WorldWideScience

Sample records for review dec-14-2004 summary

  1. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA

  2. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS

  3. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ

  4. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  5. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE

  6. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*

  7. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN

  8. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE

  9. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)

  10. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00

  11. 289-- 14 Dec 2009 [Final Version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... tragedy in a sea of simplifications. The complex .... Different levels of communication often sharpen the discussion. ... resistance, mounting costs and rising discontent on the home front' in ... of Evangelicals in Orlando, Florida).

  12. 283---14 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... the removal of artificial, man-made barriers' (Stiglitz 2003:xviii). This definition focuses on ..... States that have signed on to the WTO face losing 'most- ..... Retrenched women clothing workers cannot find work in the regulated,.

  13. 276----14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... study of authors themselves (the literate few) and in studies of analogy and ..... power. The expectation of future vindication, even taking part in divine judgment ...... Anna Rebecca Solevåg (PhD candidate, Oslo. University ...

  14. 322--14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Attribution License. 581. Vol. 65 No. ... are at this time of global financial crisis despite the historic moment in United States and world politics that occurred .... its theory gave rise to the category of 'anti-societal language'. His.

  15. 281-- 14 Dec 2009--[ Final VERSION].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... reason is that, when it comes to motivation, there is the issue of intention and secondary intention. An example: ... this in Europe are the public health service and agriculture. ... Christians in need and should expect no reward.

  16. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f

  17. 319----14 Dec 2009.indd [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Creative Commons. Attribution License. 545 ..... this money on an alternative and apparently 'lawful' project, a burial field for foreigners .... Ultimately, however, the success or failure of the Jewish political campaign to discredit ...

  18. 320--14 dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... Original Research: Boston Papers. A ... From a macro-narrative perspective, the dynamics of Jesus' healing ... After a close reading of these textual exchanges, I suggest that each of these .... critically, this paper will focus on the four Matthean healing ... of economics and the structural dynamics of exchange.

  19. 280---14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... principles which are derived from the covenant order of communion. Ellul (in Kraus .... of a status confessionis refers to the practice of the church as well as to its teaching. .... east Asian countries (except Malaysia), the International. Monetary ... a significant rise in taxes on consumption (VAT). As a result,.

  20. 124---14 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... convinced as Danny Postel (2006:15) was three years ago, during the most .... Every forty days, the masses re-appeared to mourn, as Shi'ite. Muslims do, the ...... the modernising of Islamic countries in a European fashion.

  1. U.S. Army Deployment Injury Surveillance Summary, CY 2007 1 January 2007 - 31 December 2007

    Science.gov (United States)

    2007-12-31

    percent), football (15 percent), PT (15 percent), and weightlifting (14 percent). 8 Injury Prevention Report No. 12-HF-OAN7A-09, 1 Jan -31 Dec 07...Washington, DC 20310 SUBJECT: Injury Prevention Report No. 12-HF-OAN7A-09, US Army Deployment Injury Surveillance Summary, CY 2007. 1. We are enclosing a...copy of the subject report with an Executive Summary. The ASA(I&E) provided initial funding in 2004 for the USACHPPM to conduct deployment injury

  2. Atmospheric processes in reaction of Northern Sumatra Earthquake sequence Dec 2004-Apr 2005

    Science.gov (United States)

    Ouzounov, D.; Pulinets, S.; Cervone, G.; Singh, R.; Taylor, P.

    2005-05-01

    This work describes our first results in analyzing data from different and independent sources ûemitted long-wavelength radiation (OLR), surface latent heat flux (SHLF) and GPS Total Electron Content (TEC) collected from ground based (GPS) and satellite TIR (thermal infra-red) data sources (NOAA/AVHRR, MODIS). We found atmosphere and ionosphere anomalies one week prior to both the Sumatra-Andaman Islands earthquake (Dec 26, 2004) and M 8.7 - Northern Sumatra, March 28, 2005. We analyzed 118 days of data from December 1, 2004 through April 1, 2005 for the area (0°-10°,north latitude and 90°-100° east longitude) which included 125 earthquakes with M>5.5. Recent analysis of the continuous OLR from the Earth surface indicates anomalous variations (on top of the atmosphere) prior to a number of medium to large earthquakes. In the case of M 9.0 - Sumatra-Andaman Islands event, compared to the reference fields for the months of December between 2001 and 2004, we found strongly OLR anomalous +80 W/m2 signals (two sigma) along the epicentral area on Dec 21, 2004 five days before the event. In the case of M8.7 March 28, 2005 anomalues signatures over the epicenter appears on March 26 is much weaker (only +20W/m2) and have a different topology. Anomalous values of SHLF associated with M9.0 - Sumatra-Andaman Islands were found on Dec 22, 2005 (SLHF +280Wm2) and less intensity on Mar 23, 2005 (SLHF +180Wm2). Ionospheric variations (GPS/TEC) associated with the Northern Sumatra events were determine by five Regional GPS network stations (COCO, BAKO, NTUS, HYDE and BAST2). For every station time series of the vertical TEC (VTEC) were computed together with correlation with the Dst index. On December 22, four days prior to the M9.0 quake GPS/TEC data reach the monthly maximum for COCO with minor DST activity. For the M 8.7-March 28 event, the increased values of GPS/TEC were observed during four days (March 22-25) in quiet geomagnetic background. Our results need additional

  3. 318----14 Dec 2009.indd [ final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... in social behaviour and thinking, including those relating to cosmology ... exercise power through the global economy, as well as by means of their military and ..... local forms of Israelite religion in the face of pressures from the hierocratic .... expression 'telling' is used to refer to a probable act of Jesus (the.

  4. 14th meeting of the IFRC Subcommittee on Atomic and Molecular Data for Fusion. Summary report of IAEA technical meeting

    International Nuclear Information System (INIS)

    Clark, R.E.H.; Peacock, N.J.

    2006-01-01

    The 14th Meeting of the Subcommittee on Atomic and Molecular Data for Fusion of the International Fusion Research Council was held on 24-25 June 2004, at the IAEA Headquarters in Vienna, Austria. Subcommittee members reviewed the work of the Atomic and Molecular Data Unit over the two-year period from June 2002 to June 2004, and made recommendations that covered the 2005-2006 budget cycle. The proceedings, conclusions and recommendations of the meeting are briefly described in this report, along with a short summary of the activities of the IAEA Atomic and Molecular Data Unit of the Nuclear Data Section from June 2002 to June 2004. (author)

  5. Fragrance material review on 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one.

    Science.gov (United States)

    Scognamiglio, J; Letizia, C S; Api, A M

    2013-12-01

    A toxicologic and dermatologic review of 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one when used as a fragrance ingredient is presented. 1-Spiro[4.5]dec-7-en-7-yl-4-pent-1-one is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all published and unpublished toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one were evaluated then summarized and includes acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, phototoxicity, photoallergy, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (2013) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Summary of fuel safety research meeting 2004

    International Nuclear Information System (INIS)

    Fuketa, Toyoshi; Hidaka, Akihide; Nakamura, Jinichi; Suzuki, Motoe; Nagase, Fumihisa; Sasajima, Hideo; Fujita, Misao; Otomo, Takashi; Kudo, Tamotsu; Amaya, Masaki; Sugiyama, Tomoyuki; Ikehata, Hisashi; Iwasaki, Ryo; Ozawa, Masaaki; Kida, Mitsuko

    2004-10-01

    Fuel Safety Research Meeting 2004, which was organized by the Japan Atomic Energy Research Institute, was held on March 1-2, 2004 at Toranomon Pastoral, Tokyo. The purposes of the meeting are to present and discuss the results of experiments and analyses on reactor fuel safety and to exchange views and experiences among the participants. The technical topics of the meeting covered the status of fuel safety research activities, fuel behavior under RIA and LOCA conditions, high burnup fuel behavior, and radionuclides release under severe accident conditions. This summary contains all the abstracts and OHP sheets presented in the meeting. (author)

  7. FIXING HEALTH SYSTEMS / Executive Summary (2008 update ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-12-14

    Dec 14, 2010 ... FIXING HEALTH SYSTEMS / Executive Summary (2008 update) ... In several cases, specific approaches recommended by the TEHIP team have been acted upon regionally and internationally, including the ... Related articles ...

