Exchange (ETDEWEB)
Cafferty, Kara Grace [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2017-02-01
This report describes conditions, as required by the state of Idaho Industrial Wastewater Reuse Permit (WRU-I-0160-01, Modification 1, formerly LA 000160 01), for the wastewater reuse site at the Idaho National Laboratory Site’s Materials and Fuels Complex Industrial Waste Ditch and Industrial Waste Pond from November 1, 2015, through October 31, 2016.
Market forces can help lower waste volumes
International Nuclear Information System (INIS)
Stavins, R.N.
1993-01-01
Market forces can go a long way toward helping communities solve their mounting solid-waste problems. In most communities the increasing costs of solid-waste disposal are invisible to the average homeowner because they are buried in local property tax rates. Even in the few communities that list disposal costs separately on tax bills, individual costs are not related to the volume of waste generated. Fundamental to an effective waste-management strategy is the removal of these distortions by getting the prices right. But even with improved price signals, there is no silver bullet of public policy for solid- and hazardous-waste management. Until the ubiquitous NIMBY (Not In My Backyard) problem is addressed, even the most innovative set of waste management policies will remain, at best, a partial solution
2010-01-01
... THE FARM CREDIT ADMINISTRATION § 4101.109 Waivers. The DAEO may grant a written waiver from any provision of this part based on a determination that the waiver is not inconsistent with part 2635 of this... administered. A waiver under this paragraph may impose appropriate conditions, such as requiring execution of a...
Answers to questions posed by the Michigan Governor's Nuclear Waste Disposal Task Force
Energy Technology Data Exchange (ETDEWEB)
1976-09-30
A general presentation of the National Waste Terminal Storage (NWTS) Program was given on July 26, 1976, to the Michigan Environmental Review Board and the Michigan Governor's Nuclear Waste Disposal Task Force. Following the presentation, Dr. William G. Taylor, Chairman of the Task Force, provided ERDA with a listing of questions which pertained to the NWTS program and ERDA/OWI's interest in northeast Michigan. This document contains copies of the information which was provided to Dr. Taylor in response to his inquiry.
41 CFR 101-25.109-1 - Identification of idle equipment.
2010-07-01
... comprised of senior program management, property management, and scientific personnel who are familiar with... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Identification of idle equipment. 101-25.109-1 Section 101-25.109-1 Public Contracts and Property Management Federal Property...
Directory of Open Access Journals (Sweden)
Hamza Ali
2017-01-01
Full Text Available Construction and demolition wastes are increasing significantly due to augmented boom of modern construction. Although the partial cement replacement materials do promote the idea of sustainable construction, the use of construction and demolition waste can also be considered to be viable option to advance the sustainability in modern construction practices. This paper investigates the use of industrial waste materials namely marble dust and crushed bricks as replacement of natural fine aggregates along with the use of silica fume as a partial cement replacement on the mechanical properties and durability characteristics of concrete. Partial replacement levels of waste materials were 10 and 20 percent by volume while the partial replacement level of silica fume was kept to 20 percent at all concrete samples. The results reported in this paper show that the use of marble dust as a replacement material to the natural fine aggregates resulted in an increase in the mechanical properties of concrete. However, the use of crushed bricks did not substantially contribute in the development of strength. Water permeability of concrete incorporated with both silica fume and waste materials (marble dust and crushed bricks decreased significantly. The decrease in water permeability of concrete was attributed to the pozzolanic reaction of silica fume with calcium hydroxide of cement and the filler effect of the waste materials of marble dust and crushed bricks. The use of waste materials also enhance the freeze and thaw resistance of concrete. Authors strongly suggest that the pozzolanic reaction and the development of the microstructure of the concrete through the use of waste materials are largely responsible from the advances in the durability of concrete.
Should the U.S. proceed to consider licensing deep geological disposal of high-level nuclear waste
International Nuclear Information System (INIS)
Curtiss, J.R.
1993-01-01
The United States, as well as other countries facing the question of how to handle high-level nuclear waste, has decided that the most appropriate means of disposal is in a deep geologic repository. In recent years, the Radioactive Waste Management Committee of the Nuclear Energy Agency has developed several position papers on the technical achievability of deep geologic disposal, thus demonstrating the serious consideration of deep geologic disposal in the international community. The Committee has not, as yet, formally endorsed disposal in a deep geologic repository as the preferred method of handling high-level nuclear waste. The United States, on the other hand, has studied the various methods of disposing of high-level nuclear waste, and has determined that deep geologic disposal is the method that should be developed. The purpose of this paper is to present a review of the United States' decision on selecting deep geologic disposal as the preferred method of addressing the high-level waste problem. It presents a short history of the steps taken by the U.S. in determining what method to use, discusses the NRC's waste Confidence Decision, and provides information on other issues in the U.S. program such as reconsideration of the final disposal standard and the growing inventory of spent fuel in storage
Human factors, system safety, and systems engineering in the transportation of U.S. high-level waste
International Nuclear Information System (INIS)
Price, D.L.; Chu, S.C.
1993-01-01
The U.S. Nuclear Waste Technical Review Board is an independent agency charged with evaluating the technical and scientific validity of the U.S. Department of Energy's program to manage the disposal of spent fuel and defense high-level waste. The Board has continued to emphasize the importance of using a true system approach in designing the waste management system. The Board has recommended the application of basic design disciplines such as human factors, system safety, and systems engineering. A top-level system study needs to be undertaken that focuses on minimizing handling. The analysis must be well done, in a timely manner, and without the inclusion in the analysis of arbitrary and artificial constraints. (author)
RCRA Assessment Plan for Single-Shell Tank Waste Management Area S-SX at the Hanford Site
International Nuclear Information System (INIS)
Chou, C.J.; Johnson, V.G.
1999-01-01
A groundwater quality assessment plan was prepared for waste management area S-SX at the Hanford Site. Groundwater monitoring is conducted at this facility in accordance with Title 40, Code of Federal Regulation (CFR) Part 265, Subpart F [and by reference of Washington Administrative Code (WAC) 173-303-400(3)]. The facility was placed in assessment groundwater monitoring program status after elevated waste constituents and indicator parameter measurements (i.e., chromium, technetium-99 and specific conductance) in downgradient monitoring wells were observed and confirmed. A first determination, as allowed under 40 CFR 265.93(d), provides the owner/operator of a facility an opportunity to demonstrate that the regulated unit is not the source of groundwater contamination. Based on results of the first determination it was concluded that multiple source locations in the waste management area could account for observed spatial and temporal groundwater contamination patterns. Consequently, a continued investigation is required. This plan, developed using the data quality objectives process, is intended to comply with the continued investigation requirement. Accordingly, the primary purpose of the present plan is to determine the rate and extent of dangerous waste (hexavalent chromium and nitrate) and radioactive constituents (e.g., technetium-99) in groundwater and to determine their concentrations in groundwater beneath waste management area S-SX. Comments and concerns expressed by the Washington State Department of Ecology on the initial waste management area S-SX assessment report were addressed in the descriptive narrative of this plan as well as in the planned activities. Comment disposition is documented in a separate addendum to this plan
Complex-wide review of DOE`s management of low-level radioactive waste - progress to date
Energy Technology Data Exchange (ETDEWEB)
Letourneau, M.J.
1995-12-31
The Defense Nuclear Facilities Safety Board (DNFSB) Recommendation 94-2 includes a recommendation that the Department of Energy (DOE) conduct a comprehensive, complex-wide review of the low-level waste issue to establish the dimensions of the low-level waste problem and to identify necessary corrective actions to address the safe disposition of past, present, and future volumes. DOE`s Implementation Plan calls for the conduct of a complex-wide review of low-level radioactive waste treatment, storage, and disposal sites to identify environmental, safety, and health vulnerabilities. The complex-wide review focuses on low-level waste disposal facilities through a site evaluation survey, reviews of existing documentation, and onsite observations. Low-level waste treatment and storage facilities will be assessed for their ability to meet waste acceptance criteria for disposal. Results from the complex-wide review will be used to form the basis for an integrated and planned set of actions to correct the identified vulnerabilities and to prompt development of new requirements for managing low-level waste.
Directory of Open Access Journals (Sweden)
Rachelle Bascara
2016-10-01
Full Text Available This paper shows an alternative way in which compatriot partiality could be justified within the framework of global distributive justice. Philosophers who argue that compatriot partiality is similar to racial partiality capture something correct about compatriot partiality. However, the analogy should not lead us to comprehensively reject compatriot partiality. We can justify compatriot partiality on the same grounds that liberation movements and affirmative action have been justified. Hence, given cosmopolitan demands of justice, special consideration for the economic well-being of your nation as a whole is justified if and only if the country it identifies is an oppressed developing nation in an unjust global order.This justification is incomplete. We also need to say why Person A, qua national of Country A, is justified in helping her compatriots in Country A over similarly or slightly more oppressed non-compatriots in Country B. I argue that Person A’s partiality towards her compatriots admits further vindication because it is part of an oppressed group’s project of self-emancipation, which is preferable to paternalistic emancipation.Finally, I identify three benefits in my justification for compatriot partiality. First, I do not offer a blanket justification for all forms of compatriot partiality. Partiality between members of oppressed groups is only a temporary effective measure designed to level an unlevel playing field. Second, because history attests that sovereign republics could arise as a collective response to colonial oppression, justifying compatriot partiality on the grounds that I have identified is conducive to the development of sovereignty and even democracy in poor countries, thereby avoiding problems of infringement that many humanitarian poverty alleviation efforts encounter. Finally, my justification for compatriot partiality complies with the implicit cosmopolitan commitment to the realizability of global justice
Method of disposing radioactive wastes
International Nuclear Information System (INIS)
Isozaki, Kei.
1983-01-01
Purpose : To enable safety ocean disposal of radioactive wastes by decreasing the leaching rate of radioactive nucleides, improving the quick-curing nature and increasing the durability. Method : A mixture comprising 2 - 20 parts by weight of alkali metal hydroxide and 100 parts by weight of finely powdered aqueous slags from a blast furnace is added to radioactive wastes to solidify them. In the case of medium or low level radioactive wastes, the solidification agent is added by 200 parts by weight to 100 parts by weight of the wastes and, in the case of high level wastes, the solidification agent is added in such an amount that the wastes occupy about 20% by weight in the total of the wastes and the solidification agent. Sodium hydroxide used as the alkali metal hydroxide is partially replaced with sodium carbonate, a water-reducing agent such as lignin sulfonate is added to improve the fluidity and suppress the leaching rate and the wastes are solidified in a drum can. In this way, corrosions of the vessel can be suppressed by the alkaline nature and the compression strength, heat stability and the like of the product also become excellent. (Sekiya, K.)
Considerations of human inturison in U.S. programs for deep geologic disposal of radioactive waste.
Energy Technology Data Exchange (ETDEWEB)
Swift, Peter N.
2013-01-01
Regulations in the United States that govern the permanent disposal of spent nuclear fuel and high-level radioactive waste in deep geologic repositories require the explicit consideration of hypothetical future human intrusions that disrupt the waste. Specific regulatory requirements regarding the consideration of human intrusion differ in the two sets of regulations currently in effect in the United States; one defined by the Environmental Protection Agencys 40 Code of Federal Regulations part 197, applied only to the formerly proposed geologic repository at Yucca Mountain, Nevada, and the other defined by the Environmental Protection Agencys 40 Code of Federal Regulations part 191, applied to the Waste Isolation Pilot Plant in New Mexico and potentially applicable to any repository for spent nuclear fuel and high-level radioactive waste in the United States other than the proposed repository at Yucca Mountain. This report reviews the regulatory requirements relevant to human intrusion and the approaches taken by the Department of Energy to demonstrating compliance with those requirements.
Directory of Open Access Journals (Sweden)
Andy R. Erwin Wijaya
2010-03-01
. The control system of acid mine drainage contamination included treatment of acid mine drainage into water pond and management of oxide/benign waste on the waste dump. Treatment method is neutralization of acid mine drainage into water pond using alkali reagent. The most effective and economic alkali reagent is limestone. Amount of limestone needed to neutralize of acid mine drainage (5040 m3 into water pond is 104.56 kg. The management of oxide/benign waste is application of encapsulation in-pit disposal model. This model is more effective to prevent acid mine drainage formed. Cover materials are often clay subsoils and have been used for covering to prevent oxidation. The clay have high compaction rates and low permeability (2.3148 x 10-9 m/s and this material is sufficient availability.
Penicillium pedernalense sp. nov., isolated from whiteleg shrimp heads waste compost.
Laich, Federico; Andrade, Jacinto
2016-11-01
Novel Penicillium-like strains were isolated during the characterization of the mycobiota community dynamics associated with shrimp waste composting. Phylogenetic analysis of the partial β-tubulin (BenA) gene and the ribosomal DNA internal transcribed spacer region (ITS1-5.8S-ITS2) sequences revealed that the novel strains were members of section Lanata-Divaricata and were closely related to Penicillium infrabuccalum DAOMC 250537T. On the basis of morphological and physiological characterization, and phylogenetic analysis, a novel Penicillium species, Penicillium pedernalense sp. nov., is proposed. The type strain is F01-11T (=CBS 140770T=CECT 20949T), which was isolated from whiteleg shrimp (Litopenaeus vannamei) heads waste compost in the Pedernales region (Manabí province, Ecuador).
46 CFR 109.575 - Accumulation of liquids on helicopter decks.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Accumulation of liquids on helicopter decks. 109.575... DRILLING UNITS OPERATIONS Miscellaneous § 109.575 Accumulation of liquids on helicopter decks. The master or person in charge shall ensure that no liquids are allowed to accumulate on the helicopter decks. ...
International Nuclear Information System (INIS)
Pokhitonov, Yuri; Kelley, Dennis
2009-01-01
Large amounts of liquid radioactive waste have existed in the U.S. and Russia since the 1950's as a result of the Cold War. Comprehensive action to treat and dispose of waste products has been lacking due to insufficient funding, ineffective technologies or no proven technologies, low priority by governments among others. Today the U.S. and Russian governments seek new, more reliable methods to treat liquid waste, in particular the legacy waste streams. A primary objective of waste generators and regulators is to find economical and proven technologies that can provide long-term stability for repository storage. In 2001, the V.G. Khlopin Radium Institute (Khlopin), St. Petersburg, Russia, and Pacific Nuclear Solutions (PNS), Indianapolis, Indiana, began extensive research and test programs to determine the validity of polymer technology for the absorption and immobilization of standard and complex waste streams. Over 60 liquid compositions have been tested including extensive irradiation tests to verify polymer stability and possible degradation. With conclusive scientific evidence of the polymer's effectiveness in treating liquid waste, both parties have decided to enter the Russian market and offer the solidification technology to nuclear sites for waste treatment and disposal. In conjunction with these efforts, the U.S. Department of Energy (DOE) will join Khlopin and PNS to explore opportunities for direct application of the polymers at predetermined sites and to conduct research for new product development. Under DOE's 'Initiatives for Proliferation Prevention' (IPP) program, funding will be provided to the Russian participants over a three year period to implement the program plan. This paper will present updated details of U.S. DOE's IPP program, the project structure and its objectives both short and long-term, polymer tests and applications for LLW, ILW and HLW, and new product development initiatives. (authors)
Filtration and Leach Testing for REDOX Sludge and S-Saltcake Actual Waste Sample Composites
Energy Technology Data Exchange (ETDEWEB)
Shimskey, Rick W.; Billing, Justin M.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn E.; Edwards, Matthew K.; Geeting, John GH; Hallen, Richard T.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Snow, Lanee A.; Swoboda, Robert G.
2009-02-20
A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.( ) The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Under test plan TP-RPP-WTP-467, eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. Under this test plan, a waste-testing program was implemented that included: • Homogenizing the archive samples by group as defined in the test plan • Characterizing the homogenized sample groups • Performing parametric leaching testing on each group for compounds of interest • Performing bench-top filtration/leaching tests in the hot cell for each group to simulate filtration and leaching activities if they occurred in the UFP2 vessel of the WTP Pretreatment Facility. This report focuses on filtration/leaching tests performed on two of the eight waste composite samples and follow-on parametric tests to support aluminum leaching results from those tests.
Godzik, Katharina; Coleman, Michael P
2015-04-01
The axon-protective Wallerian degeneration slow (WLD(S)) protein can ameliorate the decline in axonal ATP levels after neurite transection. Here, we tested the hypothesis that this effect is associated with maintenance of mitochondrial respiration and/or glycolysis. We used isolated neurites of superior cervical ganglion (SCG) cultures in the Seahorse XF-24 Metabolic Flux Analyser to determine mitochondrial respiration and glycolysis under different conditions. We observed that both mitochondrial respiration and glycolysis declined significantly during the latent phase of Wallerian degeneration. WLD(S) partially reduced the decline both in glycolysis and in mitochondrial respiration. In addition, we found that depleting NAD levels in uncut cultures led to changes in mitochondrial respiration and glycolysis similar to those rescued by WLD(S) after cut, suggesting that the maintenance of NAD levels in Wld(S) neurites after axonal injury at least partially underlies the maintenance of ATP levels. However, by using another axon-protective mutation (Sarm1(-/-)), we could demonstrate that rescue of basal ECAR (and hence probably glycolysis) rather than basal OCR (mitochondrial respiration) may be part of the protective phenotype to delay Wallerian degeneration. These findings open new routes to study glycolysis and the connection between NAD and ATP levels in axon degeneration, which may help to eventually develop therapeutic strategies to treat neurodegenerative diseases.