  8. Slovensky plynarensky priemysel. Annual report 2004

    International Nuclear Information System (INIS)

    2005-01-01

    This Annual Report contains the review of the results of the joint stock company Slovensky plynarensky priemysel (SPP - Slovak Gas Industry) in relation to the year 2004. This report contains the following headings: (1) Statement by the Chairman of the Board of Directors; (2) Statement by the General Director; (3) ProgRes SPP - Profile of Changes; (4) Organisational Chart applicable since 1-st January 2005; (5) Board of Directors; (6) Supervisory Board; (7) Executive Management; (8) Business Activities; (9) Economic and Financial Highlights; (10) Capital Structure of Financial Sources Covering Assets; (11)Natural Gas Trade; (12) Natural Gas Distribution; (13) International Transmission of Natural Gas; (14) Human Resources; (15) Equity Holdings; (16) 2004 Summary Results; (17) Auditor's Report; (18) Environmental Protection; (19) Charity, Sponsoring, SPP Foundation; (20) Selected data from consolidated international financial statements for the year ended 31 December 2004 and Independent Auditor's Report

  9. Defense Acquisition Review Journal. Volume 14, Number 3, Dec 2007

    Science.gov (United States)

    2007-12-01

    accounting for nearly half of the DoD’s total annual expenditures ( Apgar & Keane, 2004, p. 45). Equally significant has been the dramatic increase in service...for contract management responsibilities is exemplified by guidelines provided in the Army’s own doctrinal manual , noting that “there is no...Army Field Manual (FM) 3-100, 2003). Existing doctrinal guidelines for managing deployed contractors were described by one recent GAO report as

  10. Summary of the Hanford Site Environmental Report for Calendar Year 2004

    Energy Technology Data Exchange (ETDEWEB)

    Hanf, Robert W.; Morasch, Launa F.; Poston, Ted M.; Dirkes, Roger L.

    2005-09-26

    This booklet summarizes the information contained in ''Hanford Site Environmental Report for Calendar Year 2004.'' The Hanford Site environmental report, published annually since 1958, includes information and summary data that provide an overview of the activities at DOE's Hanford Site.

  11. Recent developments in monetary economics: a summary of the 2004 Workshop on Money, Banking, and Payments

    OpenAIRE

    Ed Nosal; Guillaume Rocheteau; Randall Wright

    2005-01-01

    We provide a summary and an overview of the papers presented at the Federal Reserve Bank of Cleveland’s 2004 Workshop on Money, Banking, and Payments, held during the weeks of August 3-7 and August 23-27, 2004.

  12. 2004 Annual Summary Report for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site, Nye County, Nevada

    International Nuclear Information System (INIS)

    Vefa Yucel

    2005-01-01

    The Maintenance Plan for the Performance Assessments and Composite Analyses for the Area 3 and Area 5 Radioactive Waste Management Sites at the Nevada Test Site (Bechtel Nevada, 2000) requires an annual review to assess the adequacy of the performance assessments (PAs) and composite analyses (CAs) for each of the facilities, and reports the results in an annual summary report to the U.S. Department of Energy Headquarters. The Disposal Authorization Statements for the Area 3 and Area 5 Radioactive Waste Management Sites (RWMSs) also require that such reviews be made and that secondary or minor unresolved issues be tracked and addressed as part of the maintenance plan (U.S. Department of Energy [DOE]). The U.S. Department of Energy National Nuclear Security Administration Nevada Site Office performed annual reviews in fiscal year (FY) 2004 by evaluating operational factors and research results that impact the continuing validity of the PA and CA results. This annual summary report presents data and conclusions from the FY 2004 review, and determines the adequacy of the PAs and CAs. Operational factors, such as the waste form and containers, facility design, waste receipts, closure plans, as well as monitoring results and research and development (R and D) activities were reviewed in FY 2004 for the determination of the adequacy of the PAs. Likewise, the environmental restoration activities at the Nevada Test Site relevant to the sources of residual radioactive material that are considered in the CAs, the land-use planning, and the results of the environmental monitoring and R and D activities were reviewed for the determination of the adequacy of the CAs

  13. 167-- 8 Dec 2009.indd [FINAL VESION].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... canonical scriptures – in the reformed tradition – and were therefore deemed unworthy of dogma and proclamation (Kaiser 2004:6). They could be used for teaching – as the Belgic Confession states – but this rarely, if at all, happened in a reformed congregation. However, a few factors have contributed to a ...

  14. Networking DEC and IBM computers

    Science.gov (United States)

    Mish, W. H.

    1983-01-01

    Local Area Networking of DEC and IBM computers within the structure of the ISO-OSI Seven Layer Reference Model at a raw signaling speed of 1 Mops or greater are discussed. After an introduction to the ISO-OSI Reference Model nd the IEEE-802 Draft Standard for Local Area Networks (LANs), there follows a detailed discussion and comparison of the products available from a variety of manufactures to perform this networking task. A summary of these products is presented in a table.

  15. A Systematic Summary of Systematic Reviews on the Topic of the Anterior Cruciate Ligament

    Science.gov (United States)

    Anderson, Michael J.; Browning, William M.; Urband, Christopher E.; Kluczynski, Melissa A.; Bisson, Leslie J.

    2016-01-01

    Background: There has been a substantial increase in the amount of systematic reviews and meta-analyses published on the anterior cruciate ligament (ACL). Purpose: To quantify the number of systematic reviews and meta-analyses published on the ACL in the past decade and to provide an overall summary of this literature. Study Design: Systematic review; Level of evidence, 4. Methods: A systematic review of all ACL-related systematic reviews and meta-analyses published between January 2004 and September 2014 was performed using PubMed, MEDLINE, and the Cochrane Database. Narrative reviews and non-English articles were excluded. Results: A total of 1031 articles were found, of which 240 met the inclusion criteria. Included articles were summarized and divided into 17 topics: anatomy, epidemiology, prevention, associated injuries, diagnosis, operative versus nonoperative management, graft choice, surgical technique, fixation methods, computer-assisted surgery, platelet-rich plasma, rehabilitation, return to play, outcomes assessment, arthritis, complications, and miscellaneous. Conclusion: A summary of systematic reviews on the ACL can supply the surgeon with a single source for the most up-to-date synthesis of the literature. PMID:27047983

  16. OVERVIEW OF ADVANCED PETROLEUM-BASED FUELS-DIESEL EMISSIONS CONTROL PROGRAM (APBF-DEC)

    Energy Technology Data Exchange (ETDEWEB)

    Sverdrup, George M.

    2000-08-20

    The Advanced Petroleum-Based Fuels-Diesel Emissions Control Program (APBF-DEC) began in February 2000 and is supported by government agencies and industry. The purpose of the APBF-DEC program is to identify and evaluate the optimal combinations of fuels, lubricants, diesel engines, and emission control systems to meet the projected emission standards for the 2000 to 2010 time period. APBF-DEC is an outgrowth of the earlier Diesel Emission Control-Sulfur Effects Program (DECSE), whose objective is to determine the impact of the sulfur levels in fuel on emission control systems that could lower the emissions of NOx and particulate matter (PM) from diesel powered vehicles in the 2002 to 2004 period. Results from the DECSE studies of two emission control technologies-diesel particle filter (DPF) and NOx adsorber-will be used in the APBF-DEC program. These data are expected to provide initial information on emission control technology options and the effects of fuel properties (including additives) on the performance of emission control systems.

  17. Book Review

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Book Review. World Health Organization 2003. Price Not Available. ISBN 9241545755. This is a paperback book updating three earlier WHO publications namely: • General Surgery at the District Hospital,. • Surgery at the District Hospital,. • Obstetric/Gynecology, Orthopedics/Traumatology, and Anesthesia ...

  18. Independent review of the SaskPower rate proposal of August 2004 : final report

    International Nuclear Information System (INIS)

    Ewing, J.D.; Buhr, L.A.

    2004-01-01

    This paper presents an independent review of SaskPower's request for an increase in rates effective September 1, 2004 and September 1, 2005. With the exception of manufacturing customers, whose rate increase will be phased in over four years, these rate changes will result in a 9 per cent system average increase in 2004 and a 1.8 per cent system average increase in 2005. The report presents an introduction and description of the terms of reference for this review; a financial outlook and comparisons; system operational analysis; an analysis of expenditures; revenue requirement; cost of service issues; and rate design. The report also presents a summary and recommendations on cost of service and rate design issues. The report concluded that the scope of this review does not lend itself to a definitive conclusion on the appropriateness of the cost of service model and its application by SaskPower. Several areas needing further attention include: net fuel and purchased power allocations to different classes; allocation of rate base and in particular distribution rate base to various classes; target ratios for revenue to revenue requirements and the subsequent return on rate base percentages for each class; and demand/energy/customer components of revenue requirements compared to billing revenues. refs., 31 tabs., 1 fig., 6 appendices

  19. 76 FR 36534 - Toxicological Review of Methanol (Non-Cancer): In Support of Summary Information on the...

    Science.gov (United States)

    2011-06-22

    ... Review of Methanol (Non-Cancer): In Support of Summary Information on the Integrated Risk Information... review draft human health assessment titled ``Toxicological Review of Methanol (Non- Cancer): In Support... Toxicological Review of Methanol (Non-Cancer) and announcing a 14-day public comment period for the addendum...

  20. Manitoba 2004 oil activity review

    International Nuclear Information System (INIS)

    Fox, J.N.

    2005-01-01

    This paper presented data on oil and gas activities in Manitoba during 2004, the busiest year in Manitoba's oil patch since the mid 1980s. Increases in the leasing of Crown and freehold acreage were also noted, with accompanying increases in drilling activity for the latter part of 2004. Details of Crown land sales were presented, with a total of 43,725 hectares of crown oil and gas rights under lease. During 2004, over 15,000 hectares of Crown oil and gas leases were sold, the highest figures since 1997. More wells were licensed and drilled in 2004 than in any year since 1986. Overall drilling success rate was 96.7 per cent. Details of top drillers in Manitoba were presented, with drilling activity focused in Waskada and Daly fields and the Sinclair area. Oil production increased by 0.7 per cent, with 1474 wells in production. Daily oil production statistics were presented, with the total value of Manitoba's oil production being $196 million. Details of the top 5 producers were provided, in addition to details of horizontal well production. Recent developments in Sinclair Field, Pierson L. Amaranth MC 3b A Pool, Waskada L. Amaranth I Pool and Virden Lodgepole D Pool were reviewed. The Manitoba Drilling Incentive Program was discussed with reference to the following enhancements: new well incentives, horizontal well incentives; holiday oil volume accounts; and marginal well major workover programs. Various Oil and Gas Act amendments were reviewed. In addition, the Williston Basin Architecture and Hydrocarbon Potential Project was discussed. 3 figs

  1. December 2004 EAST AFRICAN MEDICAL JOURNAL 641

    African Journals Online (AJOL)

    2004-12-01

    Dec 1, 2004 ... GENDER AND WILLINGNESS TO PAY FOR INSECTICIDES TREATED BED NETS IN A POOR RURAL AREA IN .... the same taste for prevention of mosquito bites and ..... Studies have found' that the systematic income gap.

  2. Summary 14 leadership principles behind the world's most disruptive company

    CERN Document Server

    2015-01-01

    Complete summary of John Rossman's book: ""The Amazon Way: 14 Leadership Principles Behind the World's Most Disruptive Company""This summary of ideas from John Rossman's book ""The Amazon Way: 14 Leadership Principles Behind the World's Most Disruptive Company"" reveals the leadership 'secrets' behind one of the biggest companies in the world. These 'secrets' are applied to all decision-making processes in the business and are used every day.There are 14 principles of leadership:1. Obsess over the customer2. Take ownership of results3. Invent and simplify4. Leaders are right - A lot5. Hire an

  3. LLE Review 101 (October-December 2004)

    Energy Technology Data Exchange (ETDEWEB)

    Shmayda, W. T. [editor

    2005-03-01

    This volume of the LLE Review, covering October to December 2004, highlights the significance of shaped adiabats to inertial confinement fusion. Theory suggests that inertial confinement fusion (ICF) capsules compressed by shaped adiabats will exhibit improved hydrodynamic stability.

  4. December 2004 - 38 War Wounds with Fractures

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... War Wounds With Fractures: The ICRC Experience. East and Central ... limbs, the remaining 30% have central wounds involving head, chest or abdomen. The longer .... holding, especially for the lower limb. It can be used for ...

  5. Program and Abstracts: DOE Solar Program Review Meeting 2004, 25--28 October 2004, Denver, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    2004-10-01

    This booklet contains the agenda and abstracts for the 2004 U.S. DOE Solar Energy Technologies Program Review Meeting. The meeting was held in Denver, Colorado, October 25-28, 2004. More than 240 abstracts are contained in this publication. Topic areas for the research papers include laboratory research, program management, policy analysis, and deployment of solar technologies.

  6. DOE Hydrogen Program 2004 Annual Merit Review and Peer Evaluation Report

    Energy Technology Data Exchange (ETDEWEB)

    2004-10-01

    This document summarizes the project evaluations and comments from the DOE Hydrogen Program 2004 Annual Program Review. Hydrogen production, delivery and storage; fuel cells; technology validation; safety, codes and standards; and education R&D projects funded by DOE in FY2004 are reviewed.

  7. Estimation of Correlation Functions by the Random DEC Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Krenk, Steen; Jensen, Jakob Laigaard

    The Random Dec Technique is a versatile technique for characterization of random signals in the time domain. In this paper a short review of the most important properties of the technique is given. The review is mainly based on recently achieved results that are still unpublished, or that has just...

  8. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... East zone of Nigeria was examined through a descriptive survey. ... Variables and Utilization (QOLBUVAU) making a return rate of 86.6%. ... sampling technique was adopted as the respondents vary in size ... the structure and location of the library in ... the reviewed literature in this study. ..... The decision.

  9. Nevada Test Site Environmental Report 2004

    International Nuclear Information System (INIS)

    BECHTEL NEVADA

    2005-01-01

    The ''Nevada Test Site Environmental Report 2004'' was prepared by Bechtel Nevada (BN) to meet the information needs of the public and the requirements and guidelines of the U.S. Department of Energy (DOE) for annual site environmental reports. This Executive Summary presents the purpose of the document, the major programs conducted at the Nevada Test Site (NTS), NTS key environmental initiatives, radiological releases and potential doses to the public resulting from site operations, a summary of non-radiological releases, implementation status of the NTS Environmental Management System, and significant environmental accomplishments. Much of the content of this Executive Summary is also presented in a separate stand-alone pamphlet titled ''Nevada Test Site Environmental Report Summary 2004''. It was produced this year to provide a more cost-effective and wider distribution of a hardcopy summary of the ''Nevada Test Site Environmental Report 2004'' to interested DOE stakeholders

  10. Retention in methadone maintenance treatment in mainland China, 2004-2012: a literature review.

    Science.gov (United States)

    Zhou, Kaina; Zhuang, Guihua

    2014-01-01

    Methadone maintenance treatment (MMT) was implemented in mainland China since 2004. Numerous individual studies have investigated MMT retention but the overview still remains unclear. The aim of the study was to review MMT retention rates and predicting factors in mainland China during 2004-2012. Chinese and English databases of literature were searched for studies reporting on retention rates and predicting factors in non-transfer MMT patients of fixed-site clinics in mainland China (2004-2012). Qualitative methods were used to synthesize the results. Nineteen studies were eligible for review, with sample size ranging from 29 to 3758. Retention rates varied between 30.0% at 6 months in Shanghai and 70.3% at 12 months in Xi'an. Predicting factors were non-treatment including sociodemographics (n=14), support system and social function (n=9), economic status (n=2) and psychological status (n=1), and treatment-related including drug use (n=15), methadone use (n=12), MMT clinics (n=9), MMT participation (n=7), awareness on MMT (n=5) and HIV serostatus (n=3). Methadone dose (n=12) and age (n=7) were the first two important specific factors. In mainland China, MMT retention rates are heterogeneous and relatively lower, and predicting factors mainly focus on objective aspects. Future work should further explore subjective predicting factors regarding MMT retention. © 2013.

  11. Nevada Test Site Environmental Report 2004

    Energy Technology Data Exchange (ETDEWEB)

    BECHTEL NEVADA

    2005-10-01

    The ''Nevada Test Site Environmental Report 2004'' was prepared by Bechtel Nevada (BN) to meet the information needs of the public and the requirements and guidelines of the U.S. Department of Energy (DOE) for annual site environmental reports. This Executive Summary presents the purpose of the document, the major programs conducted at the Nevada Test Site (NTS), NTS key environmental initiatives, radiological releases and potential doses to the public resulting from site operations, a summary of non-radiological releases, implementation status of the NTS Environmental Management System, and significant environmental accomplishments. Much of the content of this Executive Summary is also presented in a separate stand-alone pamphlet titled ''Nevada Test Site Environmental Report Summary 2004''. It was produced this year to provide a more cost-effective and wider distribution of a hardcopy summary of the ''Nevada Test Site Environmental Report 2004'' to interested DOE stakeholders.