U.S. policy and current practices for blending low-level radioactive waste for disposal
International Nuclear Information System (INIS)
Kessel, David S.; Kim, Chang Lak
2016-01-01
In the near future, many countries, including the Republic of Korea, will face a significant increase in low level radioactive waste (LLW) from nuclear power plant decommissioning. The purpose of this paper is to look at blending as a method for enhancing disposal options for low-level radioactive waste from the decommissioning of nuclear reactors. The 2007 U.S. Nuclear Regulatory Commission strategic assessment of the status of the U.S. LLW program identified the need to move to a risk-informed and performance-based regulatory approach for managing LLW. The strategic assessment identified blending waste of varying radionuclide concentrations as a potential means of enhancing options for LLW disposal. The NRC's position is that concentration averaging or blending can be performed in a way that does not diminish the overall safety of LLW disposal. The revised regulatory requirements for blending LLW are presented in the revised NRC Branch Technical Position for Concentration Averaging and Encapsulation (CA BTP 2015). The changes to the CA BTP that are the most significant for NPP operation, maintenance and decommissioning are reviewed in this paper and a potential application is identified for decommissioning waste in Korea. By far the largest volume of LLW from NPPs will come from decommissioning rather than operation. The large volumes in decommissioning present an opportunity for significant gains in disposal efficiency from blending and concentration averaging. The application of concentration averaging waste from a reactor bio-shield is also presented
International Nuclear Information System (INIS)
Mueller, C.; Nabelssi, B.; Roglans-Ribas, J.
1995-04-01
This report documents the methodology, computational framework, and results of facility accident analyses performed for the U.S. Department of Energy (DOE) Waste Management Programmatic Environmental Impact Statement (WM PEIS). The accident sequences potentially important to human health risk are specified, their frequencies are assessed, and the resultant radiological and chemical source terms are evaluated. A personal computer-based computational framework and database have been developed that provide these results as input to the WM PEIS for calculation of human health risk impacts. The methodology is in compliance with the most recent guidance from DOE. It considers the spectrum of accident sequences that could occur in activities covered by the WM PEIS and uses a graded approach emphasizing the risk-dominant scenarios to facilitate discrimination among the various WM PEIS alternatives. Although it allows reasonable estimates of the risk impacts associated with each alternative, the main goal of the accident analysis methodology is to allow reliable estimates of the relative risks among the alternatives. The WM PEIS addresses management of five waste streams in the DOE complex: low-level waste (LLW), hazardous waste (HW), high-level waste (HLW), low-level mixed waste (LLMW), and transuranic waste (TRUW). Currently projected waste generation rates, storage inventories, and treatment process throughputs have been calculated for each of the waste streams. This report summarizes the accident analyses and aggregates the key results for each of the waste streams. Source terms are estimated and results are presented for each of the major DOE sites and facilities by WM PEIS alternative for each waste stream. The appendices identify the potential atmospheric release of each toxic chemical or radionuclide for each accident scenario studied. They also provide discussion of specific accident analysis data and guidance used or consulted in this report
Medical and Biohazardous Waste Generator's Guide (Revision2)
Energy Technology Data Exchange (ETDEWEB)
Waste Management Group
2006-11-29
These guidelines describe procedures to comply with all Federal and State laws and regulations and Lawrence Berkeley National Laboratory (LBNL) policy applicable to State-regulated medical and unregulated, but biohazardous, waste (medical/biohazardous waste). These guidelines apply to all LBNL personnel who: (1) generate and/or store medical/biohazardous waste, (2) supervise personnel who generate medical/biohazardous waste, or (3) manage a medical/biohazardous waste pickup location. Personnel generating biohazardous waste at the Joint Genome Institute/Production Genomics Facility (JGI/PGF) are referred to the guidelines contained in Section 9. Section 9 is the only part of these guidelines that apply to JGI/PGF. Medical/biohazardous waste referred to in this Web site includes biohazardous, sharps, pathological and liquid waste. Procedures for proper storage and disposal are summarized in the Solid Medical/Biohazardous Waste Disposal Procedures Chart. Contact the Waste Management Group at 486-7663 if you have any questions regarding medical/biohazardous waste management.
13 CFR 114.109 - What if my claim is denied?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What if my claim is denied? 114.109 Section 114.109 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION ADMINISTRATIVE CLAIMS... representative in writing by certified or registered mail if it denies your claim. You have a right to file suit...
12 CFR 221.109 - Loan to open-end investment company.
2010-01-01
... CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.109 Loan to open-end investment company. In... customarily purchases stocks registered on a national securities exchange, the Board stated that in view of... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Loan to open-end investment company. 221.109...
46 CFR 109.323 - Manning of survival craft and supervision.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Manning of survival craft and supervision. 109.323... DRILLING UNITS OPERATIONS Operation and Stowage of Safety Equipment § 109.323 Manning of survival craft and supervision. (a) There must be a sufficient number of trained persons on board the survival craft for...
International Nuclear Information System (INIS)
Van Tuyle, G.; Bennett, D.; Arthur, E.; Cappiello, M.; Finck, P.; Hill, D.; Herczeg, J.; Goldner, F.
2001-01-01
The primary mission of the U.S. Advanced Accelerator Applications (AAA) Program is to establish a national nuclear technology research capability that can demonstrate accelerator-based transmutation of waste and conduct transmutation research while at the same time providing a capability for the production of tritium if required. The AAA Program was created during fiscal year 2001 from the Accelerator Transmutation of Waste (ATW) Program and the Accelerator Production of Tritium (APT) Project. This paper describes the new AAA Program, as well as its two major components: development and testing of waste transmutation technologies and construction of an integrated accelerator-driven test facility (ADTF). (author)
41 CFR 109-50.103 - Definitions.
2010-07-01
... museums located in the United States and interested in establishing or upgrading energy-oriented education... Section 109-50.103 Public Contracts and Property Management Federal Property Management Regulations System... uniform administrative system for application, award, and administration of assistance awards, including...
Directory of Open Access Journals (Sweden)
Gábriel Györgyi T #336;ZSÉR
2010-01-01
Full Text Available Based on the regulations of Act XLIII/2000 on Waste Management to implement the strategic objectives and targets in the Act for the prevalence of the basic waste management principles a National Waste Management Plan II will be worked out and then accepted by the Parliament as part of the National Environmental Protection Programme. On the basis of the national plan the administrative bodies of environmental protection in accordance with the regional settlement and d evelopment programmes make a regional waste management project with the inclusion of the regional, local authorities, and other authorities concerned as well as the non governmental organisations for environmental protection. In our research we analyze the correlation between municipal solid waste per capita and urbanisation level. We have conducted similar calculations in the filed of population density and income. The study was carried out on a micro region level. Our analysis can help determine the framework conditions and factors that influence waste generation, and therefore should be taken into consideration when designing waste policies .
Annual report of waste generation and pollution prevention progress 1998; ANNUAL
International Nuclear Information System (INIS)
NONE
1999-01-01
This seventh Annual Report presents and analyzes DOE Complex-wide waste generation and pollution prevention activities at 45 reporting sites from 1993 through 1998. This section summarizes Calendar Year 1998 Complex-wide waste generation and pollution prevention accomplishments. More detailed information follows this section in the body of the Report. In May 1996, the Secretary of Energy established a 50 percent Complex-Wide Waste Reduction Goal (relative to the 1993 baseline) for routine operations radioactive, mixed, and hazardous waste generation, to be achieved by December31, 1999. DOE has achieved its Complex-Wide Waste Reduction Goals for routine operations based upon a comparison of 1998 waste generation to the 1993 baseline. Excluding sanitary waste, routine operations waste generation decreased 67 percent overall from 1993 to 1998. However, for the first time since 1994, the total amount of materials recycled by the Complex decreased from 109,600 metric tons in 1997 to 92,800 metric tons in 1998. This decrease is attributed to the fact that in 1997, several large ''one-time only'' recycling projects were conducted throughout the Complex. In order to demonstrate commitment to DOE's Complex-wide recycling goal, it is important for sites to identify all potential large-scale recycling/reuse opportunities
41 CFR 109-45.1003 - Recovery of silver from precious metals bearing materials.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Recovery of silver from precious metals bearing materials. 109-45.1003 Section 109-45.1003 Public Contracts and Property Management... of Precious Metals § 109-45.1003 Recovery of silver from precious metals bearing materials. The...
International Nuclear Information System (INIS)
Boni, Maria Rosaria; Sbaffoni, Silvia; Tuccinardi, Letizia
2013-01-01
Highlights: • Co-digestion process finalized to bio-H 2 production was tested in batch tests. • Slaughterhouse waste (SHW) and food waste (FW) were co-digested in different proportions. • The presence of SHW affected the H 2 production from FW. • When SHW ranging between 50% and 70% the H 2 production is improved. • SHW percentages above 70%, led to a depletion in H 2 production. - Abstract: The aim of this study was to evaluate the influence of slaughterhouse waste (SHW; essentially the skin, fats, and meat waste of pork, poultry, and beef) in a fermentative co-digestion process for H 2 production from pre-selected organic waste taken from a refectory (food waste [FW]). Batch tests under mesophilic conditions were conducted in stirred reactors filled with different proportions of FW and SHW. The addition of 60% and 70% SHW to a mixture of SHW and FW improved H 2 production compared to that in FW only, reaching H 2 -production yields of 145 and 109 ml gVS 0 -1 , respectively, which are 1.5–2 times higher than that obtained with FW alone. Although the SHW ensured a more stable fermentative process due to its high buffering capacity, a depletion of H 2 production occurred when SHW fraction was higher than 70%. Above this percentage, the formation of foam and aggregated material created non-homogenous conditions of digestion. Additionally, the increasing amount of SHW in the reactors may lead to an accumulation of long chain fatty acids (LCFAs), which are potentially toxic for anaerobic microorganisms and may inhibit the normal evolution of the fermentative process
47 CFR 18.109 - General technical requirements.
2010-10-01
... MEDICAL EQUIPMENT General Information § 18.109 General technical requirements. ISM equipment shall be... filtering to provide adequate suppression of emissions on frequencies outside the frequency bands specified...
Radioactive Waste Management and Nuclear Facility Decommissioning Progress in Iraq - 13216
Energy Technology Data Exchange (ETDEWEB)
Al-Musawi, Fouad; Shamsaldin, Emad S.; Jasim, Hadi [Ministry of Science and Technology (MoST), Al-Jadraya, P.O. Box 0765, Baghdad (Iraq); Cochran, John R. [Sandia National Laboratories1, New Mexico, Albuquerque New Mexico 87185 (United States)
2013-07-01
Management of Iraq's radioactive wastes and decommissioning of Iraq's former nuclear facilities are the responsibility of Iraq's Ministry of Science and Technology (MoST). The majority of Iraq's former nuclear facilities are in the Al-Tuwaitha Nuclear Research Center located a few kilometers from the edge of Baghdad. These facilities include bombed and partially destroyed research reactors, a fuel fabrication facility and radioisotope production facilities. Within these facilities are large numbers of silos, approximately 30 process or waste storage tanks and thousands of drums of uncharacterised radioactive waste. There are also former nuclear facilities/sites that are outside of Al-Tuwaitha and these include the former uranium processing and waste storage facility at Jesira, the dump site near Adaya, the former centrifuge facility at Rashdiya and the former enrichment plant at Tarmiya. In 2005, Iraq lacked the infrastructure needed to decommission its nuclear facilities and manage its radioactive wastes. The lack of infrastructure included: (1) the lack of an organization responsible for decommissioning and radioactive waste management, (2) the lack of a storage facility for radioactive wastes, (3) the lack of professionals with experience in decommissioning and modern waste management practices, (4) the lack of laws and regulations governing decommissioning or radioactive waste management, (5) ongoing security concerns, and (6) limited availability of electricity and internet. Since its creation eight years ago, the MoST has worked with the international community and developed an organizational structure, trained staff, and made great progress in managing radioactive wastes and decommissioning Iraq's former nuclear facilities. This progress has been made, despite the very difficult implementing conditions in Iraq. Within MoST, the Radioactive Waste Treatment and Management Directorate (RWTMD) is responsible for waste management and the
48 CFR 32.109 - Termination financing.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Termination financing. 32... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.109 Termination financing. To encourage contractors to invest their own funds in performance despite the susceptibility of...
41 CFR 109-27.5001 - Objectives.
2010-07-01
... misappropriation; (c) The maintenance of an efficient operation; and (d) The standardization of inventories to the...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5001 Objectives. Necessary inventories shall be established and maintained at reasonable levels, consistent with...
International Nuclear Information System (INIS)
Timar, J.; Nyako, B.M.; Berek, G.; Gal, J.; Kalinka, G.; Krasznahorkay, A.; Molnar, J.; Zolnai, L.
2007-01-01
Complete text of publication follows. The existence of nuclear chirality is one of the most intriguing questions of contemporary high-spin nuclear structure studies. Rotational doublet-band candidates for chiral structures have been observed mostly in two regions of the nuclear chart: around 134 Pr, and around 104 Rh. In this second region chirality in the Rh isotopes are rather well studied, chiral doubling have also been observed in 100 Tc, however, results obtained for chirality in the studied Ag nuclei ( 105 Ag and 106 Ag) look rather contradictory. Thus, it is interesting to study these doublet bands in the nearby higher-mass Ag nuclei. In order to search for a chiral-candidate partner band to the yrast πg 9/2 v(h 11/2 ) 2 band in 109 Ag, high-spin states of this nucleus have been studied using the 96 Zr( 18 O,p4n) reaction. The experiment was performed at iThemba LABS using 8 Clover detectors of the AFRODITE array and the DIAMANT charged-particle array to detect the γ-rays and the charged particles, respectively. Altogether ∼140 million γγ-coincidence events were collected. Approximately 10 million events of them correspond to the reaction channel producing 109 Ag. No chiral candidate partner band has been found to the πg 9/2 v(h 11/2 ) 2 band with this statistics, however, the level scheme could be extended by several new levels and γ-transitions. A preliminary level scheme of 109 Ag obtained from the ongoing data analysis is shown in Fig. 1
From waste minimization to ISO 14000: Taiwan`s experience and prospects
Energy Technology Data Exchange (ETDEWEB)
Wen-Huei Chen; Wain-Sun Hou [China Technical Consultants, Inc., Taipei (Taiwan, Province of China)
1996-12-31
Taiwan has completed a very successful five-year industrial waste minimization (IWM) demonstration and promotion project sponsored by the government. From 1990 to 1995, the project successfully disseminated the IWM concept of pollution prevention (P2) to industries. It effectively reduced industrial waste while significantly benefitting the economy by assisting industries in implementing in-plant IWM programs. In July 1995, the second stage of the five-year IWM and ISO 14000 promotion project was initiated for further promoting the IWM, P2, and cleaner production and, in particular, coping with the upcoming international environmental management standards (ISO 14000). To assist industries in establishing an environmental management system (EMS) and accumulating related experience, an EMS pilot demonstration project of five model industries and an ISO 14001 EMS demonstration and promotion project for 22 factories in 13 industries were initiated in October 1995 and August 1996, respectively. These projects can assist Taiwan`s industries in changing the constitution of their enterprises, enhancing competition in the international market, and helping our nation achieve the forerunner`s profits in sustainable development. 9 refs., 3 figs.
Partial and complete tear of the anterior cruciate ligament. Direct and indirect MR signs
International Nuclear Information System (INIS)
Chen, W.T.; Tu, H.Y.; Chen, R.C.; Shih, T.T.F.; Shau, W.Y.
2002-01-01
Purpose: To analyze MR direct and indirect signs for knees with anterior cruciate ligament (ACL) partial or complete tear. Material and Methods: According to documented MR direct and indirect signs for ACL tear, we retrospectively reviewed the incidence of those signs in 15 partial ACL tear and 17 complete ACL tear patients. The findings were also compared with duration of injury (less or more than 6 weeks, as acute or chronic stages). Results: A residual straight and tight ACL fiber in at least one pulse sequence was more frequently detected in partial ACL tears. The empty notch sign, a wavy contour of ACL, bone contusion at lateral compartment and lateral meniscus posterior horn tear were significantly more frequently seen in complete tear cases. The posterior cruciate ligament angle in chronic complete ACL tear cases (109 deg ±20 deg) had a tendency to be less than in chronic partial ACL tear cases (119 deg ±18 deg). Conclusion: The empty notch sign, a wavy ACL, bone contusion, and posterior horn of lateral meniscus tears are suggestive of a complete ACL tear. A residual straight and tight ACL fiber seen in at least one image section is a helpful sign to diagnosis of partial ACL tear. In the acute ACL injury stage, a focal increase of the ACL signal intensity is more suggestive of a partial ACL tear
24 CFR 811.109 - Trust indenture provisions.
2010-04-01
... AND URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION... DISABILITIES PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.109...
Pagans i Miró, Estel·la
2006-01-01
Ammonia emissions were quantified for the laboratory-scale composting of three typical organic wastes with medium nitrogen content: organic fraction of municipal solid wastes, raw sludge and anaerobically digested sludge; and the composting of two wastes with high nitrogen content: animal by-products from slaughterhouses and partially hydrolysed hair from the leather industry. All the wastes were mixed with the proper amount of bulking agent. Ammonia emitted in the composting of the five wast...
BATISTA, Jaqueline Eduarda Rodrigues; BRAGA, Lucas Pereira; OLIVEIRA, Renata Corrêa de; SILVA, Edson Pablo; DAMIANI, Clarissa
2018-01-01
Abstract Pumpkin seeds are considered waste and its composition has high protein content, being feasible for human consumption, also reducing costs in waste treatment. In this work we provided an alternative to reuse the wastes of pumpkin seed applied in cupcakes formulation as a complementary source to wheat flour. Four formulations with different proportions of pumpkin seed flour were investigated. The effects of partial wheat flour substitution were evaluated using the parameters texture, ...
Denitration of Savannah River Plant waste streams
International Nuclear Information System (INIS)
Orebaugh, E.G.
1976-07-01
Partial denitration of waste streams from Savannah River Plant separations processes was shown to significantly reduce the quantity of waste solids to be stored as an alkaline salt cake. The chemical processes involved in the denitration of nonradioactive simulated waste solutions were studied. Chemical and instrumental analytical techniques were used to define both the equilibrium concentrations and the variation of reactants and products in the denitration reaction. Mechanisms were proposed that account for the complicated chemical reactions observed in the simulated waste solutions. Metal nitrates can be denitrated by reaction with formic acid only by the release of nitric acid from hydrolysis or formate complexation of metal cations. However, eventual radiolysis of formate salts or complexes results in the formation of biocarbonate and makes complexation-denitration a nonproductive means of reducing waste solids. Nevertheless, destruction of nitrate associated with free acid and easily hydrolyzable cations such as iron, mercury, and zirconium can result in greater than 30 percent reduction in waste solids from five SRP waste streams
Development of an accelerated leach test(s) for low-level waste forms
International Nuclear Information System (INIS)
Dougherty, D.R.; Fuhrmann, M.; Colombo, P.
1986-01-01
An accelerated leach test(s) is being developed to predict long-term leaching behavior of low-level radioactive waste (LLW) forms in their disposal environments. As necessary background, a literature survey of reported leaching mechanisms, available mathematical models and factors that affect leaching of LLW forms has been compiled. Mechanisms which have been identified include diffusion, dissolution, ion exchange, corrosion and surface effects. A computerized data base of LLW leaching data and mathematical models is being developed. The data is being used for model evaluation by curve fitting and statistical analysis according to standard procedures of statistical quality control. Long-term leach tests on portland cement, bitumen and vinyl ester-styrene (VES) polymer waste forms are underway which are designed to identify and evaluate factors that accelerate leaching without changing the mechanisms. Initial results on the effect of temperature on leachability indicate that the leach rates of cement and VES waste forms increase with increasing temperature, whereas, the leach rate of bitumen is little affected
International Nuclear Information System (INIS)
Wolfe, R.A.
1976-01-01
This overview examines the research and development program that has been established within the U.S. Energy Research and Development Administration (ERDA) to develop the technology to treat transuranic-contaminated waste. Also considered is the waste expected within the total nuclear fuel cycle
41 CFR 109-27.5107 - Recovery of silver from used hypo solution and scrap film.
2010-07-01
... used hypo solution and scrap film. 109-27.5107 Section 109-27.5107 Public Contracts and Property... § 109-27.5107 Recovery of silver from used hypo solution and scrap film. The requirements for the recovery of silver from used hypo solution and scrap film are contained in § 109-45.1003 of this chapter. ...
Motives as predictors of the public's attitudes toward solid waste issues
Energy Technology Data Exchange (ETDEWEB)
Ebreo, A.; Vining, J.
2000-02-01
Surveys focusing on solid-waste-related issues, conducted over a period of several years, provided data from independent samples of residents of a Midwestern, USA, community. The collection of these data yielded useful information about the relationship between residents' recycling motives and their attitudes toward solid waste management in light of several changes in the solid waste infrastructure of the community over that time. The initial survey assessed baseline beliefs and attitudes, while later surveys were conducted after the implementation of a community educational program and a curbside recycling program. The findings indicated that for recyclers and nonrecyclers, different motives predicted endorsement of solid waste programs and policies. Although a similar percentage of recyclers and nonrecyclers were in support of various proposed programs and policies, concern for the environment was found to be positively related to nonrecyclers' support of proposed programs, particularly before these programs were implemented. Prior to program implementation, motives other than environmental altruism were found to be related to recyclers' support of the programs. Additional findings support the idea that educational programs and increased accessibility to recycling opportunities affect the relationship between people's attitudes toward solid waste management and their recycling motives.
Trim waste minimization at the Pinellas Plant
International Nuclear Information System (INIS)
DeLaneuville, D.
1992-01-01
Bacteria counts and several methods of slowing bacterial growth in machine trim coolant are suggested to reduce the frequency of coolant replacement without risking employee health or the longevity of the product or machinery. On-site treatment and disposal of waste trim are recommended to further reduce waste volume. This paper discusses the benefits of these efforts, including projected cost savings based on partial implementation at the Department of Energy's Pinellas Plant
Capabilities of U.S. domestic transportation systems for the shipment of radioactive wastes
International Nuclear Information System (INIS)
Best, R.E.; Allen, J.H.; Aucoin, P.A.; Ball, G.D.; Hoffman, C.C.; Mason, M.E.; Propes, W.A.; Vizzini, T.A.
1977-09-01
This document is a compilation of data and reports that provide an overview of the capabilities of U.S. domestic transportation systems for the shipment of materials that are or may be classified as radioactive wastes
Selective electrochemical extraction of REEs from NdFeB magnet waste at room temperature
Venkatesan, P.; Vander Hoogerstraete, Tom; Hennebel, Tom; Binnemans, Koen; Sietsma, J.; Yang, Y.
2018-01-01
NdFeB magnet waste is one of the important secondary resources from which rare-earth elements (REEs) can be recovered. Herein we present an electrochemical route to selectively extract REEs from the magnet waste at room temperature. First, the magnet waste was partially leached with HCl. The
41 CFR 109-27.5104-5 - Control and issue of stock.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Control and issue of stock. 109-27.5104-5 Section 109-27.5104-5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...
41 CFR 109-27.5005 - Shop, bench, cupboard or site stock.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Shop, bench, cupboard or site stock. 109-27.5005 Section 109-27.5005 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...
Reusing Ceramic Tile Polishing Waste In Paving Block Manufacturing
Giordano Penteado; Carmenlucia Santos; de Carvalho; Eduardo Viviani; Cecche Lintz; Rosa Cristina
2016-01-01
Ceramic companies worldwide produce large amounts of polishing tile waste, which are piled up in the open air or disposed of in landfills. These wastes have such characteristics that make them potential substitutes for cement and sand in the manufacturing of concrete products. This paper investigates the use of ceramic tile polishing waste as a partial substitute for cement and sand in the manufacturer of concrete paving blocks. A concrete mix design was defined and then the sand was replaced...
Energy Technology Data Exchange (ETDEWEB)
Yorio, Pablo; Caille, Guillermo
2004-04-01
We evaluated the volumes of waste from fish processing plants in Chubut Province, Argentina, and discuss its potential consequences for Kelp Gull (Larus dominicanus) population dynamics and coastal management. Mean volume of waste produced between 1989 and 2001 in three coastal cities was 49.8 {+-} 10.9 thousand tons y{sup -1}. The amount of waste varied between years and cities, being larger at Puerto Madryn and Comodoro Rivadavia than at Rawson (24.1, 19.3 and 6.4 thousand tons y{sup -1}, respectively). Waste was disposed at the three cities during all months of the sampled years. Large numbers of Kelp Gulls have been recorded taking advantage of fish waste disposed at these waste sites throughout the year. Considering its energetic content, waste generated at processing plants may support a population of between 101 000 and 209 000 Kelp Gulls. Fish waste could be contributing to their population expansion through increased survival and breeding success. Conflicts due to the use of waste and derived effects on other coastal species and human populations could be minimized by adequate fish waste management.
International Nuclear Information System (INIS)
Yorio, Pablo; Caille, Guillermo
2004-01-01
We evaluated the volumes of waste from fish processing plants in Chubut Province, Argentina, and discuss its potential consequences for Kelp Gull (Larus dominicanus) population dynamics and coastal management. Mean volume of waste produced between 1989 and 2001 in three coastal cities was 49.8 ± 10.9 thousand tons y -1 . The amount of waste varied between years and cities, being larger at Puerto Madryn and Comodoro Rivadavia than at Rawson (24.1, 19.3 and 6.4 thousand tons y -1 , respectively). Waste was disposed at the three cities during all months of the sampled years. Large numbers of Kelp Gulls have been recorded taking advantage of fish waste disposed at these waste sites throughout the year. Considering its energetic content, waste generated at processing plants may support a population of between 101 000 and 209 000 Kelp Gulls. Fish waste could be contributing to their population expansion through increased survival and breeding success. Conflicts due to the use of waste and derived effects on other coastal species and human populations could be minimized by adequate fish waste management
DNH 109: A fragmentary hominin near-proximal ulna from Drimolen, South Africa
Directory of Open Access Journals (Sweden)
Andrew Gallagher
2011-05-01
Full Text Available We describe a fragmentary, yet significant, diminutive proximal ulna (DNH 109 from the Lower Pleistocene deposits of Drimolen, Republic of South Africa. On the basis of observable morphology and available comparative metrics, DNH 109 is definitively hominin and is the smallest African Plio-Pleistocene australopith ulna yet recovered. Mediolateral and anteroposterior dimensions of the proximal diaphysis immediately distal to the m. brachialis sulcus in DNH 109 yield an elliptical area (π/4 *m-l*a-p that is smaller than the A.L. 333-38 Australopithecus afarensis subadult from Hadar. Given the unusually broad mediolateral/anteroposterior diaphyseal proportions distal to the brachialis sulcus, the osseous development of the medial and lateral borders of the sulcus, and the overall size of the specimen relative to comparative infant, juvenile, subadult and adult comparative hominid ulnae (Gorilla, Pan and Homo, it is probable that DNH 109 samples an australopith of probable juvenile age at death. As a result of the fragmentary state of preservation and absence of association with taxonomically diagnostic craniodental remains, DNH 109 cannot be provisionally assigned to any particular hominin genus (Paranthropus or Homo at present. Nonetheless, DNH 109 increases our known sample of available Plio-Pleistocene subadult early hominin postcrania.
TWRS privatization support project waste characterization database development. Volume 1
International Nuclear Information System (INIS)
Brevick, C.H.
1995-11-01
Pacific Northwest National Laboratory requested support from ICF Kaiser Hanford Company in assembling radionuclide and chemical analyte sample data and inventory estimates for fourteen Hanford under-ground storage tanks: 241-AN-102, -104, -105, -106, and -107, 241-AP-102, -104, and -105; 241-AW-101, -103, and -105, 241-AZ-101 and-102; and 241-C-109. Sample data were assembled for sixteen radio nuclides and thirty five chemical analytes. The characterization data were provided to Pacific Northwest National Laboratory in support of the Tank Waste Remediation Services Privatization Support Project. The purpose of this report is to present the results and document the methodology used in preparing the waste characterization information data set to support the Tank Waste Remediation Services Privatization Support Project. This report describes the methodology used in assembling the waste characterization information and how that information was validated by a panel of independent technical reviewers. Also, contained in this report are the various data sets created., the master data set, a subset, and an unreviewed data set
Directory of Open Access Journals (Sweden)
Amornchai Challcharoenwattana
2015-06-01
Full Text Available The study aimed to evaluate co-benefits in term of GHG reduction, and avoided landfill costs by implementing a community-based management (CBM program for municipal solid waste (MSW. Two towns of peri-urban settlement in Thailand were investigated in case studies to compare eco-performance between the towns with and without implementation of the CBM program. MSW mass flows together with MSW utilization records were analyzed based on data in year 2013. Climate co-benefits from waste utilization activities were examined. Results from the study indicated that waste banks in the CBM program can effectively divert most of recyclables from entering landfills. The performance of “waste bank—recyclable recovery program” recycling rate from the case study with CBM is 172.20 kg per member per year, which is about 926% higher than average CBMs with MSW recycling in Thailand, and the success of CBM can be attributed to its curbside pickup service and fair-pricing of recyclables. The study also found that if the town decided to divert wastes from landfilling, carbon intensity of the MSW system would be 0.47 tons of CO2-eq per ton of collected MSW. The landfilling cost would be approximately 7.41 USD per ton of MSW as landfilling cost. With CBM programs, current MSW reutilization rate has achieved 9.68% of generated waste, and 16.80% of GHG emission has been avoided, along with a reduction in landfill costs of 11.57%. Two scenarios of waste utilization in Thailand were explored and compared, in terms of which scenarios yielded the highest co-benefits. The study demonstrates that by allowing local mechanism and community involvement programs to develop with operational waste banks, the efficiency of collecting recycling wastes increased. A similar system can be applied to other communities in other countries.
Hazardous waste management: Reducing the risk
International Nuclear Information System (INIS)
Goldman, B.A.; Hulme, J.A.; Johnson, C.
1986-01-01
Congress has strengthened the laws under which active hazardous waste facilities are regulated. Nevertheless, after visiting a number of active treatment, storage, and disposal facilities, the Council on Economic Priorities (CEP) found that not only do generators not know which facilities are the best, but that the EPA has not always selected the best facilities to receive wastes removed from Superfund sites. Other facilities were better managed, better located, and better at using more advanced technologies than the facilities the EPA selected. In fact, of the ten facilities CEP evaluated in detail the EPA chose the one that performed worst - CECOS International, Inc. in Williamsburg, Ohio - to receive Superfund wastes in more instances than any of the other nine facilities. Data from a house subcommittee survey indicate that almost half of the operating hazardous waste facilities the EPA chose to receive wastes removed from Superfund sites may have contaminated groundwater. Some of the chosen facilities may even be partially responsible for a share of the wastes they are being paid to clean up. Hazardous waste management strategies and technology, how to evaluate facilities, and case studies of various corporations and hazardous waste management facilities are discussed
Electrical Energy Harvesting from Cooker’s Wasted Heat with Using Conduction Cooling
Directory of Open Access Journals (Sweden)
Amouzard Mahdiraji Wincent Ghafour
2018-01-01
Full Text Available In order meet the demand of electricity in current era, the need for new sources of energy even in very minimal amount, could be done with proper research and technology advancement in order to convert as much wasted energy as possible. Collecting and analyses cooker’s wasted heat as a main wasted energy source become the main interest for this research. This application can be installed either in household usage or commercial usage. Based on majority stove in household datasheet it shown that the efficiency of the stove is approximately 50%. With half of the efficiency turn into wasted heat, this application is suitable for thermoelectric generator (TEG to harvest the heat. The objective of this research is to determine whether the thermoelectric generator (TEG would able to power the 3V LED light as a small lighting system in household. Several designs with five TEGs in series circuit are tested to the application to analyses which method generated a better result. Since this research only focus in using a conduction cooling, aluminum heat sink will be utilized either for heat absorption or heat rejection. The maximum temperature differences between hot side and cold side is 209.83 °C with average power approximately 0.1 W.
41 CFR 109-38.903-50 - Reporting DOE motor vehicle data.
2010-07-01
... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.9-Federal Motor Vehicle Fleet... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reporting DOE motor vehicle data. 109-38.903-50 Section 109-38.903-50 Public Contracts and Property Management Federal...
41 CFR 109-38.401-2 - Use of self-service pumps.
2010-07-01
... pumps. 109-38.401-2 Section 109-38.401-2 Public Contracts and Property Management Federal Property...-2 Use of self-service pumps. It is DOE policy that motor vehicle operators shall use self-service pumps in accordance with the provisions of 41 CFR 101-38.401-2. ...
International Nuclear Information System (INIS)
Mohanty, Sitakanta; Codell, Richard
2000-01-01
The U.S. Nuclear Regulatory Commission (NRC), with the assistance of the Center for Nuclear Waste Regulatory Analyses, has developed a Total-system Performance Assessment (TPA) Code to assist in evaluating the performance of the Yucca Mountain (YM) High-Level Waste Repository in Nevada, proposed by the U.S. Department of Energy (DOE). The proposed YM repository would be built in a thick sequence of partially saturated volcanic tuff above the water table. Among the unique challenges of this environment are (1) the transport of radionuclides would take place partially through highly heterogeneous unsaturated rock; (2) the waste packages (WPs) would be generally exposed to oxidizing conditions, and (3) water either infiltrating from the surface or recirculating because of decay heat may drip onto the WPs. Tools such as the TPA code and embedded techniques for evaluating YM performance are aimed at (1) determining the parameters and key parts of the repository system that have the most influence on repository performance; (2) performing alternative conceptual models studies, especially with bounding models; (3) estimating the relative importance of the physical phenomena that lead to human exposure to radionuclides; and (4) improving NRC staff capabilities in performance assessment and associated license application reviews. This paper presents an overview of the NRC conceptual framework, approach to conducting system-level sensitivity analyses for determining influential parameters, and alternative conceptual model studies to investigate the effect of model uncertainties. (author)
International Nuclear Information System (INIS)
Callow, R.A.; Weidner, J.R.; Loehr, C.A.; Bates, S.O.; Thompson, L.E.; McGrail, B.P.