  12. Do evidence summaries increase policy-makers' use of evidence from systematic reviews: A systematic review protocol.

    Science.gov (United States)

    Petkovic, Jennifer; Welch, Vivian; Tugwell, Peter

    2015-09-28

    Systematic reviews are important for decision-makers. They offer many potential benefits but are often written in technical language, are too long, and do not contain contextual details which makes them hard to use for decision-making. There are many organizations that develop and disseminate derivative products, such as evidence summaries, from systematic reviews for different populations or subsets of decision-makers. This systematic review will assess the effectiveness of systematic review summaries on increasing policymakers' use of systematic review evidence and to identify the components or features of these summaries that are most effective. We will include studies of policy-makers at all levels as well as health-system managers. We will include studies examining any type of "evidence summary," "policy brief," or other products derived from systematic reviews that present evidence in a summarized form. The primary outcomes are the following: (1) use of systematic review summaries decision-making (e.g., self-reported use of the evidence in policy-making, decision-making) and (2) policy-maker understanding, knowledge, and/or beliefs (e.g., changes in knowledge scores about the topic included in the summary). We will conduct a systematic review of randomized controlled trials (RCTs), non-randomized controlled trials (NRCTs), controlled before-after studies (CBA), and interrupted time series (ITS) studies. The results of this review will inform the development of future systematic review summaries to ensure that systematic review evidence is accessible to and used by policy-makers making health-related decisions.

  13. December 2004 Aspergillus of the Lung with Haemoptysis

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... invasion of a a tuberculous cavity and 2. allergic bronchopulmonary aspergilosis. The aim study was to evaluate the outcome of surgical management in patients with Aspergillomas of the lung with recurrent and severe Haemoptysis. Methods: Eight patients were treated surgically for Aspergillomas of the ...

  14. A LITERATURE REVIEW ON SICK LEAVE DETERMINANTS (1984-2004)

    NARCIS (Netherlands)

    Beemsterboer, Willibrord; Stewart, Roy; Groothoff, Johan; Nijhuis, Frans

    2009-01-01

    Objectives: A literature review for the years 1984-2004 was performed to identify the determinants of the sick leave frequency and duration over that period and to establish the continuity in the character of those determinants. Materials and Methods: The review referred to national and

  15. Proceedings of the International Workshop on Nanomaterials, Magnetic Ions and Magnetic Semiconductors Studied Mostly by Hyperfine Interactions (IWNMS 2004) held in Baroda, India, 10–14 February 2004

    CERN Document Server

    Somayajulu, D. R. S; IWNMS 2004

    2005-01-01

    Proceedings of the Baroda Workshop IWNMS 2004, held in Baroda, India, 10-14 February, 2004 Researchers and graduate students interested in the Mössbauer Effect and its applications will find this volume indispensable. The volume presents the most recent developments in the methodology of Mössbauer spectroscopy. Reprinted from Hyperfine Interactions (HYPE) Volume 160, 1-4

  16. TransCanada Corporation 2004 annual report

    International Nuclear Information System (INIS)

    2005-01-01

    TransCanada is a leading North American energy company dealing with natural gas transmission, power generation and marketing opportunities. Financial information from TransCanada was presented in this annual report along with a review of its operations in 2004 and a summary of how the company performed in terms of providing natural gas transmission and power services in North America. In 2004, TransCanada increased earnings from continuing operations and maintained a strong cash flow and continued to strengthen its balance sheet. Achievements in 2004 included the acquisition of the Gas Transmission Northwest Pipeline System and the North Baja Pipeline System; the purchase of hydroelectric generation assets in New England with a total generating capacity of more than 500 MW; and the completed construction of two new gas-fired cogeneration plants, the 165 MW MacKay River facility in Alberta and the 90 MW Grandview facility in New Brunswick. The challenges in 2004 included the performance of the company's existing asset-based businesses and the new initiatives to produce another year of solid operating and financial results. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements and common share information. This included the utility's assets, liabilities, revenues, expenses and cash flows. Revenue and expenditure statements were summarized by source. tabs., figs

  17. December 2004 45 Bronchial Asthma, Allergic Rhinitis and chole

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Background: Gallbladder has not been associated with any allergic condition what so ever. However, certain patients with bronchial asthma and cholelithiasis have reported to the author improvement in their asthmatic attack after cholecystectomy. Methods: This was an observational study on 22 bronchial ...

  18. December2004 Results of Triple Arthrodesis in Uganda.

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Background: In Uganda, foot deformities of various kinds and complexities are common. The aim of this study was to evaluate ... Conclusion: In the developing world triple arthrodesis still has a role to play in treatment of feet deformities. The results ... on flat ground, high stepping gait, moderate deformity ...

  19. 75 FR 6413 - Office of New Reactors; Proposed Revision to Standard Review Plan, Section 14.3.12 on Physical...

    Science.gov (United States)

    2010-02-09

    ... Standard Review Plan, Section 14.3.12 on Physical Security Hardware Inspections, Tests, Analyses, and.... SUMMARY: The NRC is soliciting public comment on NUREG-0800, ``Standard Review Plan for the Review of Safety Analysis Reports for Nuclear Power Plants,'' on a proposed Revision 1 to Standard Review Plan (SRP...

  20. Nexen 2004 annual report

    International Nuclear Information System (INIS)

    2005-01-01

    This report contains financial information from Nexen Inc., a Calgary-based global energy and chemicals company. A review of strategies and operations was also provided, including details of new exploration and plans for growth development in Canada and internationally. Growth regions included the Athabasca oil sands; Gulf of Mexico, Middle East, offshore West Africa and the North Sea. Nexen share prices at the end of the fourth quarter rested at $58.35, up from $47.03 in 2003. Quarterly dividends increased to $0.10 per share. Net sales for 2004 were $3,176 million compared to $2,844 million in 2003. Cash flow increased 8 per cent from 2003 to $1.9 billion. The report lists major achievements of 2004. Among the achievements were the acquisition of assets in the UK North Sea and the development of the Long Lake Project. New investments in 2004 included $69 million in Offshore West Africa, $175 million in Canada with $148 million in maturing Canadian core assets. Legal proceedings pending against the company were provided. This annual report includes an auditor's report of the company's energy resource activities. An operations review was also presented along with consolidated financial statements, a summarized balance sheet of assets, liabilities/surplus and net assets, and common share information. Revenue and expenditure statements were summarized by source. A summary of government and environmental regulations affecting business was also provided. tabs., figs

  1. DEC Home

    Science.gov (United States)

    , improving, and protecting Alaska's natural resources and environment to enhance the health, safety, economic , Assessment and Restoration Environmental Health Drinking Water Food Safety & Sanitation Laboratory Environmental Conservation Alaska Department of Environmental Conservation Search DEC State of Alaska Conserving

  2. Market review: Market values summary July market review/current market data

    International Nuclear Information System (INIS)

    Anon.

    1996-01-01

    A summary of financial data for the uranium spot market is provided. Recent transactions are tabulated, including uranium sales, natural uranium loans, conversion sales, and enrichment sales. A market values summary and long-term price indicators are also provided. The July 1996 market review data includes summaries of near-term uranium sales, near-term supply/demand, NUEXCO values, USEC prices, and calculated worth of enriched uranium. Active projects in uranium, conversion, and separative work supply and demand are listed. International market values are tabulated for 22 selected currencies

  3. 14 CFR 14.28 - Review by FAA decisionmaker.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Review by FAA decisionmaker. 14.28 Section... § 14.28 Review by FAA decisionmaker. (a) In proceedings other than those under part 17 of this chapter and the AMS, either the applicant or the FAA counsel may seek review of the initial decision on the...

  4. Occupational skin cancer: Systematic review

    Directory of Open Access Journals (Sweden)

    Jéssica Suellen Sena

    2016-06-01

    Full Text Available SUMMARY Objective: To analyze the epidemiological profile, risk factors in the workplace environment and prevention methods for professionals at risk of skin cancer. Method: A systematic review of articles on occupational skin cancer, published in the Lilacs, Scielo, Medline and Cochrane Library from January 1st, 2008, to December 31st, 2013, was performed. The search included the following terms: “neoplasias cutâneas” (DeCS, “exposição ocupacional” (DeCS, “epidemiologia” (DeCS as well as the keyword “prevenção”, and their equivalents in English. Results: After analyzing the titles and summaries of articles, the search strategy resulted in 83 references, of which 22 articles met the eligibility criteria. Discussion: We found that sun exposure is the main occupational risk factor for skin cancer, causing outdoor workers to be the most vulnerable to developing occupational skin cancer. Professionals with low levels of education and European descent are at increased risk of developing this cancer. Conclusion: Outdoor workers are more vulnerable to developing occupational skin cancer, estimating that professionals with low level of education and European descent are at increased risk of developing this cancer. Therefore, companies need to invest more in the health of workers by providing protective equipment and thus preventing occupational skin cancer.