1991-08-01
This report describes two in situ vitrification field tests conducted on simulated buried waste pits during June and July 1990 at the Idaho National Engineering Laboratory. In situ vitrification, an emerging technology for in place conversion of contaminated soils into a durable glass and crystalline waste form, is being investigated as a potential remediation technology for buried waste. The overall objective of the two tests was to access the general suitability of the process to remediate waste structures representative of buried waste found at Idaho National Engineering Laboratory. In particular, these tests, as part of a treatability study, were designed to provide essential information on the field performance of the process under conditions of significant combustible and metal wastes and to test a newly developed electrode feed technology. The tests were successfully completed, and the electrode feed technology successfully processed the high metal content waste. Test results indicate the process is a feasible technology for application to buried waste. 33 refs., 109 figs., 39 tabs
Utilization of Construction Waste Tiles as a Replacement for Fine Aggregates in Concrete
Directory of Open Access Journals (Sweden)
A. A. Adekunle
2017-10-01
Full Text Available Ceramic wastes are found to be suitable for usage as substitution for fine and coarse aggregates in concrete production. This study is an investigation into the utilization of waste tiles as partial replacement for fine and coarse aggregates in concrete. The control mix and other mixes containing cement, water, granite and partial replacement for sand with crushed tiles (in 5%, 10%, 15% and 20% proportions were cast, cubed, cured and crushed. Also, another mix containing cement, water, sand and partial replacement of granite with crushed tiles (in 25%, 50% and 75% proportions were cast, cubed, cured and crushed. The specimens were tested for their respective compressive strengths using the Universal Testing Machine (UTM on the 7th, 14th, 21st and 28th days of curing. At 28 days, the compressive strength value of 5% of fine-waste tiles replacement was 20.12 N/mm2 while that of 10%, 15% and 20% were 14.24 N/mm2, 11.04 N/mm2 and 10.12 N/mm2 respectively. Moreover, at 28 days, the compressive strength of 25% of coarse-waste tiles replacement shows an increase to 22.45 N/mm2 while that of 50% and 75% were 18.4 N/mm2 and 12.2 N/mm2 respectively. Thus it can be concluded that fine aggregates can be substituted at 5% waste tiles while coarse aggregates can be substituted at 25% waste tiles.>/p>
International Nuclear Information System (INIS)
Parreira, Paulo S.; Nascimento Filho, Virgilio F.
1999-01-01
Using the energy dispersive X-ray fluorescence technique (ED-XRF), with radioisotopic sources of 55 Fe, 238 Pu e 109 Cd samples excitation, a qualitative study was carried out in a phosphogypsum and phosphate samples from different origin. The objective was to verify the excitation responses from different sources and to establish the analytical conditions of the technique for these kind of matrices. Besides the P and Ca, characteristic macro elements of this of matrix, it was also observed the elements Si, S, K, matrix, it was also observed the elements Si, S, K, Ti, Cr, Mn, Cu, Zn, Pb, Sr, Y, Zr and Nb. With different sources could be observed different groups of elements, since the emission response of the characteristic X-rays are associated to the excitation energy, in other words to the radioactive source. From the nutrients of major interest in this kind of matrix (P, S and Ca), the P and S elements showed small analytical sensibilities to the 109 Cd source. Greater intensities of characteristics X-ray emissions for the mainly elements of interest, was observed with the 55 Fe source and with the 238 Pu and 109 Cd sources analysis could be done showing trace elements which are present in those sort of samples. (author)
23 CFR 420.109 - What are the requirements for distribution of metropolitan planning funds?
2010-04-01
... and Research Funds § 420.109 What are the requirements for distribution of metropolitan planning funds... 23 Highways 1 2010-04-01 2010-04-01 false What are the requirements for distribution of metropolitan planning funds? 420.109 Section 420.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF...
International Nuclear Information System (INIS)
Kaczmarsky, Myron M.; Tsang, Irving; Stepien, Walter P.
1992-01-01
A Pollution Prevention/Waste Minimization Program was established during the early design phase of the U.S. DOE's New Production Reactor/Heavy Water Reactor Facility (NPR/HWRF) to encompass design, construction, operation and decommissioning. The primary emphasis of the program was given to waste elimination, source reduction and/or recycling to minimize the quantity and toxicity of material before it enters the waste stream for treatment or disposal. The paper discusses the regulatory and programmatic background as it applies to the NPR/HWRF and the waste assessment program developed as a phased approach to pollution prevention/waste minimization for the NPR/HWRF. Implementation of the program will be based on various factors including life cycle cost analysis, which will include costs associated with personnel, record keeping, transportation, pollution control equipment, treatment, storage, disposal, liability, compliance and oversight. (author)
International Nuclear Information System (INIS)
Ratel, G.; Michotte, C.; Janssen, H.; Kossert, K.; Lucas, L.; Karam, L.
2005-01-01
In 2004, the Physikalisch-Technische Bundesanstalt (PTB, Germany) and the National Institute of Standards and Technology (NIST, USA) each submitted one sample of known activity of 109 Cd to the International Reference System (SIR). The PTB result replaces their previous measurement of 1994 and the NIST result updates their 1986 CCRI(II) comparison result. The values of the activity submitted were about 15 MBq and 42 MBq. The new key comparison results have replaced the earlier values in the matrix of degrees of equivalence that now contains six results, identifier BIPM.RI(II)-K1.Cd-109, to which the remaining eleven results from the CCRI(II)-K2.Cd-109 held in 1986 are still linked. (authors)
Containment of solidified liquid hazardous waste in domal salt
International Nuclear Information System (INIS)
Domenico, P.A.; Lerman, A.
1992-01-01
In recent years, the solidification of hazardous liquid waste has become a viable option in waste management. The solidification process results in an increased volume but more stable waste form that must be disposed of or stored in a dry environment. An environment of choice in south central Texas is domal salt. The salt dome currently under investigation has a water content of 0.002 percent by weight and a permeability less than one nanodarcy. A question that must be addressed is whether a salt dome has a particular set of attributes that will prevent the release of contaminants to the environment. From a regulatory perspective, a ''no migration'' petition must be approved by the U.S.E.P.A. for the containment facility. By ''no migration'' it is implied that the waste must be contained for 10,000 years. A demonstration that this condition will be met will require model calculations and such models must be based on the physical and chemical characteristics of the waste form and the geologic environment. In particular, the models must address the rate of brine infiltration into the caverns, providing information on how fast an immobile solid waste form could convert to a more mobile liquid state. Additionally, the potential for migration by both diffusion and advection is of concern. Lastly, given a partially saturated cavern, the question of how far gaseous waste will be transported over the 10,000 year containment period must also be addressed. Results indicate that the containment capabilities of domal salt are exceptional. A nominal volume of brine will seep into the cavern and most voids between the injected solidified waste pellets will remain unsaturated. Very small quantities of hazardous constituents will be leached from the waste pellets
41 CFR 109-39.107 - Limited exemptions.
2010-07-01
..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.107 Limited exemptions. The Director, Office of... exemptions from the fleet management system. ...
2010-07-01
... 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System... operators and passengers in GSA Interagency Fleet Management System (IFMS) motor vehicles are aware of the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General. 109-39.300...
System for disposing of radioactive waste
International Nuclear Information System (INIS)
Gablin, K.A.; Hansen, L.J.
1980-01-01
A system is disclosed for disposing of radioactive mixed liquid and particulate waste material from nuclear reactors by solidifying the liquid components into a free standing hardened mass with a syrup of partially polymerized particles of urea formaldehyde in water and a liquid curing agent
Decentralized Energy from Waste Systems
Directory of Open Access Journals (Sweden)
Blanca Antizar-Ladislao
2010-01-01
Full Text Available In the last five years or so, biofuels have been given notable consideration worldwide as an alternative to fossil fuels, due to their potential to reduce greenhouse gas emissions by partial replacement of oil as a transport fuel. The production of biofuels using a sustainable approach, should consider local production of biofuels, obtained from local feedstocks and adapted to the socio-economical and environmental characteristics of the particular region where they are developed. Thus, decentralized energy from waste systems will exploit local biomass to optimize their production and consumption. Waste streams such as agricultural and wood residues, municipal solid waste, vegetable oils, and algae residues can all be integrated in energy from waste systems. An integral optimization of decentralized energy from waste systems should not be based on the optimization of each single process, but the overall optimization of the whole process. This is by obtaining optimal energy and environmental benefits, as well as collateral beneficial co-products such as soil fertilizers which will result in a higher food crop production and carbon dioxide fixation which will abate climate change.
Decentralized energy from waste systems
International Nuclear Information System (INIS)
Antizar-Ladislao, B.; Turrion-Gomez, J. L.
2010-01-01
In the last five years or so, biofuels have been given notable consideration worldwide as an alternative to fossil fuels, due to their potential to reduce greenhouse gas emissions by partial replacement of oil as a transport fuel. The production of biofuels using a sustainable approach, should consider local production of biofuels, obtained from local feedstocks and adapted to the socio-economical and environmental characteristics of the particular region where they are developed. Thus, decentralized energy from waste systems will exploit local biomass to optimize their production and consumption. Waste streams such as agricultural and wood residues, municipal solid waste, vegetable oils, and algae residues can all be integrated in energy from waste systems. An integral optimization of decentralized energy from waste systems should not be based on the optimization of each single process, but the overall optimization of the whole process. This is by obtaining optimal energy and environmental benefits, as well as collateral beneficial co-products such as soil fertilizers which will result in a higher food crop production and carbon dioxide fixation which will abate climate change. (author)
Energy Technology Data Exchange (ETDEWEB)
1994-04-01
The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety.
International Nuclear Information System (INIS)
1994-04-01
The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety
30 CFR 250.109 - What documents must I prepare and maintain related to welding?
2010-07-01
... related to welding? 250.109 Section 250.109 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF... Performance Standards § 250.109 What documents must I prepare and maintain related to welding? (a) You must submit a Welding Plan to the District Manager before you begin drilling or production activities on a...
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
During the time period covered in this report (1960`s through early 1990`s), six commercial low-level radioactive waste (LLRW) disposal facilities have been operated in the US. This report provides environmental monitoring data collected at each site. The report summarizes: (1) each site`s general design, (2) each site`s inventory, (3) the environmental monitoring program for each site and the data obtained as the program has evolved, and (4) what the program has indicated about releases to off-site areas, if any, including a statement of the actual health and safety significance of any release. A summary with conclusions is provided at the end of each site`s chapter. The six commercial LLRW disposal sites discussed are located near: Sheffield, Illinois; Maxey Flats, Kentucky; Beatty, Nevada; West Valley, New York; Barnwell, South Carolina; Richland, Washington.
... chemicals can still harm human health and the environment. When you throw these substances away, they become hazardous waste. Some hazardous wastes come from products in our homes. Our garbage can include such hazardous wastes as old batteries, bug spray cans and paint thinner. U.S. residents ...
International Nuclear Information System (INIS)
Cranford, B.
1993-01-01
A strong industry is vital to U.S. Economic health and prosperity, but U.S. industry is facing serious challenges both domestically and internationally. One of these challenges is the reduction of volatile organic compounds emissions from industrial processes and products. To assist industry with these challenges, the U.S. Department of Energy established the Industrial Waste Reduction Program to improve energy efficiency and competitiveness to private industry through cost-effective waste material reduction. This paper describes the programs and the use of joint partnerships between the Department of Energy, industry, national laboratories, universities and others, in developing technologies which reduce VOC emissions while improving energy efficiency. This paper also describes the process and selection criteria for participation in the program, and briefly describes the following five VOC reduction technologies under development: Dual Cure Coatings, Solvent Reduction through use of a No-clean Soldering Process, Solvent Waste Minimization by Supercritical CO 2 Cleaning Process, ethanol Recovery Process, and Membrane Vapor Recovery Systems. The VOC reductions as well as the energy savings and other benefits to the U.S. are discussed
Cai, Qing; Wang, Juan-Juan; Shao, Wei; Ying, Sheng-Hua; Feng, Ming-Guang
2018-04-27
Rtt109 is a histone acetyltransferase that catalyzes histone H3K56 acetylation required for genomic stability, DNA damage repair and virulence-related gene activity in yeast-like human pathogens but remains functionally unknown in fungal insect pathogens. This study seeks to elucidate catalytic activity of Rtt109 orthologue and its possible role in sustaining biological control potential of Beauveria bassiana, a fungal entomopathogen. Deletion of rtt109 in B. bassiana abolished histone H3K56 acetylation and triggered histone H2A-S129 phosphorylation. Consequently, the deletion mutant showed increased sensitivities to the stresses of DNA damage, oxidation, cell wall perturbation, high osmolarity and heat shock during colony growth, severe conidiation defects under normal culture conditions, reduced conidial hydrophobicity, decreased conidial UV-B resistance, and attenuated virulence through normal cuticle infection. These phenotypic changes correlated well with reduced transcript levels of many genes, which encode the families of H2A-S129 dephosphorylation-related protein phosphotases, DNA damage-repairing factors, antioxidant enzymes, heat-shock proteins, key developmental activators, hydrophobins and cuticle-degrading Pr1 proteases respectively. Rtt109 can acetylate H3K56 and dephosphorylate H2A-S129 in direct and indirect manners respectively, and hence plays an essential role in sustaining genomic stability and global gene activity required for conidiation capacity, environmental fitness and pest-control potential in B. bassiana. This article is protected by copyright. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
David Frederick
2012-02-01
This report describes conditions, as required by the state of Idaho Industrial Wastewater Reuse Permit (LA-000160-01), for the wastewater reuse site at the Idaho National Laboratory Site's Materials and Fuels Complex Industrial Waste Ditch and Industrial Waste Pond from November 1, 2010 through October 31, 2011. The report contains the following information: (1) Facility and system description; (2) Permit required effluent monitoring data and loading rates; (3) Groundwater monitoring data; (4) Status of special compliance conditions; and (5) Discussion of the facility's environmental impacts. During the 2011 reporting year, an estimated 6.99 million gallons of wastewater were discharged to the Industrial Waste Ditch and Pond which is well below the permit limit of 13 million gallons per year. Using the dissolved iron data, the concentrations of all permit-required analytes in the samples from the down gradient monitoring wells were below the Ground Water Quality Rule Primary and Secondary Constituent Standards.
Directory of Open Access Journals (Sweden)
Cechinel, André
2014-01-01
Full Text Available Este artigo propõe-se a investigar o suposto papel explicativo atribuído às notas que T. S. Eliot acrescentou ao poema The Waste Land quando de sua publicação. Para tanto, o texto volta a sua atenção, em particular, para três das várias observações em que o poeta expõe as referências por ele consultadas e referidas nos versos, isso com o intuito de verificar se de fato há um esclarecimento interpretativo prestado ao poema graças à inclusão das notas. Em linhas gerais, o choque entre os versos de The Waste Land e as notas autorais provoca um impasse que aciona o que aqui chamamos de uma máquina literária produtora de teses. Essa máquina, compreendida a partir de seu mecanismo estruturante, não só recusa a sugestão de que o entendimento do poema decorre da decodificação apropriada das fontes, como também produz um efeito plural responsável por desestabilizar a hierarquia classicista e canônica que a crítica literária por décadas viu ali instalada
U.S. Navy Shipboard-Generated Plastic Waste Pilot Recycling Program
1991-03-01
ship’s stores or vending machines often makes it way into "plastics only" containers located in work and berthing spaces. During the Escambia MRFsort...from Ships, or MARPOL). This legislation, which bans the disposal of plastics into the ocean, resulted from international and national pressures to halt...plastic by weight from a mixed, municipal waste stream produces a good product using the Er-1 extrusion technology. The Er-1 machine is a batch
Partial Epilepsy with Auditory Features
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2004-07-01
Full Text Available The clinical characteristics of 53 sporadic (S cases of idiopathic partial epilepsy with auditory features (IPEAF were analyzed and compared to previously reported familial (F cases of autosomal dominant partial epilepsy with auditory features (ADPEAF in a study at the University of Bologna, Italy.
Directory of Open Access Journals (Sweden)
Swaptik Chowdhury
2015-06-01
Full Text Available With increasing industrialization, the industrial byproducts (wastes are being accumulated to a large extent, leading to environmental and economic concerns related to their disposal (land filling. Wood ash is the residue produced from the incineration of wood and its products (chips, saw dust, bark for power generation or other uses. Cement is an energy extensive industrial commodity and leads to the emission of a vast amount of greenhouse gases, forcing researchers to look for an alternative, such as a sustainable building practice. This paper presents an overview of the work and studies done on the incorporation of wood ash as partial replacement of cement in concrete from the year 1991 to 2012. The aspects of wood ash such as its physical, chemical, mineralogical and elemental characteristics as well as the influence of wood ash on properties such as workability, water absorption, compressive strength, flexural rigidity test, split tensile test, bulk density, chloride permeability, freeze thaw and acid resistance of concrete have been discussed in detail.