  5. National hospital discharge survey: 2004 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    Kozak, Lola Jean; DeFrances, Carol Jean; Hall, Margaret Jean

    2006-10-01

    This report presents 2004 national estimates and selected trend data on the use of nonfederal short-stay hospitals in the United States. Estimates are provided by selected patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Estimates of diagnoses and procedures are presented according to International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9-CM) codes. The estimates are based on data collected through the National Hospital Discharge Survey (NHDS). The survey has been conducted annually since 1965. In 2004, data were collected for approximately 371,000 discharges. Of the 476 eligible nonfederal short-stay hospitals in the sample, 439 (92 percent) responded to the survey. An estimated 34.9 million inpatients were discharged from nonfederal short-stay hospitals in 2004. They used 167.9 million days of care and had an average length of stay of 4.8 days. Hospital use by age ranged from 4.3 million days of care for patients 5-14 years of age to 31.8 million days of care for 75-84 year olds. Almost a third of patients 85 years and over were discharged from hospitals to long-term care institutions. Diseases of the circulatory system was the leading diagnostic category for males. Childbirth was the leading category for females, followed by circulatory diseases. The proportion of HIV discharges who were 40 years of age and over increased from 40 percent in 1995 to 67 percent in 2004. The rate of cardiac catheterizations was higher for males than for females and higher for patients 65-74 and 75-84 years of age than for older or younger groups. The average length of stay for both vaginal and cesarean deliveries decreased from 1980 through 1995 but stays for vaginal deliveries increased 24 percent during the period from 1995 to 2004.

  6. Dec-POMDPs as Non-Observable MDPs

    NARCIS (Netherlands)

    Oliehoek, F.A.; Amato, C.

    2014-01-01

    A recent insight in the field of decentralized partially observable Markov decision processes (Dec-POMDPs) is that it is possible to convert a Dec-POMDP to a non-observable MDP, which is a special case of POMDP. This technical report provides an overview of this reduction and pointers to related

  7. Book review: Three great tsunamis: Lisbon (1755), Sumatra-Andaman (2004), and Japan (2011)

    Science.gov (United States)

    Geist, Eric L.

    2014-01-01

    “Three Great Tsunamis: Lisbon (1755), Sumatra–Andaman (2004), and Japan (2011)” is published in Springer’s new series SpringerBriefs. According to Springer’s website, the SpringBriefs volumes are intended to provide “concise summaries of cutting-edge research and practical applications across a wide spectrum of fields”. Among the several categories considered for SpringerBriefs are in-depth case studies, for which this volume is most closely aligned.

  8. DEC VT220

    CERN Multimedia

    1983-01-01

    The DEC (Digital Equipment Corporation) VT220 is a text terminal which uses an redesigned keyboard(LK201). The VT220 improved on the earlier VT100 series of terminals with much smaller physical packaging and and a much faster microprocessor.

  9. Total 2004 results

    International Nuclear Information System (INIS)

    2005-02-01

    This document presents the 2004 results of Total Group: consolidated account, special items, number of shares, market environment, adjustment for amortization of Sanofi-Aventis merger-related intangibles, 4. quarter 2004 results (operating and net incomes, cash flow), upstream (results, production, reserves, recent highlights), downstream (results, refinery throughput, recent highlights), chemicals (results, recent highlights), Total's full year 2004 results (operating and net income, cash flow), 2005 sensitivities, Total SA parent company accounts and proposed dividend, adoption of IFRS accounting, summary and outlook, main operating information by segment for the 4. quarter and full year 2004: upstream (combined liquids and gas production by region, liquids production by region, gas production by region), downstream (refined product sales by region, chemicals), Total financial statements: consolidated statement of income, consolidated balance sheet (assets, liabilities and shareholder's equity), consolidated statements of cash flows, business segments information. (J.S.)

  10. 78 FR 26029 - Toxicological Review of Methanol (Non-Cancer): In Support of Summary Information on the...

    Science.gov (United States)

    2013-05-03

    ... Review of Methanol (Non-Cancer): In Support of Summary Information on the Integrated Risk Information... and peer review on the draft non-cancer toxicological review of methanol. SUMMARY: EPA is announcing a... Review of Methanol (Non-Cancer): In Support of Summary Information on the Integrated Risk Information...

  11. 15 CFR 752.14 - System reviews.

    Science.gov (United States)

    2010-01-01

    ...) Other reviews. BIS may require an SCL holder or consignee to submit to its office a list of all sales... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false System reviews. 752.14 Section 752.14... LICENSE § 752.14 System reviews. (a) Post-license system reviews. BIS may conduct system reviews of the...

  12. Total 2004 results

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-02-01

    This document presents the 2004 results of Total Group: consolidated account, special items, number of shares, market environment, adjustment for amortization of Sanofi-Aventis merger-related intangibles, 4. quarter 2004 results (operating and net incomes, cash flow), upstream (results, production, reserves, recent highlights), downstream (results, refinery throughput, recent highlights), chemicals (results, recent highlights), Total's full year 2004 results (operating and net income, cash flow), 2005 sensitivities, Total SA parent company accounts and proposed dividend, adoption of IFRS accounting, summary and outlook, main operating information by segment for the 4. quarter and full year 2004: upstream (combined liquids and gas production by region, liquids production by region, gas production by region), downstream (refined product sales by region, chemicals), Total financial statements: consolidated statement of income, consolidated balance sheet (assets, liabilities and shareholder's equity), consolidated statements of cash flows, business segments information. (J.S.)

  13. Annual report and balance 2004; Memoria y balance 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    A summary of the research, development, services and production activities of the National Atomic Energy Commission (CNEA) of Argentina is given as well as details of management resources together with the evolution of the budget. The activities of the CNEA related companies during 2004 are also outlined. A special mention is made of the activities of the three CNEA educational and training institutes.

  14. Energy Technology Division research summary 2004

    International Nuclear Information System (INIS)

    Poeppel, R. B.; Shack, W. J.

    2004-01-01

    The Energy Technology (ET) Division provides materials and engineering technology support to a wide range of programs important to the US Department of Energy (DOE). The Division's capabilities are generally applied to technical issues associated with energy systems, biomedical engineering, transportation, and homeland security. Research related to the operational safety of commercial light water nuclear reactors (LWRs) for the US Nuclear Regulatory Commission (NRC) remains another significant area of interest for the Division. The pie chart below summarizes the ET sources of funding for FY 2004

  15. Global review of health care surveys using lot quality assurance sampling (LQAS), 1984-2004.

    Science.gov (United States)

    Robertson, Susan E; Valadez, Joseph J

    2006-09-01

    We conducted a global review on the use of lot quality assurance sampling (LQAS) to assess health care services, health behaviors, and disease burden. Publications and reports on LQAS surveys were sought from Medline and five other electronic databases; the World Health Organization; the World Bank; governments, nongovernmental organizations, and individual scientists. We identified a total of 805 LQAS surveys conducted by different management groups during January 1984 through December 2004. There was a striking increase in the annual number of LQAS surveys conducted in 2000-2004 (128/year) compared with 1984-1999 (10/year). Surveys were conducted in 55 countries, and in 12 of these countries there were 10 or more LQAS surveys. Geographically, 317 surveys (39.4%) were conducted in Africa, 197 (28.5%) in the Americas, 115 (14.3%) in the Eastern Mediterranean, 114 (14.2%) in South-East Asia, 48 (6.0%) in Europe, and 14 (1.8%) in the Western Pacific. Health care parameters varied, and some surveys assessed more than one parameter. There were 320 surveys about risk factors for HIV/AIDS/sexually transmitted infections; 266 surveys on immunization coverage, 240 surveys post-disasters, 224 surveys on women's health, 142 surveys on growth and nutrition, 136 surveys on diarrheal disease control, and 88 surveys on quality management. LQAS surveys to assess disease burden included 23 neonatal tetanus mortality surveys and 12 surveys on other diseases. LQAS is a practical field method which increasingly is being applied in assessment of preventive and curative health services, and may offer new research opportunities to social scientists. When LQAS data are collected recurrently at multiple time points, they can be used to measure the spatial variation in behavior change. Such data provide insight into understanding relationships between various investments in social, human, and physical capital, and into the effectiveness of different public health strategies in achieving

  16. Rhythmic expression of DEC2 protein in vitro and in vivo.

    Science.gov (United States)

    Sato, Fuyuki; Muragaki, Yasuteru; Kawamoto, Takeshi; Fujimoto, Katsumi; Kato, Yukio; Zhang, Yanping

    2016-06-01

    Basic helix-loop-helix (bHLH) transcription factor DEC2 (bHLHE41/Sharp1) is one of the clock genes that show a circadian rhythm in various tissues. DEC2 regulates differentiation, sleep length, tumor cell invasion and apoptosis. Although studies have been conducted on the rhythmic expression of DEC2 mRNA in various tissues, the precise molecular mechanism of DEC2 expression is poorly understood. In the present study, we examined whether DEC2 protein had a rhythmic expression. Western blot analysis for DEC2 protein revealed a rhythmic expression in mouse liver, lung and muscle and in MCF-7 and U2OS cells. In addition, AMP-activated protein kinase (AMPK) activity (phosphorylation of AMPK) in mouse embryonic fibroblasts (MEFs) exhibited a rhythmic expression under the condition of medium change or glucose-depleted medium. However, the rhythmic expression of DEC2 in MEF gradually decreased in time under these conditions. The medium change affected the levels of DEC2 protein and phosphorylation of AMPK. In addition, the levels of DEC2 protein showed a rhythmic expression in vivo and in MCF-7 and U2OS cells. The results showed that the phosphorylation of AMPK immunoreactivity was strongly detected in the liver and lung of DEC2 knockout mice compared with that of wild-type mice. These results may provide new insights into rhythmic expression and the regulation between DEC2 protein and AMPK activity.

  17. Forum Engelberg, 1-4 March 2004

    CERN Document Server

    2004-01-01

    The 2004 Forum Engelberg will pay tribute to its President, Hubert Curien, a former President of the CERN Council and former French Minister for Research. The subject of this year's conference, which will take place in Lucerne from 1st to 4th March 2004, is "Science on the Agenda of European Politics." This year, there will be talks by numerous speakers, including the directors of the seven European intergovernmental scientific organisations (EIROforum) and the European Commissioner for Research, Philippe Busquin. The highlights of the conference will include an Interdisciplinary Scientific Programme on 2nd and 3rd March, a session on e-science and the Grid on 4th March and a Young Scientists Programme. The programme and registration forms are available at http://www.forum-engelberg.org/

  18. Outline of geophysical investigations on the great earthquake in the south-west Japan on Dec. 21, 1946

    Science.gov (United States)

    Nagata, Takeshi

    1947-01-01

    In in the early morning of Dec. 21, 1946, a great destructive earthquake occurred in southern-western Japan. According to the seismogram obtained in our university, the earthquake motion began at Tokyo from 4 h 20 m 10.4 s on Dec. 21, 1946. The maximum amplitude of NS, EW, and up-down components of the earthquake motion at Tokyo was 12.0 mm, 14.0 mm and 3.0 mm respectively, while the initial motion was composed of 80 μ south, 67 μ west and 20 μ down movements.

  19. Efficacy and tolerability of treatment with single doses of diethylcarbamazine (DEC) and DEC plus albendazole (ABZ) for three consecutive years in lymphatic filariasis: a field study in India.

    Science.gov (United States)

    Kshirsagar, Nilima A; Gogtay, N J; Garg, B S; Deshmukh, P R; Rajgor, D D; Kadam, V S; Thakur, P A; Gupta, A; Ingole, N S; Lazdins-Helds, J K

    2017-10-01

    Lymphatic filariasis (LF) affects 73 countries, causes morbidity and impedes socioeconomic development. We had found no difference in safety and micro (Mf) and macro filarial action of single-dose diethylcarbamazine (DEC) and DEC + albendazole (ABZ) in an F01 study done in India (year 2000). There was a programmatic need to evaluate safety and efficacy of multiple annual treatments (F02). Subjects (155) from the F01 study, meeting inclusion-exclusion criteria, were enrolled in F02 and treated with further two annual doses of DEC or DEC + ABZ. Efficacy was evaluated for Mf positivity by peripheral smear (PS) and nucleopore (NP) filter, circulating filarial antigen (CFA) and filarial dance sign (FDS) positivity and Mf count at yearly follow-up. Safety was assessed for 5 days after drug administration. Total of 139 subjects evaluated for efficacy (69 DEC and 70 DEC + ABZ group). Mf positivity prevalence declined progressively by 95% (PS), 66% (NP), and 95% (PS) and 86% (NP); CFA positivity prevalence declined by 15% and 9%; FDS by 100% each; Mf count declined by 75.5 and 76.9% with three annual treatment of DEC and DEC + ABZ, respectively. Addition of ABZ did not show any advantage over DEC given as three annual rounds for LF. DEC and DEC + ABZ were well tolerated. There was no correlation between result of CFA and FDS, (both claimed to be indicative of adult worm). Analysis of published studies and our data indicate that macrofilaricidal effect of DEC/DEC + ABZ may be seen in children and not adults, with three or more annual dosing.

  20. Executive Summary - Overview

    International Nuclear Information System (INIS)

    2005-01-01

    Professor Andrzej Budzanowski was Director of IFJ in the years 1990-2004. On September 1st 2004, on IFJ joining the Polish Academy of Sciences, Professor Marek Jezabek has been nominated by the President of PAN as the Director of IFJ, for a 4-year term. Our Institute, with a personnel of 450 (182 research staff) and over 50 Ph.D. students, is presently one of the largest institutes of the Polish Academy of Sciences and one of the largest research institutes in Poland. The scientific staff consists on 120 post-doctoral researchers, 26 Associated Professors and 36 State-Nominated Professors. The total budget of the Institute for the year 2004 was about 56 million Euro. The IFJ is financed mainly from the state budget of the Ministry of Scientific Research and Information Technology. In 2004 this financing was about 4 million Euro, constituting 72% of the Institute's total budget. The remaining part of our 2004 budget came from individual research projects, also sponsored by the Ministry of Scientific Research (688 kEuro), from international projects (368 kEuro) and from the Institute's entrepreneurship activities (498 kEuro). Between 2003 and 2004 we doubled our income from international projects. For further budget information. The Scientific Council of the Institute, which consists of 40 elected members of the Institute's staff and 4 external members (elected representatives from other Polish institutes and universities), is authorized to confer Ph.D. degrees in Physics and related disciplines, and to initiate and conduct habilitation and professorship procedures. In 2003-2004 17 Ph.D. theses and 11 habilitations have been completed. Following their review procedures, 3 Associate Professors at the IFJ became state-nominated Professors, receiving their nominations from Poland's President, Mr. A. Kwasniewski. The Institute is structured into 17 scientific departments which cover the range of our scientific interests. A summary of our main scientific achievements in

  1. 179--14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    14 Des 2009 ... Wilber's development theory to show the evolution of consciousness .... van hierdie artikel is sy boek The integral intake: A guide to comprehensive idiographic assessment .... world view, a valuing system, a level of psychological existence, ..... characteristic of mysticism, although the ways that mystics have.

  2. Scientific Report 2004

    International Nuclear Information System (INIS)

    2005-04-01

    The annual scientific report gives a summary overview of the research and development activities at the Belgian Nuclear Research Centre SCK-CEN in 2004. The report discusses progress and main achievements in the following areas: reactor safety, radioactive waste and clean-up, radiation protection, the BR2 reactor, nuclear research and society, managing nuclear knowledge and fusion research

  3. Scientific Report 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-04-01

    The annual scientific report gives a summary overview of the research and development activities at the Belgian Nuclear Research Centre SCK-CEN in 2004. The report discusses progress and main achievements in the following areas: reactor safety, radioactive waste and clean-up, radiation protection, the BR2 reactor, nuclear research and society, managing nuclear knowledge and fusion research.

  4. EAMJ Dec. Repeatability.indd

    African Journals Online (AJOL)

    2008-12-12

    Dec 12, 2008 ... wheeze in the past year, and 174 who did not. Interventions:Administered .... best of three spirometer readings was taken, and any individual with ... all those wheezers with reported ever having asthma, and the 'negatives' to ...