Directory of Open Access Journals (Sweden)
Zasiah TAFHEEM
2018-03-01
Full Text Available The consumption of various forms of plastic has been increased in recent days due to the boost in industrialization and other human activities. Most of the plastic wastes are abandoned and require large landfill area for storage. More importantly, the low biodegradability of plastic poses a serious threat to environment protection issue. Various methods have been followed for the disposal of plastic in an attempt to reduce the negative impact of the plastic on the environment. Recently, various types of plastic have been incorporated in concrete to minimize the exposure of plastic to the environment. The aim of this study is to investigate the properties of concrete containing polyethylene terephthalate (PET, and high density polyethylene (HDPE plastic that were used as partial replacement of coarse aggregate (CA. In this study, four compositions of stone aggregate(S: plastic waste ratios have been used by volume basis: 100% S: 0% Plastic (control concrete, 90% S: 10% PET, 90% S: 10% HDPE, and 90% S: 5% PET+5% HDPE. The effects of waste plastic addition on the mechanical properties of concrete are presented in this paper. Test results reveal that minimum reduction in compressive strength has been found 35% in case of 10% PET plastic replaced concrete whereas splitting tensile strength for 10% PET replaced concrete has been increased by 21% while compared to control concrete. In addition, fresh unit weight of concrete containing plastic waste has been decreased by 4% in comparison to control concrete.
Purification and partial characterization of canine S100A12.
Heilmann, Romy M; Suchodolski, Jan S; Steiner, Jörg M
2010-12-01
Canine S100A12 (cS100A12) is a calcium-binding protein of the S100 superfamily of EF-hand proteins, and its expression is restricted to neutrophils and monocytes. Interaction of S100A12 with the receptor for advanced glycation end products (RAGE) has been suggested to play a central role in inflammation. Moreover, S100A12 has been shown to represent a sensitive and specific marker for gastrointestinal inflammation in humans. Only human, porcine, bovine, and rabbit S100A12 have been purified to date, and an immunoassay for the quantification of S100A12 is available only for humans. Therefore, the aim of this study was to develop a protocol for the purification of S100A12 and to partially characterize this protein in the dog (Canis lupus familiaris) as a prelude to the development of an immunologic method for its detection and quantification in canine serum and fecal specimens. Leukocytes were isolated from canine whole blood by dextran sedimentation, and canine S100A12 was extracted from the cytosol fraction of these cells. Further purification of cS100A12 comprised of ammonium sulfate precipitation, hydrophobic interaction chromatography, and strong cation- and anion-exchange column chromatography. Canine S100A12 was successfully purified from canine whole blood. The relative molecular mass of the protein was estimated at 10,379.5 and isoelectric focusing revealed an isoelectric point of 6.0. The approximate specific absorbance of cS100A12 at 280 nm was determined to be 1.78 for a 1 mg/ml solution. The N-terminal AA sequence of the first 15 residues of cS100A12 was Thr-Lys-Leu-Glu-Asp-His-X-Glu-Gly-Ile-Val-Asp-Val-Phe-His, and revealed 100% identity with the predicted protein sequence available through the canine genome project. Sequence homology for the 14 N-terminal residues identified for cS100A12 with those of feline, bovine, porcine, and human S100A12 was 78.6%. We conclude that canine S100A12 can be successfully purified from canine whole blood using the
Diffusion from cylindrical waste forms
International Nuclear Information System (INIS)
Thomas, G.F.
1985-05-01
The diffusion of a single component material from a finite cylindrical waste form, initially containing a uniform concentration of the material, is investigated. Under the condition that the cylinder is maintained in a well-stirred bath, expressions for the fractional inventory leached and the leach rate are derived with allowance for the possible permanent immobilization of the diffusant through its decay to a stable product and/or its irreversible reaction with the waste form matrix. The usefulness of the reported results in nuclear waste disposal applications is emphasized. The results reported herein are related to those previously derived at Oak Ridge National Laboratory by Bell and Nestor. A numerical scheme involving the partial decoupling of nested infinite summations and the use of rapidly converging rational approximants is recommended for the efficient implementation of the expressions derived to obtain reliable estimates of the bulk diffusion constant and the rate constant describing the diffusant-waste form interaction from laboratory data
Effect of olive waste (Husk on behavior of cement paste
Directory of Open Access Journals (Sweden)
Sharaf Alkheder
2016-12-01
Full Text Available Jordan is a famous country in terms of olive trees agriculture that resulted in a mass production of olive oil products. The huge amounts of olive waste (husk that resulted from olives processing to produce olive oil represent an environmental challenge in the country. The idea in this paper comes to use olive waste as a partial replacement for Portland cement in cement paste to conserve the environment, reduce cement consumption and increase cost efficiency. The wastes were burned properly in an oven and maintained for 6 h until it was fully transformed into ashes. Then, the oven was turned off and ashes were allowed to cool. After cooling, the material passed sieve #200 were used. The sieved ashes were used in the cement mix as a partial cement replacement for making the mortar and cement paste. Normal consistency and setting time were determined as well as soundness, compressive strength. Results indicated that normal consistency of the cement pastes containing different percentage of olive waste is somehow lower than that of the ordinary cement paste and slightly decreases with increasing the percentage. The results also indicated that the compressive strength of hardened blended cement paste containing different percentages of olive waste slightly decrease with olive waste content at 3, 7, and 28 days.
Development of an accelerated leach test(s) for low-level waste forms
International Nuclear Information System (INIS)
Dougherty, D.R.; Fuhrmann, M.; Colombo, P.
1985-01-01
An accelerated leach test(s) is being developed to predict long-term leaching behavior of low-level radioactive waste (LLW) forms in their disposal environments. As necessary background, a literature survey of reported leaching mechanisms, available mathematical models and factors that affect leaching of LLW forms has been compiled. Mechanisms which have been identified include diffusion, dissolution, ion exchange, corrosion and surface effects. A computerized data base of LLW leaching data and mathematical models is being developed. The data is being used for model evaluation by curve fitting and statistical analysis according to standard procedures of statistical quality control. Long-term leach tests on portland cement, bitumen and vinyl ester-styrene (VES) polymer waste forms are underway which are designed to identify and evaluate factors that accelerate leaching without changing the mechanisms. Initial results on the effect of temperature on leachability indicate that the leach rates of cement and VES waste forms increase with increasing temperature, whereas, the leach rate of bitumen is little affected. 10 refs., 5 figs
Liquid scintillation counting analysis of cadmium-109
International Nuclear Information System (INIS)
Robinson, M.K.; Barfuss, D.W.
1991-01-01
Recently the authors have used radiolabled cadmium-109 to measure the transport of inorganic cadmium in renal proximal tubules. An anomaly discovered in the liquid scintillation counting analysis of Cd-109 which is not attributable to normal decay; it consists of a significant decrease in the measured count rate of small amounts of sample. The objective is to determine whether the buffer solution used in the membrane transport studies is causing precipitation of the cadmium or whether cadmium is being adsorbed by the glass. It was important to determine whether the procedure could be modified to correct this problem. The problem does not appear to be related to the use of the buffer or to adsorption of Cd onto glass. Correction based on using triated L-glucose in all of these experiments and calculating a correction factor for the concentration of cadmium
Directory of Open Access Journals (Sweden)
Hua Li
2015-01-01
Full Text Available This study develops a sustainability assessment model for analysis and decision-making of the impact of China’s municipal solid waste management enhancement strategy options based on three waste treatment scenarios: landfill disposal, waste-to-energy incineration, and a combination of a material recovery facility and composting. The model employs life cycle assessment, health risk assessment, and full cost accounting to evaluate the treatment scenarios regarding safeguarding public health, protecting the environment and conserving resources, and economic feasibility. The model then uses an analytic hierarchy process for an overall appraisal of sustainability. Results suggest that a combination of material recovery and composting is the most efficient option. The study results clarify sustainable attributes, suitable predications, evaluation modeling, and stakeholder involvement issues in solid waste management. The demonstration of the use of sustainability assessment model (SAM provides flexibility by allowing assessment for a municipal solid waste management (MSWM strategy on a case-by-case basis, taking into account site-specific factors, therefore it has the potential for flexible applications in different communities/regions.
Measurement of the 1S-2S frequency in atomic hydrogen
International Nuclear Information System (INIS)
Hildum, E.A.
1986-01-01
A first precise measurement of the 1S-2S energy interval in atomic hydrogen was obtained by observing the 1S-2S transition in an atomic beam by pulsed Doppler-free two-photon spectroscopy and using an interferometrically calibrated line of 130 Te 2 at 486 nm as the references. The measured 1S-2S frequency is 2,466,061 395.6(4.9)MHz. With the calculated 1S Lamb shift, the 1S-2S frequency yields a value for the Rydberg constant, R/sub ∞/ = 109,737.314 92(22) cm -1 , which is not in good agreement with the most recent previously measured value, 109,737.315 44(11) cm -1 , obtained by S.R. Amin et al. It is, however, in good agreement with a previous Rydberg value, 109,737.315 04(32) cm -1 , measured by J.E.M. Goldsmith. If the Rydberg constant is taken as given, the 1S-2S frequency determines a value for the 1S Lamb shift. With Amin's Rydberg, the measured Lamb shift is 8161.0(5.4) MHz, in poor agreement with the theoretical value of 8149.43(8) MHz. With Goldsmith's Rydberg, the measurement Lamb shift is 8151.0(8.7) MHz, in good agreement with theory
Liquid secondary waste. Waste form formulation and qualification
Energy Technology Data Exchange (ETDEWEB)
Cozzi, A. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Dixon, K. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hill, K. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); King, W. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Nichols, R. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2016-03-01
The Hanford Site Effluent Treatment Facility (ETF) currently treats aqueous waste streams generated during Site cleanup activities. When the Hanford Tank Waste Treatment and Immobilization Plant (WTP) begins operations, a liquid secondary waste (LSW) stream from the WTP will need to be treated. The volume of effluent for treatment at the ETF will increase significantly. Washington River Protection Solutions is implementing a Secondary Liquid Waste Immobilization Technology Development Plan to address the technology needs for a waste form and solidification process to treat the increased volume of waste planned for disposal at the Integrated Disposal Facility IDF). Waste form testing to support this plan is composed of work in the near term to demonstrate the waste form will provide data as input to a performance assessment (PA) for Hanford’s IDF.
48 CFR 201.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Statutory acquisition-related dollar thresholds-adjustment for inflation. 201.109 Section 201.109 Federal Acquisition...-adjustment for inflation. (d) A matrix showing the most recent escalation adjustments of statutory...
International Nuclear Information System (INIS)
Orlowski, S.M.
1983-01-01
The radioactive waste management program started in the mid-1970s is being carried out by the Commission of European Communities (CEC) Joint Research Centre and by research bodies within the European community under CEC coordination and partial financing. The program deals with the management of the radioactive waste resulting from uranium-plutonium fuel cycle. During its first phase (1973-1979), various treatment and conditioning processes were investigated; high temperature incineration and acid digestion of alpha-bearing waste, immobilization of highly active waste in borosilicate glasses, inter alia, appeared promising. Geological disposal was recognized as a feasible option; transmutation of long-lived products did not appear to be an advantageous alternative to geological disposal, and the studies were discontinued. The second phase (1980-1984) of the program is a followup to the first. The needs of the European nuclear industry and of the national radioactive waste agencies or operators recently created are, however, taken into account. The continuity of the RandD effort is ensured by a ''Community plan of action on waste management,'' (1980-1992). A third phase, 1984-1989, should demonstrate the availability and validity of the waste management techniques and be convincing about their safety
Energy Technology Data Exchange (ETDEWEB)
Boni, Maria Rosaria; Sbaffoni, Silvia; Tuccinardi, Letizia, E-mail: letizia.tuccinardi@uniroma1.it
2013-06-15
Highlights: • Co-digestion process finalized to bio-H{sub 2} production was tested in batch tests. • Slaughterhouse waste (SHW) and food waste (FW) were co-digested in different proportions. • The presence of SHW affected the H{sub 2} production from FW. • When SHW ranging between 50% and 70% the H{sub 2} production is improved. • SHW percentages above 70%, led to a depletion in H{sub 2} production. - Abstract: The aim of this study was to evaluate the influence of slaughterhouse waste (SHW; essentially the skin, fats, and meat waste of pork, poultry, and beef) in a fermentative co-digestion process for H{sub 2} production from pre-selected organic waste taken from a refectory (food waste [FW]). Batch tests under mesophilic conditions were conducted in stirred reactors filled with different proportions of FW and SHW. The addition of 60% and 70% SHW to a mixture of SHW and FW improved H{sub 2} production compared to that in FW only, reaching H{sub 2}-production yields of 145 and 109 ml gVS{sub 0}{sup -1}, respectively, which are 1.5–2 times higher than that obtained with FW alone. Although the SHW ensured a more stable fermentative process due to its high buffering capacity, a depletion of H{sub 2} production occurred when SHW fraction was higher than 70%. Above this percentage, the formation of foam and aggregated material created non-homogenous conditions of digestion. Additionally, the increasing amount of SHW in the reactors may lead to an accumulation of long chain fatty acids (LCFAs), which are potentially toxic for anaerobic microorganisms and may inhibit the normal evolution of the fermentative process.
Energy Technology Data Exchange (ETDEWEB)
F. Hua; P. Pasupathi; N. Brown; K. Mon
2005-09-19
The safe disposal of radioactive waste requires that the waste be isolated from the environment until radioactive decay has reduced its toxicity to innocuous levels for plants, animals, and humans. All of the countries currently studying the options for disposing of high-level nuclear waste (HLW) have selected deep geologic formations to be the primary barrier for accomplishing this isolation. In U.S.A., the Nuclear Waste Policy Act of 1982 (as amended in 1987) designated Yucca Mountain in Nevada as the potential site to be characterized for high-level nuclear waste (HLW) disposal. Long-term containment of waste and subsequent slow release of radionuclides into the geosphere will rely on a system of natural and engineered barriers including a robust waste containment design. The waste package design consists of a highly corrosion resistant Ni-based Alloy 22 cylindrical barrier surrounding a Type 316 stainless steel inner structural vessel. The waste package is covered by a mailbox-shaped drip shield composed primarily of Ti Grade 7 with Ti Grade 24 structural support members. The U.S. Yucca Mountain Project has been studying and modeling the degradation issues of the relevant materials for some 20 years. This paper reviews the state-of-the-art understanding of the degradation processes based on the past 20 years studies on Yucca Mountain Project (YMP) materials degradation issues with focus on interaction between the in-drift environmental conditions and long-term materials degradation of waste packages and drip shields within the repository system during the 10,000 years regulatory period. This paper provides an overview of the current understanding of the likely degradation behavior of the waste package and drip shield in the repository after the permanent closure of the facility. The degradation scenario discussed in this paper include aging and phase instability, dry oxidation, general and localized corrosion, stress corrosion cracking and hydrogen induced
International Nuclear Information System (INIS)
Hua, F.; Pasupathi, P.; Brown, N.; Mon, K.
2005-01-01
The safe disposal of radioactive waste requires that the waste be isolated from the environment until radioactive decay has reduced its toxicity to innocuous levels for plants, animals, and humans. All of the countries currently studying the options for disposing of high-level nuclear waste (HLW) have selected deep geologic formations to be the primary barrier for accomplishing this isolation. In U.S.A., the Nuclear Waste Policy Act of 1982 (as amended in 1987) designated Yucca Mountain in Nevada as the potential site to be characterized for high-level nuclear waste (HLW) disposal. Long-term containment of waste and subsequent slow release of radionuclides into the geosphere will rely on a system of natural and engineered barriers including a robust waste containment design. The waste package design consists of a highly corrosion resistant Ni-based Alloy 22 cylindrical barrier surrounding a Type 316 stainless steel inner structural vessel. The waste package is covered by a mailbox-shaped drip shield composed primarily of Ti Grade 7 with Ti Grade 24 structural support members. The U.S. Yucca Mountain Project has been studying and modeling the degradation issues of the relevant materials for some 20 years. This paper reviews the state-of-the-art understanding of the degradation processes based on the past 20 years studies on Yucca Mountain Project (YMP) materials degradation issues with focus on interaction between the in-drift environmental conditions and long-term materials degradation of waste packages and drip shields within the repository system during the 10,000 years regulatory period. This paper provides an overview of the current understanding of the likely degradation behavior of the waste package and drip shield in the repository after the permanent closure of the facility. The degradation scenario discussed in this paper include aging and phase instability, dry oxidation, general and localized corrosion, stress corrosion cracking and hydrogen induced
Potential role of ABC-assisted repositories in U.S. plutonium and high-level waste disposition
Energy Technology Data Exchange (ETDEWEB)
Berwald, D.; Favale, A.; Myers, T. [Grumman Aerospace Corporation, Bethpage, NY (United States)] [and others
1995-10-01
This paper characterizes the issues involving deep geologic disposal of LWR spent fuel rods, then presents results of an investigation to quantify the potential role of Accelerator-Based Conversion (ABC) in an integrated national nuclear materials and high level waste disposition strategy. The investigation used the deep geological repository envisioned for Yucca Mt., Nevada as a baseline and considered complementary roles for integrated ABC transmutation systems. The results indicate that although a U.S. geologic waste repository will continue to be required, waste partitioning and accelerator transmutation of plutonium, the minor actinides, and selected long-lived fission products can result in the following substantial benefits: plutonium burndown to near zero levels, a dramatic reduction of the long term hazard associated with geologic repositories, an ability to place several-fold more high level nuclear waste in a single repository, electricity sales to compensate for capital and operating costs.
Waste Characterization Methods
Energy Technology Data Exchange (ETDEWEB)
Vigil-Holterman, Luciana R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Naranjo, Felicia Danielle [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-02-02
This report discusses ways to classify waste as outlined by LANL. Waste Generators must make a waste determination and characterize regulated waste by appropriate analytical testing or use of acceptable knowledge (AK). Use of AK for characterization requires several source documents. Waste characterization documentation must be accurate, sufficient, and current (i.e., updated); relevant and traceable to the waste stream’s generation, characterization, and management; and not merely a list of information sources.
Waste Characterization Methods
International Nuclear Information System (INIS)
Vigil-Holterman, Luciana R.; Naranjo, Felicia Danielle
2016-01-01
This report discusses ways to classify waste as outlined by LANL. Waste Generators must make a waste determination and characterize regulated waste by appropriate analytical testing or use of acceptable knowledge (AK). Use of AK for characterization requires several source documents. Waste characterization documentation must be accurate, sufficient, and current (i.e., updated); relevant and traceable to the waste stream's generation, characterization, and management; and not merely a list of information sources.
48 CFR 49.109-7 - Settlement by determination.
2010-10-01
... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.109-7 Settlement by determination. (a... determination of the amount due consistent with the termination clause, including any cost principles...
Patient’s Satisfaction with Removable Partial Dentures: A Retrospective Case Series
Shala, Kujtim Sh.; Dula, Linda J.; Pustina-Krasniqi, Teuta; Bicaj, Teuta; Ahmedi, Enis F.; Lila-Krasniqi, Zana; Tmava-Dragusha, Arlinda
2016-01-01
This retrospective clinical study aimed to assess patient’s satisfaction with removable partial dentures (RPDs), as retention, chewing ability, aesthetics during the observation period. Material and Methods: A total of 63 patients with RPDs, participated in this study. The following data was collected: Kennedy classification, denture design, denture support, satisfaction and success of RPD. Result: The results showed that 73.6% of patients were wearing RPD for the first time and were finally satisfied. According to the denture support of RPDs, clasp-retained quadrangular RPDs were 100% effective, followed by triangular dental support 81% and linear dental support 47.7%. Comparison of RPDs with attachment with RPDs with claps assessed through Fisher exact test, confirmed statistically significant difference (P=0.008), despite retention; however, chewing ability and aesthetics showed no statistically significant difference with X 2 test on patient’s satisfaction with RPD with or without attachment. Conclusion: Patients often would prefer not showing the anterior buccal clasps of RPD, therefore are generally satisfied more with RPD with attachment based on level of retention, chewing ability and aesthetics. PMID:28077970
Historical research in the Hanford site waste cleanup
International Nuclear Information System (INIS)
Gerber, Michele S.
1992-01-01
This paper will acquaint the audience with role of historical research in the Hanford Site waste cleanup - the largest waste cleanup endeavor ever undertaken in human history. There were no comparable predecessors to this massive waste remediation effort, but the Hanford historical record can provide a partial road map and guide. It can be, and is, a useful tool in meeting the goal of a successful, cost-effective, safe and technologically exemplary waste cleanup. The Hanford historical record is rich and complex. Yet, it poses difficult challenges, in that no central and complete repository or data base exists, records contain obscure code words and code numbers, and the measurement systems and terminology used in the records change many times over the years. Still, these records are useful to the current waste cleanup in technical ways, and in ways that extend beyond a strictly scientific aspect. Study and presentations of Hanford Site history contribute to the huge educational and outreach tasks of helping the Site's work force deal with 'culture change' and become motivated for the cleanup work that is ahead, and of helping the public and the regulators to place the events at Hanford in the context of WWII and the Cold War. This paper traces historical waste practices and policies as they changed over the years at the Hanford Site, and acquaints the audience with the generation of the major waste streams of concern in Hanford Site cleanup today. It presents original, primary-source research into the waste history of the Hanford Site. The earliest, 1940s knowledge base, assumptions and calculations about radioactive and chemical discharges, as discussed in the memos, correspondence and reports of the original Hanford Site (then Hanford Engineer Works) builders and operators, are reviewed. The growth of knowledge, research efforts, and subsequent changes in Site waste disposal policies and practices are traced. Examples of the strengths and limitations of the
Directory of Open Access Journals (Sweden)
Verena Radulovic
2018-03-01
Full Text Available For over a decade, media stories have exposed health and environmental harm caused by informal electronics recycling in less industrialized countries. Greater awareness of these risks helped inform regulations across the globe and the development of recycling standards. Yet, media depictions also shape public perceptions of informal workers and their role in handling electronic waste, or e-waste. This paper examines how mainstream print media describes the informal sector’s involvement in handling e-waste in India, especially as policymakers and other stakeholders currently grapple with how to integrate informal workers into formal, more transparent e-waste management schemes. This study evaluates depictions of the informal sector in print articles from both non-Indian and Indian news media outlets, employing controversy mapping principles and digital research tools. Findings may help inform stakeholder agendas seeking to influence public awareness on how to integrate informal workers into viable e-waste management solutions. Subsequent research based on these results could also help stakeholders understand the actors and networks that shape such media depictions. Results from the dataset show that most news articles describe informal workers negatively or problematically due to activities causing health risks and environmental damage, but usually do not discern which activities in the value chain (e.g., collection, dismantling, metals extraction represent the greatest risks. Comparatively fewer articles portray informal workers positively or as contributing to e-waste solutions. Most articles also do not explain challenges that arise when working with informal workers. As such, media depictions today often lag behind policy debates and obscure multiple facets—good and bad—of the informal sector’s involvement in managing e-waste. Thus, an opportunity exists for policymakers, manufacturers, and advocacy groups to bridge the gap between
Energy Technology Data Exchange (ETDEWEB)
Gardner, T.H.; Berry, D.A.; Lyons, K.D.; Beer, S.K.; Freed, A.D. [U.S. Department of Energy, Morgantown, WV (USA). National Energy Technology Laboratory
2002-12-01
H{sub 2}S catalytic partial oxidation technology with an activated carbon catalyst was found to be a promising method for the removal of hydrogen sulfide from fuel cell hydrocarbon feedstocks. Three different fuel cell feedstocks were considered for analysis: sour natural gas, sour effluent from a liquid middle distillate fuel processor and a Texaco O{sub 2}-blown coal-derived synthesis gas. The H{sub 2}S catalytic partial oxidation reaction, its integratability into fuel cell power plants with different hydrocarbon feedstocks and its salient features are discussed. Experimental results indicate that H{sub 2}S concentration can be removed down to the part-per-million level in these plants. Additionally, a power law rate expression was developed and reaction kinetics compared to prior literature. The activation energy for this reaction was determined to be 34.4 kJ/g mol with the reaction being first order in H{sub 2}S and 0.3 order in O{sub 2}. 18 refs., 14 figs., 3 tabs.
49 CFR 212.109 - Joint planning of inspections.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.109... designed to monitor the compliance of the railroads, shippers, and manufacturers operating within the State...
Effects of biodrying process on municipal solid waste properties.
Tambone, F; Scaglia, B; Scotti, S; Adani, F
2011-08-01
In this paper, the effect of biodrying process on municipal solid waste (MSW) properties was studied. The results obtained indicated that after 14d, biodrying reduced the water content of waste, allowing the production of biodried waste with a net heating value (NHV) of 16,779±2,074kJ kg(-1) wet weight, i.e. 41% higher than that of untreated waste. The low moisture content of the biodried material reduced, also, the potential impacts of the waste, i.e. potential self-ignition and potential odors production. Low waste impacts suggest to landfill the biodried material obtaining energy via biogas production by waste re-moistening, i.e. bioreactor. Nevertheless, results of this work indicate that biodrying process because of the partial degradation of the organic fraction contained in the waste (losses of 290g kg(-1) VS), reduced of about 28% the total producible biogas. Copyright © 2011 Elsevier Ltd. All rights reserved.
Detection of waste's layers with geoelectric methods: case of Relleno Sanitario Rio Azul, Costa Rica
International Nuclear Information System (INIS)
Suarez, Jorge; Zuniga, Hector
2013-01-01
Areas of greatest potential leachate storage are identified making 25 VES (Vertical Electrical Soundings), whose effective exploration depth was around 65 meters. The proposed geophysical model consists of four layers: the first corresponds to a coverage of compacted material (20 Ωm - 54 Ωm), the second layer contains unsaturated waste (11 Ωm - 18 Ωm), the third (1 Ωm - 5.4 Ωm) is saturated waste with leachate and the fourth (49 Ωm - 360 Ωm) the basement on which was installed the landfill. Therefore, the geoelectric allowed determining the thickness and distribution of covering materials, waste, saturated waste with leachates and depth of the basement's top. (author) [es
Ferrocyanide tank waste stability
International Nuclear Information System (INIS)
Fowler, K.D.
1993-01-01
Ferrocyanide wastes were generated at the Hanford Site during the mid to late 1950s as a result of efforts to create more tank space for the storage of high-level nuclear waste. The ferrocyanide process was developed to remove 137 CS from existing waste and newly generated waste that resulted from the recovery of valuable uranium in Hanford Site waste tanks. During the course of research associated with the ferrocyanide process, it was recognized that ferrocyanide materials, when mixed with sodium nitrate and/or sodium nitrite, were capable of violent exothermic reaction. This chemical reactivity became an issue in the 1980s, when safety issues associated with the storage of ferrocyanide wastes in Hanford Site tanks became prominent. These safety issues heightened in the late 1980s and led to the current scrutiny of the safety issues associated with these wastes, as well as current research and waste management programs. Testing to provide information on the nature of possible tank reactions is ongoing. This document supplements the information presented in Summary of Single-Shell Tank Waste Stability, WHC-EP-0347, March 1991 (Borsheim and Kirch 1991), which evaluated several issues. This supplement only considers information particular to ferrocyanide wastes
U.S. Nuclear Regulatory Commission Process for Risk-Informing the Nuclear Waste Arena
International Nuclear Information System (INIS)
Leslie, B. W.
2003-01-01
The U.S. Nuclear Regulatory Commission (NRC) is increasing the use of risk insights and information in its regulation of nuclear materials and waste. The objective of this risk-informed regulatory effort is to improve the effectiveness and efficiency of the agency, while maintaining or increasing its focus on safety. The agency's Office of Nuclear Material Safety and Safeguards (NMSS) proposed a five-step process to carry out a framework for increasing the use of risk information and insights in its regulation of nuclear materials and waste. The office is carrying out the five-step process to risk-inform the nuclear materials and waste arenas. NMSS's actions included forming a Risk Task Group and the use of case studies to test and complete screening criteria for identifying candidate regulatory applications amenable for risk-informing. Other actions included involving stakeholders through enhanced public participation, developing safety goals for materials and waste regulatory applications, and establishing a risk training program for staff. Through the case studies, NRC staff found the draft screening criteria to be effective in deciding regulatory areas that may be amenable to an increased use of risk insights. NRC staff also found that risk information may have the potential to reduce regulatory burden and improve staff's efficiency in making decisions, while maintaining safety. Finally, staff found that it would be possible to develop safety goals for the nuclear materials and waste arenas
41 CFR 109-25.104 - Acquisition of office furniture and office machines.
2010-07-01
... furniture and office machines. 109-25.104 Section 109-25.104 Public Contracts and Property Management... furniture and office machines. DOE offices and designated contractors shall make the determination as to whether requirements can be met through the utilization of DOE owned furniture and office machines. ...
Environmental evaluation of municipal waste prevention
International Nuclear Information System (INIS)
Gentil, Emmanuel C.; Gallo, Daniele; Christensen, Thomas H.
2011-01-01
Highlights: → Influence of prevention on waste management systems, excluding avoided production, is relatively minor. → Influence of prevention on overall supply chain, including avoided production is very significant. → Higher relative benefits of prevention are observed in waste management systems relying mainly on landfills. - Abstract: Waste prevention has been addressed in the literature in terms of the social and behavioural aspects, but very little quantitative assessment exists of the environmental benefits. Our study evaluates the environmental consequences of waste prevention on waste management systems and on the wider society, using life-cycle thinking. The partial prevention of unsolicited mail, beverage packaging and food waste is tested for a 'High-tech' waste management system relying on high energy and material recovery and for a 'Low-tech' waste management system with less recycling and relying on landfilling. Prevention of 13% of the waste mass entering the waste management system generates a reduction of loads and savings in the waste management system for the different impacts categories; 45% net reduction for nutrient enrichment and 12% reduction for global warming potential. When expanding our system and including avoided production incurred by the prevention measures, large savings are observed (15-fold improvement for nutrient enrichment and 2-fold for global warming potential). Prevention of food waste has the highest environmental impact saving. Prevention generates relatively higher overall relative benefit for 'Low-tech' systems depending on landfilling. The paper provides clear evidence of the environmental benefits of waste prevention and has specific relevance in climate change mitigation.
Decommissioning of evaporation technology for processing liquid radioactive waste in UJV Rez, a. s
International Nuclear Information System (INIS)
Tous, M.; Otcovsky, T.; Podlaha, J.
2015-01-01
The UJV Rez, a. s. is the main leader in processing institutional radioactive waste (RAW) in the Czech Republic and the Waste Management Department has been established since the research reactor VVR-S (now LVR-15) was put in operation. Due to the large activities in nuclear research and engineering in the past, a big capacity of waste management technologies was needed. The low pressure compactor for volume reduction of solid RAW, as well as chemical pre-treatment technology of liquid RAW were installed and later the evaporation technology for effective processing the liquid RAW with the cementation and bituminization unit for final conditioning of concentrated liquid RAW were used. During the years of research reactor operation and research activities in UJV Rez, a. s. there were two installed evaporation technologies in row. After the latest evaporator lifetime, changes in liquid RAW production and together with higher decontamination factor requirements, this technology was decided to be decommissioned. The decommissioned evaporation technology was installed and put in operation in 1991. This technology was used for processing liquid aqueous RAW produced from internal research activities and of course for external producers and institutions (e.g. universities, medicine, research institutes, industry). The approved decommissioning plan was prepared and the licence for immediate decommissioning was obtained in 2012. Then the decommissioning project started. The preparing stages as dosimetric survey, expected material balance and of course initial decontamination activities were performed. Evaporation technology dismantling and processing the arising RAW were done by the internal staff of Waste Management Department. The total volume of produced RAW was 49,5 m 3 of RAW. The secondary liquid RAW (from decontamination) of amount 1,4 m 3 , contaminated sludge of amount 0,5 m 3 , solid RAW (construction steel) of amount 39,1 m 3 , solid compressible RAW (protective
International Nuclear Information System (INIS)
Li, Zhidong
2015-01-01
This study identified the current status and long-term outlook of China's nuclear power development and radioactive waste disposal management after the 3.11 FUKUSHIMA accidents. China strengthened the actions for achieving nuclear power safety and cost efficiency as well as safety management of radioactive waste. It is a hard work to expand the capacity to 58 GW, the governmental target in 2020. The long-term development will strongly depend on the progress in safety management of nuclear power and radioactive waste and economic competitiveness. (author)
Partially-deuterated samples of HET-s(218–289) fibrils: assignment and deuterium isotope effect
Energy Technology Data Exchange (ETDEWEB)
Smith, Albert A.; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias, E-mail: maer@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland); Böckmann, Anja, E-mail: a.bockmann@ibcp.fr [Institut de Biologie et Chimie des Protéines, Bases Moléculaires et Structurales des Systèmes Infectieux, Labex Ecofect, UMR 5086 CNRS, Université de Lyon (France); Meier, Beat H., E-mail: beme@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland)
2017-02-15
Fast magic-angle spinning and partial sample deuteration allows direct detection of {sup 1}H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, {sup 1}H detection requires assignment of the {sup 1}H resonances. In this work, resonance assignments of backbone H{sup N} and Hα are presented for HET-s(218–289) fibrils, based on the existing assignment of Cα, Cβ, C’, and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.
U.S. Bureau of Mines, phase I Hanford low-level waste melter tests: Melter offgas report
International Nuclear Information System (INIS)
Eaton, W.C.