  5. I-NERI 2004 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    2004-01-01

    The International Nuclear Energy Research Initiative (I-NERI) supports the National Energy Policy by conducting research to advance the state of nuclear science and technology in the United States (U.S.). I-NERI sponsors innovative scientific and engineering research and development (R&D) in cooperation with participating countries. The R&D research performed under the I-NERI umbrella addresses the key issues affecting the future of nuclear energy and its global deployment. I-NERI research is directed towards improving cost performance, increasing proliferation resistance, enhancing safety, and improving the waste management of future nuclear energy systems. This I-NERI 2004 Annual Report serves to inform interested parties on the program's organization, progress of the collaborative research projects, and future planning for the program. The report covers the four years of I-NERI activity since the program's inception in fiscal year (FY) 2001. The motivation and series of events that led to the creation of the I-NERI program are discussed in Section 2. The participating countries in current I-NERI collaborative agreements are also presented. Section 3 presents an overview of the I-NERI goals and objectives, a work scope summary for the collaborative projects, and a summary of research project awards through the end of FY 2004. It also includes FY 2005 accomplishments and planned FY 2005 activities. A summary of programmatic accomplishments is presented in Section 4. Also included is a summary of new and existing projects, an overview of the I-NERI program funding, and the new collaborations anticipated in FY 2005. The R&D work scope for current I-NERI collaborative projects with Canada, France, Japan, the Organization for Economic Cooperation and Development/Nuclear Energy Agency (OECD/NEA), and the Republic of Korea are presented in Sections 5 through 9, respectively. For each participating country, an index of projects and a summary of FY 2004

  6. Hanford Site Climatological Summary 2004 with Historical Data

    International Nuclear Information System (INIS)

    Hoitink, Dana J.; Ramsdell, James V.; Burk, Kenneth W.; Shaw, William J.

    2005-01-01

    This document presents the climatological data measured on the DOE Hanford Site for calendar year 2004. This report contains updated historical information for temperature, precipitation, wind, and normal and extreme values of temperature, and precipitation

  7. DOE-NSF-NIH Workshop on Opportunities in THz Science, February 12-14, 2004

    Energy Technology Data Exchange (ETDEWEB)

    Sherwin, M.A.; Bucksbaum, P.H.; Schmuttenmaer, C. A.; Allen, J.; Biedron, S.; Carr, L.; Chamberlain, M.; Crowe, T.; DeLucia, F.; Hu, Q.; Jones, B.; Noordham, B.; Norris, T.; Orenstein, J.; Unterrainer, K.; Van der Meer, L.; Wilke, I.; Williams, G.; Zhang, X.-C.; Cheville, A.; Markelz, A.; Parks, B.; Plancken, P.; Shan, J.; Austin, B.; Basov, D.; Citrin, D.; Grundfest, W.; Heinz, T.; Kono, J.; Mittleman, D.; Siegel, P.; Taylor, T.; Jones, B.; Markelz, A.; Martin, M.; Nelson, K.; Smith, T.; Williams, G.; Allen, M.; Averitt, R.; Brunel, L.; Heilweil, T.; Heyman, J.; Jepsen, P.; Kaind, R.; Leemans, W.; Mihaly, L.; Rangan, C.; Tom, H.; Wallace, V.; Zimdars, D.

    2004-02-14

    This is the report of the Workshop on Opportunities in THz Science, held on February 12-14, 2004 in Arlington, VA. This workshop brought together researchers who use or produce THz radiation for physics, chemistry, biology, medicine, and materials science to discuss new research opportunities and common resource needs. The charge from the sponsors of the workshop was to focus on basic science questions within these disciplines that have and can be answered using THz radiation.

  8. EAMJ Dec. Pathological.indd

    African Journals Online (AJOL)

    2008-12-12

    Dec 12, 2008 ... cardiac-arrhythmias cardio-myopathy, HIV/AIDS, Left Ventricular ... (LVH), infective endocarditis, atrial septal aneurysm, carotid plaques with or ... patients who died had anterior circulation ischaemic stroke as per ... disturbance of cerebral function of sudden onset ..... of strict blood pressure control (15, 32).

  9. Macro-IML manual for DEC PDP 11 computer with controller DEC CA 11-A/BORER type 1,533 A

    International Nuclear Information System (INIS)

    Kubitz, M.; Kind, R.

    1975-03-01

    The IML-implementations follow the Macro-Syntax as given in Appendix A of the document 'CAMAC. The Definitior of IML (A Language For Use in CAMAC Systems)'. This document has been adopted as a description by ESONE and AEC NIM in August/September 74 and has been published in October 74. They have been designed for the DEC PDP 11 computer with the branch controller DEC CA 11-A and the Single Crate Controller BORER Type 1,533 A. For both DEC operating systems, DOS V08/09 and RSX-11D/M a full set of macros has been implemented except the block transfer on special LAM, X-error control statements and the subscript mode. Transfer modes not implemented by the hardware of the CA 11-A are simulated by software. (orig.) [de

  10. Critical Discourse Analysis in Education: A Review of the Literature, 2004 to 2012

    Science.gov (United States)

    Rogers, Rebecca; Schaenen, Inda; Schott, Christopher; O'Brien, Kathryn; Trigos-Carrillo, Lina; Starkey, Kim; Chasteen, Cynthia Carter

    2016-01-01

    This article reviews critical discourse analysis scholarship in education research from 2004 to 2012. Our methodology was carried out in three stages. First, we searched educational databases. Second, we completed an analytic review template for each article and encoded these data into a digital spreadsheet to assess macro-trends in the field.…

  11. DIRECT ENERGY CONVERSION (DEC) FISSION REACTORS - A U.S. NERI PROJECT

    International Nuclear Information System (INIS)

    Beller, D.; Polansky, G.

    2000-01-01

    The direct conversion of the electrical energy of charged fission fragments was examined early in the nuclear reactor era, and the first theoretical treatment appeared in the literature in 1957. Most of the experiments conducted during the next ten years to investigate fission fragment direct energy conversion (DEC) were for understanding the nature and control of the charged particles. These experiments verified fundamental physics and identified a number of specific problem areas, but also demonstrated a number of technical challenges that limited DEC performance. Because DEC was insufficient for practical applications, by the late 1960s most R and D ceased in the US. Sporadic interest in the concept appears in the literature until this day, but there have been no recent programs to develop the technology. This has changed with the Nuclear Energy Research Initiative that was funded by the U.S. Congress in 1999. Most of the previous concepts were based on a fission electric cell known as a triode, where a central cathode is coated with a thin layer of nuclear fuel. A fission fragment that leaves the cathode with high kinetic energy and a large positive charge is decelerated as it approaches the anode by a charge differential of several million volts, it then deposits its charge in the anode after its kinetic energy is exhausted. Large numbers of low energy electrons leave the cathode with each fission fragment; they are suppressed by negatively biased on grid wires or by magnetic fields. Other concepts include magnetic collimators and quasi-direct magnetohydrodynamic generation (steady flow or pulsed). We present the basic principles of DEC fission reactors, review the previous research, discuss problem areas in detail and identify technological developments of the last 30 years relevant to overcoming these obstacles. A prognosis for future development of direct energy conversion fission reactors will be presented

  12. Announcing the Venus Transit 2004 (VT-2004) Programme

    Science.gov (United States)

    2004-02-01

    Rare Celestial Event to be Observed by Millions Summary On June 8, 2004, Venus - the Earth's sister planet - will pass in front of the Sun. This event, a 'transit', is extremely rare - the last one occurred in 1882, 122 years ago. Easily observable in Europe, Asia, Africa and Australia, it is likely to attract the attention of millions of people on these continents and, indeed, all over the world. On this important occasion, the European Southern Observatory (ESO) has joined forces with the European Association for Astronomy Education (EAAE), the Institut de Mécanique Céleste et de Calcul des Éphémérides (IMCCE) and the Observatoire de Paris in France, as well as the Astronomical Institute of the Academy of Sciences of the Czech Republic to establish the Venus Transit 2004 (VT-2004) public education programme. It is supported by the European Commission in the framework of the European Science and Technology Week and takes advantage of this extraordinary celestial event to expose the public - in a well-considered, interactive and exciting way - to a number of fundamental issues at the crucial interface between society and basic science. VT-2004 has several components, including an instructive and comprehensive website (www.vt-2004.org). It is directed towards the wide public in general and the media, school students and their teachers, as well as amateur astronomers in particular. It invites all interested persons to participate actively in the intercontinental VT-2004 Observing Campaign (that reenacts historical Venus Transit observations) and the VT-2004 Video Contest. During the VT-2004 Final Event in November, the winners of the Video Contest will be chosen by an international jury. This meeting will also serve to discuss the project and its impact. The outcome of this rare celestial event and the overall experience from this unique public education project will clearly be of very wide interest, not just in the field of astronomy.

  13. 2004 Sumatra Tsunami

    Directory of Open Access Journals (Sweden)

    Vongvisessomjai, S.