1995-01-01
A multiphase program was initiated in 1994 to test commercially available melter technologies for the vitrification of the low-level waste (LLW) stream from defense wastes stored in underground tanks at the Hanford Site in southeastern Washington State. Phase 1 of the melter demonstration tests using simulated LLW was completed during fiscal year 1995. This document is the melter offgas report on testing performed by the U.S. Department of the Interior, Bureau of Mines, Albany Research Center in Albany, Oregon. The Bureau of Mines (one of the seven vendors selected) was chosen to demonstrate carbon electrode melter technology (also called carbon arc or electric arc) under WHC subcontract number MMI-SVV-384216. The document contains the complete offgas report for the first 24-hour melter test (WHC-1) as prepared by Entropy Inc. A summary of this report is also contained in the''U.S. Bureau of Mines, Phase 1 Hanford Low-Level Waste Melter Tests: Final Report'' (WHC-SD-WM-VI-030)
Energy Technology Data Exchange (ETDEWEB)
Brincat, S.; Mantell, B.S.
1986-07-01
A patient who developed a partial relapse of Bell's palsy following superficial radiotherapy to a basal cell carcinoma in the temple is reported. Nerves injured by Bell's palsy may be more susceptible to radiation induced damage.
International Nuclear Information System (INIS)
Cour Jansen, J. la.
1997-03-01
A comparative environmental evaluation has been made for three systems for processing household refuse. The first system (1) comprises thermofilic treatment of the organic waste. The inorganic parts of the waste from both systems is combusted in a cogeneration plant. The third system (3) is a cogeneration plant combusting all the wastes. The most essential issue in comparing the three waste processing systems is the possibility to use the residual products from the bio-gasification system (1) and the composting system in the agriculture as fertilizers. Without such a use it is estimated that the systems (1) and (2) will be very unfeasible, both environmentally and economically. The contents of heavy metals, organic chemicals, and plasticizers in the residual products are at present above the Danish threshold values. This problem can only be solved by reducing the contents of these pollutants in the household wastes. Based on these findings it is therefore very doubtful whether the residual waste products from bio-gasification and probably also from composting can be used in the agriculture in the future. However, it is for the other parts of the environmental analysis assumed that the problem will eventually be solved. Differences in resource utilization in the waste processing are very small in the three systems. When comparing the net energy production system (1) and (3) show the best results. The three systems are almost equal related to emissions of HC1, NO x , and SO 2 , the composting system performing the best. The three systems emit the same amount of CO 2 and other greenhouse gases. Composting, however, results in a smaller energy susbstituion and is therefore marginally a poorer solution. For reducing the heavy metals and plasticizers in the environment combustion of the organic wastes is the best system. (LN)
41 CFR 109-1.5202 - Establishment of a personal property holdings baseline.
2010-07-01
... personal property holdings baseline. 109-1.5202 Section 109-1.5202 Public Contracts and Property Management...-1.5202 Establishment of a personal property holdings baseline. (a) If the contractor is a new... baseline or may perform a complete physical inventory of all personal property. This physical inventory is...
Liquid secondary waste: Waste form formulation and qualification
Energy Technology Data Exchange (ETDEWEB)
Cozzi, A. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Dixon, K. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hill, K. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Nichols, R. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-07-31
The Hanford Site Effluent Treatment Facility (ETF) currently treats aqueous waste streams generated during site cleanup activities. When the Hanford Tank Waste Treatment and Immobilization Plant (WTP) begins operations, including Direct Feed Low Activity Waste (DFLAW) vitrification, a liquid secondary waste (LSW) stream from the WTP will need to be treated. The volume of effluent for treatment at the ETF will increase significantly. The powdered salt waste form produced by the ETF will be replaced by a stabilized solidified waste form for disposal in Hanford’s Integrated Disposal Facility (IDF). Washington River Protection Solutions is implementing a Secondary Liquid Waste Immobilization Technology Development Plan to address the technology needs for a waste form and solidification process to treat the increased volume of waste planned for disposal at the IDF. Waste form testing to support this plan is composed of work in the near term to provide data as input to a performance assessment (PA) for Hanford’s IDF. In 2015, three Hanford Liquid Secondary Waste simulants were developed based on existing and projected waste streams. Using these waste simulants, fourteen mixes of Hanford Liquid Secondary Waste were prepared and tested varying the waste simulant, the water-to-dry materials ratio, and the dry materials blend composition.1 In FY16, testing was performed using a simulant of the EMF process condensate blended with the caustic scrubber—from the Low Activity Waste (LAW) melter—, processed through the ETF. The initial EMF-16 simulant will be based on modeling efforts performed to determine the mass balance of the ETF for the DFLAW.2 The compressive strength of all of the mixes exceeded the target of 3.4 MPa (500 psi) to meet the requirements identified as potential IDF Waste Acceptance Criteria in Table 1 of the Secondary Liquid Waste Immobilization Technology Development Plan.3 The hydraulic properties of the waste forms tested (hydraulic conductivity
78 FR 14774 - U.S. Environmental Solutions Toolkit-Universal Waste
2013-03-07
...--Universal Waste AGENCY: International Trade Administration, DOC. ACTION: Notice and Request for Comment... or services relevant to management of universal waste. The Department of Commerce continues to..., Web site address, contact information, and universal waste management category of interest from the...
Energy Technology Data Exchange (ETDEWEB)
SPRITZER,M; HONG,G
2005-01-01
Under Cooperative Agreement No. DE-FC36-00GO10529 for the Department of Energy, General Atomics (GA) is developing Supercritical Water Partial Oxidation (SWPO) as a means of producing hydrogen from low-grade biomass and other waste feeds. The Phase I Pilot-scale Testing/Feasibility Studies have been successfully completed and the results of that effort are described in this report. The Key potential advantages of the SWPO process is the use of partial oxidation in-situ to rapidly heat the gasification medium, resulting in less char formation and improved hydrogen yield. Another major advantage is that the high-pressure, high-density aqueous environment is ideal for reaching and gasifying organics of all types. The high water content of the medium encourages formation of hydrogen and hydrogen-rich products and is especially compatible with high water content feeds such as biomass materials. The high water content of the medium is also effective for gasification of hydrogen-poor materials such as coal. A versatile pilot plant for exploring gasification in supercritical water has been established at GA's facilities in San Diego. The Phase I testing of the SWPO process with wood and ethanol mixtures demonstrated gasification efficiencies of about 90%, comparable to those found in prior laboratory-scale SCW gasification work carreid out at the University of Hawaii at Manoa (UHM) as well as other biomass gasification experience with conventional gasifiers. As in the prior work at UHM, a significant amount of the hydrogen found in the gas phase products is derived from the water/steam matrix. The studies at UHM utilized an indirectly heated gasifier with an acitvated carbon catalyst. In contrast, the GA studies utilized a directly heated gasifier without catalyst, plus a surrogate waste fuel. Attainment of comparable gasification efficiencies without catalysis is an important advancement for the GA process, and opens the way for efficient hydrogen production from low
41 CFR 109-39.103 - Agency appeals.
2010-07-01
..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.103 Agency appeals. The Director, Office of... request exemption from, a determination made by GSA concerning the establishment of a fleet management...
41 CFR 109-27.5007-1 - Procedures.
2010-07-01
...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5007-1 Procedures. The following procedures shall be established for taking physical inventory of stocks subjected to quantity controls as well as those under financial control: (a) Completion of a physical inventory...
41 CFR 109-39.301 - Utilization guidelines.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Utilization guidelines... Management System Vehicles § 109-39.301 Utilization guidelines. DOE activities utilizing GSA IFMS motor... meeting DOE utilization guidelines or established local use objectives, as appropriate. Those vehicles not...
Review of the Scientific Understanding of Radioactive Waste at the U.S. DOE Hanford Site.
Peterson, Reid A; Buck, Edgar C; Chun, Jaehun; Daniel, Richard C; Herting, Daniel L; Ilton, Eugene S; Lumetta, Gregg J; Clark, Sue B
2018-01-16
This Critical Review reviews the origin and chemical and rheological complexity of radioactive waste at the U.S. Department of Energy Hanford Site. The waste, stored in underground tanks, was generated via three distinct processes over decades of plutonium extraction operations. Although close records were kept of original waste disposition, tank-to-tank transfers and conditions that impede equilibrium complicate our understanding of the chemistry, phase composition, and rheology of the waste. Tank waste slurries comprise particles and aggregates from nano to micro scales, with varying densities, morphologies, heterogeneous compositions, and complicated responses to flow regimes and process conditions. Further, remnant or changing radiation fields may affect the stability and rheology of the waste. These conditions pose challenges for transport through conduits or pipes to treatment plants for vitrification. Additionally, recalcitrant boehmite degrades glass quality and the high aluminum content must be reduced prior to vitrification for the manufacture of waste glass of acceptable durability. However, caustic leaching indicates that boehmite dissolves much more slowly than predicted given surface normalized rates. Existing empirical models based on ex situ experiments and observations generally only describe material balances and have not effectively predicted process performance. Recent advances in the areas of in situ microscopy, aberration-corrected transmission electron microscopy, theoretical modeling across scales, and experimental methods for probing the physics and chemistry at mineral-fluid and mineral-mineral interfaces are being implemented to build robustly predictive physics-based models.
Physico-chemical studies on amylases from fermented cassava waste water
International Nuclear Information System (INIS)
Oboh, G.; Akindahunsi, A.A.
2001-09-01
Waste water from cassava mash fermented with pure strain of Saccharomycees cerevisae together with Lactobacillus delbruckii and Lactobacillus coryneformis (3 days) was assayed for amylase activity. The result of the study indicated that the fermentation waste water had amylase activity, the unit activity and the specific activity of the amylase in the waste water was 0.22μmole/min and 0.06μmole/min/mg, respectively. The amylase was partially purified using Gel filtration (Sephadex-G150). The partially purified enzyme was maximally activity at pH 6.0 and 60 deg. C temperature. It had its maximum stability between pH 6-7 for 4hr, and 30 deg. C for 50 mins. NaCl, NH 4 Cl, FeCl 3 , KCl, NaNO 3 activates the enzyme activity while CUSO 4 and HgCl 2 inhibit the activity of the amylase. It could be concluded that these amylases from the fermented cassava waste amylase were active at wide temperature and pH ranges, this quality could be explored in the industrial sector (most especially food industry) as a source of industrial amylase that requires a wide range of conditions (temperature and pH). (author)
Energy Technology Data Exchange (ETDEWEB)
Arm, Stuart T.; Van Meighem, Jeffery S. [Washington River Protection Solutions, P.O. Box 850, Richland, Washington, 99352 (United States); Duncan, Garth M.; Pell, Michael J. [Bechtel National Inc., 2435 Stevens Center Place, Richland, Washington, 99352 (United States); Harrington, Christopher C. [Department of Energy - Office of River Protection, 2440 Stevens Center Place, Richland, Washington, 99352 (United States)
2013-07-01
The U.S. Department of Energy (DOE), Office of River Protection (ORP) is responsible for management and completion of the River Protection Project (RPP) mission, which includes the Hanford Site tank farms operations and the Waste Treatment and Immobilization Plant (WTP). The RPP mission is to store, retrieve and treat Hanford's tank waste; store and dispose of treated wastes; and close the tank farm waste management areas and treatment facilities by 2047. The WTP is currently being designed and constructed by Bechtel National Inc. (BNI) for DOE-ORP. BNI relies on a number of technical services from other Hanford contractors for WTP's construction and commissioning. These same services will be required of the future WTP operations contractor. Partly in response to a DNFSB recommendation, the WTP interface management process managing these technical services has recently been improved through changes in organization and issue management. The changes are documented in an Interface Management Plan. The organizational improvement is embodied in the One System Integrated Project Team that was formed by integrating WTP and tank farms staff representing interfacing functional areas into a single organization. A number of improvements were made to the issue management process but most notable was the formal appointment of technical, regulatory and safety subject matter experts to ensure accurate identification of issues and open items. Ten of the thirteen active WTP Interface Control Documents have been revised in 2012 using the improved process with the remaining three in progress. The value of the process improvements is reflected by the ability to issue these documents on schedule and accurately identify technical, regulatory and safety issues and open items. (authors)
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
78 FR 14773 - U.S. Environmental Solutions Toolkit-Medical Waste
2013-03-07
...--Medical Waste AGENCY: International Trade Administration, DOC. ACTION: Notice and Request for Comment... or services relevant to management of medical waste. The Department of Commerce continues to develop... encouraged to submit their company's name, Web site address, contact information, and medical waste...
Radioactive waste incinerator at the Scientific Ecology Group, Inc
International Nuclear Information System (INIS)
Dalton, J.D.; Arrowsmith, H.W.
1990-01-01
Scientific Ecology Group, Inc. (SEG) is the largest radioactive waste processor in the United States. This paper discusses how SEG recently began operation of the first commercial low-level radioactive waste incinerator in the United States. This incinerator is an Envikraft EK 980 NC multi-stage, partial pyrolysis, controlled-air unit equipped with an off-gas train that includes a boiler, baghouse, HEPA bank, and wet scrubber. The incinerator facility has been integrated into a large waste management complex with several other processing systems. The incinerator is operated on a continuous around-the-clock basis, processing up to 725 kg/hr (1,600 lbs/hr) of solid waste while achieving volume reduction ratios in excess of 300:1
Utilization of Hospital Waste Ash in Concrete
Directory of Open Access Journals (Sweden)
Shazim Ali Memon
2013-01-01
Full Text Available Hospital waste management is a huge problem in Pakistan. The annual production of medical waste produced from health care facilities, in Pakistan, is around 250,000 tons. This research paper is intended to evaluate the feasibility of using of hospital waste ash obtained from Pakistan Institute of Medical Sciences, Rawalpindi, Pakistan, as partial replacement of cement. The main variable in this research is the amount of hospital waste ash (2, 4, 6 and 8% by weight of cement while the amount of cementitious material, water to cementitious material ratio, fine and coarse aggregate content were kept constant. Test results substantiate that hospital waste ash can be used in concrete. XRD (X-Ray Diffraction of hospital waste ash showed that it is rich in calcite while scanning electron micrographs indicated that the particles of hospital waste ash have highly irregular shape. The slump value, density of fresh concrete and water absorption decreased with the increase in the quantity of hospital waste ash in the mix. At 3 days of testing, the compressive strength of mixes with hospital waste ash was higher than the control mix while at 7 and 28 days the CM (Control Mix showed higher strength than the hospital waste ash mixes except the mix containing 2% hospital waste ash by weight of cement.
Utilization of hospital waste ash in concrete
International Nuclear Information System (INIS)
Memon, S.; Sheikh, M.
2013-01-01
Hospital waste management is a huge problem in Pakistan. The annual production of medical waste produced from health care facilities, in Pakistan, is around 250,000 tons. This research paper is intended to evaluate the feasibility of using of hospital waste ash obtained from Pakistan Institute of Medical Sciences, Rawalpindi, Pakistan, as partial replacement of cement. The main variable in this research is the amount of hospital waste ash (2, 4, 6 and 8% by weight of cement) while the amount of cementitious material, water to cementitious material ratio, fine and coarse aggregate content were kept constant. Test results substantiate that hospital waste ash can be used in concrete. XRD (X-Ray Diffraction) of hospital waste ash showed that it is rich in calcite while scanning electron micrographs indicated that the particles of hospital waste ash have highly irregular shape. The slump value, density of fresh concrete and water absorption decreased with the increase in the quantity of hospital waste ash in the mix. At 3 days of testing, the compressive strength of mixes with hospital waste ash was higher than the control mix while at 7 and 28 days the CM (Control Mix) showed higher strength than the hospital waste ash mixes except the mix containing 2% hospital waste ash by weight of cement. (author)
International Nuclear Information System (INIS)
1991-05-01
The document focuses on high-level and transuranic waste at the DOE nuclear weapons complex. Reviews some of the critical areas and aspects of the DOE waste problem in order to provide data and further analysis of important issues. Partial contents, High-Level Waste Management at the DOE Weapons Complex, are as follows: High-Level Waste Management: Present and Planned; Amount and Distribution; Current and Potential Problems; Vitrification; Calcination; Alternative Waste Forms for the Idaho National Engineering Laboratory; Technologies for Pretreatment of High-Level Waste; Waste Minimization; Regulatory Framework; Definition of High-Level Waste; Repository Delays and Contingency Planning; Urgency of High-Level Tank Waste Treatment; Technologies for High-Level Waste Treatment; Rethinking the Waste Form and Package; Waste Form for the Idaho National Engineering Laboratory; Releases to the Atmosphere; Future of the PUREX Plant at Hanford; Waste Minimization; Tritium Production; International Cooperation; Scenarios for Future HLW Production. Partial contents of Chapter 2, Managing Transuranic Waste at the DOE Nuclear Weapons Complex, are as follows: Transuranic Waste at Department of Energy Sites; Amount and Distribution; Waste Management: Present and Planned; Current and Potential Problems; Three Technologies for Treating Retrievably Stored Transuranic Waste; In Situ Vitrification; The Applied Research, Development, Demonstration, Testing, and Evaluation Plan (RDDT ampersand E); Actinide Conversion (Transmutation); Waste Minimization; The Regulatory Framework; Definition of, and Standards for, Disposal of Transuranic Waste; Repository Delays; Alternative Storage and Disposal Strategies; Remediation of Buried Waste; The Waste Isolation Pilot Plant; Waste Minimization; Scenarios for Future Transuranic Waste Production; Conditions of No-Migration Determination
Potential application of biodrying to treat solid waste
Zaman, Badrus; Oktiawan, Wiharyanto; Hadiwidodo, Mochtar; Sutrisno, Endro; Purwono; Wardana, Irawan Wisnu
2018-02-01
The generation of solid waste around the world creates problems if not properly managed. The method of processing solid waste by burning or landfill is currently not optimal. The availability of land where the final processing (TPA) is critical, looking for a new TPA alternative will be difficult and expensive, especially in big cities. The processing of solid waste using bio drying technology has the potential to produce renewable energy and prevention of climate change. Solid waste processing products can serve as Refuse Derived Fuel (RDF), reduce water content of solid waste, meningkatkan kualitas lindi and increase the amount of recycled solid waste that is not completely separated from home. Biodrying technology is capable of enhancing the partial disintegration and hydrolysis of macromolecule organic compounds (such as C-Organic, cellulose, hemicellulose, lignin, total nitrogen). The application of biodrying has the potential to reduce greenhouse gas emissions such as carbon dioxide (CO2), methane (CH4), and dinitrooksida (N2O). These gases cause global warming.
Performance Evaluation of Concrete using Marble Mining Waste
Kore, Sudarshan Dattatraya; Vyas, A. K.
2016-12-01
A huge amount waste (approximately 60%) is generated during mining and processing in marble industries. Such waste can be best utilized in infrastructure development works. Coarse aggregate 75% by weight was replaced by aggregate obtained from marble mining waste. The impact of marble waste as a partial replacement for conventional coarse aggregate on the properties of concrete mixes such as workability, compressive strength, permeability, abrasion, etc. was evaluated. The test results revealed that the compressive strength was comparable to that of control concrete. Other properties such as workability of concrete increased, water absorption reduced by 17%, and resistance to abrasion was marginally increased by 2% as compared to that of control concrete. Ultrasonic pulse velocity and FTIR results show improvement in quality of concrete with crushed marble waste. From the TGA analysis it was confirmed that, aggregate produced from marble waste shows better performance under elevated temperature than that of conventional aggregates.
System for disposing of radioactive waste
International Nuclear Information System (INIS)
Gablin, K.A.; Hansen, L.J.
1979-01-01
A system is described for disposing of radioactive waste material from nuclear reactors by solidifying the liquid components to produce an encapsulated mass adapted for disposal by burial. The method contemplates mixing of radioactive waste materials, with or without contained solids, with a setting agent capable of solidifying the waste liquids into a free standing hardened mass, placing the resulting liquid mixture in a container with a proportionate amount of a curing agent to effect solidification under controlled conditions, and thereafter burying the container and contained solidified mixture. The setting agent is a water-extendable polymer consisting of a suspension of partially polymerized particles of urea formaldehyde in water, and the curing agent is sodium bisulfate. Methods are disclosed for dewatering slurry-like mixtures of liquid and particulate radioactive waste materials, such as spent ion exchange resin beads, and for effecting desired distribution of non-liquid radioactive materials in the central area of the container prior to solidification, so that the surrounding mass of lower specific radioactivity acts as a partial shield against higher radioactivity of the non-liquid radioactive materials. The methods also provide for addition of non-radioactive filler materials to dilute the mixture and lower the overall radioactivity of the hardened mixture to desired Lowest Specific Activity counts. An inhibiting agent is added to the liquid mixture to adjust the solidification time, and provision is made for adding additional amounts of setting agent and curing agent to take up any free water and further encapsulate the hardened material within the container. 30 claims
System for disposing of radioactive waste
International Nuclear Information System (INIS)
Gablin, K.A.; Hansen, L.J.
1977-01-01
A system is described for disposing of radioactive waste material from nuclear reactors by solidifying the liquid components to produce an encapsulated mass adapted for disposal by burial. The method contemplates mixing of radioactive waste materials, with or without contained solids, with a setting agent capable of solidifying the waste liquids into a free standing hardened mass, placing the resulting liquid mixture in a container with a proportionate amount of a curing agent to effect solidification under controlled conditions, and thereafter burying the container and contained solidified mixture. The setting agent is a water-extendable polymer consisting of a suspension of partially polymerized particles of urea formaldehyde in water, and the curing agent is sodium bisulfate. Methods are disclosed for dewatering slurry-like mixtures of liquid and particulate radioactive waste materials, such as spent ion exchange resin beads, and for effecting desired distribution of non-liquid radioactive materials in the central area of the container prior to solidification, so that the surrounding mass of lower specific radioactivity acts as a partial shield against higher radioactivity of the non-liquid radioactive materials. The methods also provide for addition of non-radioactive filler materials to dilute the mixture and lower the overall radioactivity of the hardened mixture to desired Lowest Specific Activity counts. An inhibiting agent is added to the liquid mixture to adjust the solidification time, and provision is made for adding additional amounts of setting agent and curing agent to take up any free water and further encapsulate the hardened material within the container
Radioactive waste management and regulation
International Nuclear Information System (INIS)
Willrich, M.; Lester, R.K.; Greenberg, S.C.; Mitchell, H.C.; Walker, D.A.
1977-01-01
Purpose of this book is to assist in developing public policy and institutions for the safe management of radioactive waste, currently and long term. Both high-level waste and low-level waste containing transuranium elements are covered. The following conclusions are drawn: the safe management of post-fission radioactive waste is already a present necessity and an irreversible long-term commitment; the basic goals of U.S. radioactive waste policy are unclear; the existing organization for radioactive waste management is likely to be unworkable if left unchanged; and the existing framework for radioactive waste regulation is likely to be ineffective if left unchanged. The following recommendations are made: a national Radioactive Waste Authority should be established as a federally chartered public corporation; with NRC as the primary agency, a comprehensive regulatory framework should be established to assure the safety of all radioactive waste management operations under U.S. jurisdiction or control; ERDA should continue to have primary government responsibility for R and D and demonstration of radioactive waste technology; and the U.S. government should propose that an international Radioactive Waste Commission be established under the IAEA
Contact-Handled Transuranic Waste Acceptance Criteria for the Waste Isolation Pilot Plant
Energy Technology Data Exchange (ETDEWEB)
Washington TRU Solutions LLC
2005-12-29
The purpose of this document is to summarize the waste acceptance criteria applicable to the transportation, storage, and disposal of contact-handled transuranic (CH-TRU) waste at the Waste Isolation Pilot Plant (WIPP). These criteria serve as the U.S. Department of Energy's (DOE) primary directive for ensuring that CH-TRU waste is managed and disposed of in a manner that protects human health and safety and the environment.The authorization basis of WIPP for the disposal of CH-TRU waste includes the U.S.Department of Energy National Security and Military Applications of Nuclear EnergyAuthorization Act of 1980 (reference 1) and the WIPP Land Withdrawal Act (LWA;reference 2). Included in this document are the requirements and associated criteriaimposed by these acts and the Resource Conservation and Recovery Act (RCRA,reference 3), as amended, on the CH-TRU waste destined for disposal at WIPP.|The DOE TRU waste sites must certify CH-TRU waste payload containers to thecontact-handled waste acceptance criteria (CH-WAC) identified in this document. Asshown in figure 1.0, the flow-down of applicable requirements to the CH-WAC istraceable to several higher-tier documents, including the WIPP operational safetyrequirements derived from the WIPP CH Documented Safety Analysis (CH-DSA;reference 4), the transportation requirements for CH-TRU wastes derived from theTransuranic Package Transporter-Model II (TRUPACT-II) and HalfPACT Certificates ofCompliance (references 5 and 5a), the WIPP LWA (reference 2), the WIPP HazardousWaste Facility Permit (reference 6), and the U.S. Environmental Protection Agency(EPA) Compliance Certification Decision and approval for PCB disposal (references 7,34, 35, 36, and 37). The solid arrows shown in figure 1.0 represent the flow-down of allapplicable payload container-based requirements. The two dotted arrows shown infigure 1.0 represent the flow-down of summary level requirements only; i.e., the sitesmust reference the regulatory source
Waste acceptance and waste loading for vitrified Oak Ridge tank waste
International Nuclear Information System (INIS)
Harbour, J.R.; Andrews, M.K.
1997-01-01
The Office of Science and Technology of the DOE has funded a joint project between the Oak Ridge National Laboratory (ORNL) and the Savannah River Technology Center (SRTC) to evaluate vitrification and grouting for the immobilization of sludge from ORNL tank farms. The radioactive waste is from the Gunite and Associated Tanks (GAAT), the Melton Valley Storage Tanks (MVST), the Bethel Valley Evaporator Service Tanks (BVEST), and the Old Hydrofractgure Tanks (OHF). Glass formulation development for sludge from these tanks is discussed in an accompanying article for this conference (Andrews and Workman). The sludges contain transuranic radionuclides at levels which will make the glass waste form (at reasonable waste loadings) TRU. Therefore, one of the objectives for this project was to ensure that the vitrified waste form could be disposed of at the Waste Isolation Pilot Plant (WIPP). In order to accomplish this, the waste form must meet the WIPP Waste Acceptance Criteria (WAC). An alternate pathway is to send the glass waste forms for disposal at the Nevada Test Site (NTS). A sludge waste loading in the feed of 6 wt percent will lead to a waste form which is non-TRU and could potentially be disposed of at NTS. The waste forms would then have to meet the requirements of the NTS WAC. This paper presents SRTC''s efforts at demonstrating that the glass waste form produced as a result of vitrification of ORNL sludge will meet all the criteria of the WIPP WAC or NTS WAC
Tribal Waste Management Program
The EPA’s Tribal Waste Management Program encourages environmentally sound waste management practices that promote resource conservation through recycling, recovery, reduction, clean up, and elimination of waste.
Crystal structure of AFV3-109, a highly conserved protein from crenarchaeal viruses
Directory of Open Access Journals (Sweden)
Quevillon-Cheruel Sophie
2007-01-01
Full Text Available Abstract The extraordinary morphologies of viruses infecting hyperthermophilic archaea clearly distinguish them from bacterial and eukaryotic viruses. Moreover, their genomes code for proteins that to a large extend have no related sequences in the extent databases. However, a small pool of genes is shared by overlapping subsets of these viruses, and the most conserved gene, exemplified by the ORF109 of the Acidianus Filamentous Virus 3, AFV3, is present on genomes of members of three viral familes, the Lipothrixviridae, Rudiviridae, and "Bicaudaviridae", as well as of the unclassified Sulfolobus Turreted Icosahedral Virus, STIV. We present here the crystal structure of the protein (Mr = 13.1 kD, 109 residues encoded by the AFV3 ORF 109 in two different crystal forms at 1.5 and 1.3 Å resolution. The structure of AFV3-109 is a five stranded β-sheet with loops on one side and three helices on the other. It forms a dimer adopting the shape of a cradle that encompasses the best conserved regions of the sequence. No protein with a related fold could be identified except for the ortholog from STIV1, whose structure was deposited at the Protein Data Bank. We could clearly identify a well bound glycerol inside the cradle, contacting exclusively totally conserved residues. This interaction was confirmed in solution by fluorescence titration. Although the function of AFV3-109 cannot be deduced directly from its structure, structural homology with the STIV1 protein, and the size and charge distribution of the cavity suggested it could interact with nucleic acids. Fluorescence quenching titrations also showed that AFV3-109 interacts with dsDNA. Genomic sequence analysis revealed bacterial homologs of AFV3-109 as a part of a putative previously unidentified prophage sequences in some Firmicutes.
PROGRESS & CHALLENGES IN CLEANUP OF HANFORDS TANK WASTES
Energy Technology Data Exchange (ETDEWEB)
HEWITT, W.M.; SCHEPENS, R.
2006-01-23
plan to treat these wastes as transuranic waste (TRU) for disposal at the Waste Isolation Pilot Plant (WIPP), which will reduce the WTP system processing time by three years. We are also developing and testing bulk vitrification as a technology to supplement the WTP LAW vitrification facility for immobilizing the massive volume of LAW. We will conduct a full-scale demonstration of the Demonstration Bulk Vitrification System by immobilizing up to 1,100 m{sup 3} (300,000 gallons) of tank S-109 low-curie soluble waste from which Cs-137 had previously been removed. This past year has been marked by both progress and new challenges. The focus of our tank farm work has been retrieving waste from the old single-shell tanks (SSTs). We have completed waste retrieval from three SSTs and are conducting retrieval operations on an additional three SSTs. While most waste retrievals have gone about as expected, we have faced challenges with some recalcitrant tank heel wastes that required enhanced approaches. Those enhanced approaches ranged from oxalic acid additions to deploying a remote high-pressure water lance. As with all large, long-term projects that employ first of a kind technologies, we continue to be challenged to control costs and maintain schedule. However, it is most important to work safely and to provide facilities that will do the job they are intended to do.
Low-lying level structure of the neutron-rich nucleus {sup 109}Nb: A possible oblate-shape isomer
Energy Technology Data Exchange (ETDEWEB)
Watanabe, H., E-mail: hiroshi@ribf.riken.j [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Sumikama, T. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Nishimura, S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yoshinaga, K. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Li, Z. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Miyashita, Y. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Yamaguchi, K. [Department of Physics, Osaka University, Machikaneyama-machi 1-1, Osaka 560-0043 Toyonaka (Japan); Baba, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Berryman, J.S. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Blasi, N. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Bracco, A.; Camera, F. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Dipartimento di Fisica, Universita di Milano, via Celoria 16, I-20133 Milano (Italy); Chiba, J. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Doornenbal, P. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Go, S.; Hashimoto, T.; Hayakawa, S. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan); Hinke, C. [Physik Department, Technische Universitaet Muenchen, D-85748 Garching (Germany); Ideguchi, E. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan); Isobe, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan)
2011-01-31
The neutron-rich nuclei {sup 109}Nb and {sup 109}Zr have been populated using in-flight fission of a {sup 238}U beam at 345 MeV/nucleon at the RIBF facility. A T{sub 1/2}=150(30) ns isomer at 313 keV has been identified in {sup 109}Nb for the first time. The low-lying levels in {sup 109}Nb have been also populated following the {beta}-decay of {sup 109}Zr. Based on the difference in feeding pattern between the isomeric and {beta} decays, the decay scheme from the isomeric state in {sup 109}Nb was established. The observed hindrances of the electromagnetic transitions deexciting the isomeric state are discussed in terms of possible shape coexistence. Potential energy surface calculations for single-proton configurations predict the presence of low-lying oblate-deformed states in {sup 109}Nb.
41 CFR 109-39.106 - Unlimited exemptions.
2010-07-01
..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.106 Unlimited exemptions. The Director, Office of... determination that an unlimited exemption from inclusion of a motor vehicle in a fleet management system is...
21 CFR 109.4 - Establishment of tolerances, regulatory limits, and action levels.
2010-04-01
... a food additive, may be established to define a level of contamination at which a food may be... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Establishment of tolerances, regulatory limits, and action levels. 109.4 Section 109.4 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...
Abdulmughni, Ammar; Jóźwik, Ilona K; Brill, Elisa; Hannemann, Frank; Thunnissen, Andy-Mark W H; Bernhardt, Rita
2017-11-01
Cytochrome P450 enzymes are increasingly investigated due to their potential application as biocatalysts with high regio- and/or stereo-selectivity and under mild conditions. Vitamin D 3 (VD 3 ) metabolites are of pharmaceutical importance and are applied for the treatment of VD 3 deficiency and other disorders. However, the chemical synthesis of VD 3 derivatives shows low specificity and low yields. In this study, cytochrome P450 CYP109A2 from Bacillus megaterium DSM319 was expressed, purified, and shown to oxidize VD 3 with high regio-selectivity. The in vitro conversion, using cytochrome P450 reductase (BmCPR) and ferredoxin (Fdx2) from the same strain, showed typical Michaelis-Menten reaction kinetics. A whole-cell system in B. megaterium overexpressing CYP109A2 reached 76 ± 5% conversion after 24 h and allowed to identify the main product by NMR analysis as 25-hydroxylated VD 3 . Product yield amounted to 54.9 mg·L -1 ·day -1 , rendering the established whole-cell system as a highly promising biocatalytic route for the production of this valuable metabolite. The crystal structure of substrate-free CYP109A2 was determined at 2.7 Å resolution, displaying an open conformation. Structural analysis predicts that CYP109A2 uses a highly similar set of residues for VD 3 binding as the related VD 3 hydroxylases CYP109E1 from B. megaterium and CYP107BR1 (Vdh) from Pseudonocardia autotrophica. However, the folds and sequences of the BC loops in these three P450s are highly divergent, leading to differences in the shape and apolar/polar surface distribution of their active site pockets, which may account for the observed differences in substrate specificity and the regio-selectivity of VD 3 hydroxylation. The atomic coordinates and structure factors have been deposited in the Protein Data Bank with accession code 5OFQ (substrate-free CYP109A2). Cytochrome P450 monooxygenase CYP109A2, EC 1.14.14.1, UniProt ID: D5DF88, Ferredoxin, UniProt ID: D5DFQ0, cytochrome P450