    2005-09-01

    Full Text Available A catastrophic tsunami on December 26, 2004 caused devastation in the coastal region of six southern provinces of Thailand on the Andaman Sea coast. This paper summaries the characteristics of tsunami with the aim of informing and warning the public and reducing future casualties and damage.The first part is a review of the records of past catastrophic tsunamis, namely those in Chile in 1960, Alaska in 1964, and Flores, Java, Indonesia, in 1992, and the lessons drawn from these tsunamis. An analysis and the impact of the 2004 Sumatra tsunami is then presented and remedial measures recommended.Results of this study are as follows:Firstly, the 2004 Sumatra tsunami ranked fourth in terms of earthquake magnitude (9.0 M after those in 1960 in Chile (9.5 M, 1899 in Alaska (9.2 M and 1964 in Alaska (9.1 M and ranked first in terms of damage and casualties. It was most destructive when breaking in shallow water nearshore.Secondly, the best alleviation measures are 1 to set up a reliable system for providing warning at the time of an earthquake in order to save lives and reduce damage and 2 to establish a hazard map and implement land-use zoning in the devastated areas, according to the following principles:- Large hotels located at an elevation of not less than 10 m above mean sea level (MSL- Medium hotels located at an elevation of not less than 6 m above MSL- Small hotel located at elevation below 6 m MSL, but with the first floor elevated on poles to allow passage of a tsunami wave- Set-back distances from shoreline established for various developments- Provision of shelters and evacuation directionsFinally, public education is an essential part of preparedness.

  14. Summary of BISON Development Activities: NEAMS FY14 Report

    Energy Technology Data Exchange (ETDEWEB)

    Williamson, R. L. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Novascone, S. R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hales, J. D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Spencer, B. W. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Liu, W. [Anatech, Inc.; Pastore, G. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Perez, D. M. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gardner, R. J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Stafford, D. S. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gamble, K. A. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-10-01

    This summary report contains an overview of work performed under the work package entitled “FY2014 NEAMS INL-Engineering Scale Fuel Performance & Interface with RPL Tools.” A first chapter identifies the specific FY-14 milestones, providing a basic description of the associated work and references to related detailed documentation. Where applicable, a representative technical result is provided. A second chapter summarizes substantial additional work including 1) efforts to improve numerical convergence and contact in BISON, 2) development of capability to simulate hydrogen behavior in Zircaloy cladding and 3) efforts to enhance collaborative work with the Halden Research Program. A final chapter briefly outlines planned future work.

  15. Uranium enrichment management review: summary of analysis

    International Nuclear Information System (INIS)

    1981-01-01

    In May 1980, the Assistant Secretary for Resource Applications within the Department of Energy requested that a group of experienced business executives be assembled to review the operation, financing, and management of the uranium enrichment enterprise as a basis for advising the Secretary of Energy. After extensive investigation, analysis, and discussion, the review group presented its findings and recommendations in a report on December 2, 1980. The following pages contain background material on which that final report was based. This report is arranged in chapters that parallel those of the uranium enrichment management review final report - chapters that contain summaries of the review group's discussion and analyses in six areas: management of operations and construction; long-range planning; marketing of enrichment services; financial management; research and development; and general management. Further information, in-depth analysis, and discussion of suggested alternative management practices are provided in five appendices

  16. Uranium enrichment management review: summary of analysis

    Energy Technology Data Exchange (ETDEWEB)

    1981-01-01

    In May 1980, the Assistant Secretary for Resource Applications within the Department of Energy requested that a group of experienced business executives be assembled to review the operation, financing, and management of the uranium enrichment enterprise as a basis for advising the Secretary of Energy. After extensive investigation, analysis, and discussion, the review group presented its findings and recommendations in a report on December 2, 1980. The following pages contain background material on which that final report was based. This report is arranged in chapters that parallel those of the uranium enrichment management review final report - chapters that contain summaries of the review group's discussion and analyses in six areas: management of operations and construction; long-range planning; marketing of enrichment services; financial management; research and development; and general management. Further information, in-depth analysis, and discussion of suggested alternative management practices are provided in five appendices.

  17. Market review - Market values summary/July market review/current market data

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    This article is the July 1995 uranium market review. Data for current uranium market is presented, and a summary of recent transactions is also given. During this reporting period, there was one concentrate deal, two transactions in the long-term natural uranium market and conversion market, and three spot market transactions in the enrichment market. Active uranium supply fell, as did demand, and prices in all sectors were relatively stable

  18. 7 CFR 3406.14 - Proposal review-teaching.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Proposal review-teaching. 3406.14 Section 3406.14 Agriculture Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION... Review and Evaluation of a Teaching Proposal § 3406.14 Proposal review—teaching. The proposal evaluation...

  19. Mining consumer reviews to generate ratings of different product attributes while producing feature-based review-summary

    Science.gov (United States)

    Kangale, Akshay; Krishna Kumar, S.; Arshad Naeem, Mohd; Williams, Mark; Tiwari, M. K.

    2016-10-01

    With the massive growth of the internet, product reviews increasingly serve as an important source of information for customers to make choices online. Customers depend on these reviews to understand users' experience, and manufacturers rely on this user-generated content to capture user sentiments about their product. Therefore, it is in the best interest of both customers and manufacturers to have a portal where they can read a complete comprehensive summary of these reviews in minimum time. With this in mind, we arrived at our first objective which is to generate a feature-based review-summary. Our second objective is to develop a predictive model to know the next week's product sales based on numerical review ratings and textual features embedded in the reviews. When it comes to product features, every user has different priorities for different features. To capture this aspect of decision-making, we have designed a new mechanism to generate a numerical rating for every feature of the product individually. The data have been collected from a well-known commercial website for two different products. The validation of the model is carried out using a crowd-sourcing technique.

  20. JAERI TANDEM annual report 2004. April 1, 2004 - March 31, 2005

    International Nuclear Information System (INIS)

    Ishii, Tetsuro; Takeuchi, Suehiro; Oshima, Masumi; Nagame, Yuichiro; Chiba, Satoshi; Sataka, Masao

    2006-01-01

    This annual report describes research activities, which have been performed with the JAERI tandem accelerator and its energy booster from April 1, 2004 to March 31, 2005. Summary reports of 48 papers, and lists of publication, personnel and cooperative research with universities are contained. The JAERI (Japan Atomic Energy Research Institute) have been unified with JNC (Japan Nuclear Fuel Cycle Development Institute) and became JAEA (Japan Atomic Energy Agency) on October 1st, 2005. (author)

  1. EDF - 2004 annual results, Financial statements 2004

    International Nuclear Information System (INIS)

    Gadonneix, Pierre; Camus, Daniel

    2005-01-01

    As the world's biggest electricity generator, the EDF Group covers every sector of expertise, from generation to trading and transmission grids. EDF builds on the expertise of its people, its R and D and engineering skills, its experience as a leading industry operator and the attentive support of its customers to deliver competitive solutions that successfully reconcile economic growth with climate protection. This document presents the 2004 annual results of the Group (key figures, financial results, strategy and perspectives) as well as its Consolidated financial statements at 31 December 2004: 1. Accounting principles and methods; 2. French law of 9 August 2004 on the Public Electricity and Gas Services and Electricity and Gas Companies; 3. Significant events of 2004; 4. Changes in the scope of consolidation; 5. Information by business segment and geographical area; 6. Sales; 7. Purchases and other external expenses; 8. Average workforce; 9. Other operating income and expenses; 10. Net (increase) decrease in provisions; 11. Interest expenses; 12. Foreign exchange result; 13. Other financial income and expenses; 14. Income taxes

  2. 75 FR 1617 - Draft Toxicological Review of Methanol: In Support of the Summary Information in the Integrated...

    Science.gov (United States)

    2010-01-12

    ... Toxicological Review of Methanol: In Support of the Summary Information in the Integrated Risk Information... external review draft document titled ``Toxicological Review of Methanol: In Support of Summary Information... methanol will be held on February 23, 2010, beginning at 9 a.m. and ending at 4 p.m., Eastern Standard Time...

  3. PEPFAR Investments In Governance And Health Systems Were One-Fifth Of Countries' Budgeted Funds, 2004-14.

    Science.gov (United States)

    Moucheraud, Corrina; Sparkes, Susan; Nakamura, Yoriko; Gage, Anna; Atun, Rifat; Bossert, Thomas J

    2016-05-01

    Launched in 2003, the US President's Emergency Plan for AIDS Relief (PEPFAR) is the largest disease-focused assistance program in the world. We analyzed PEPFAR budgets for governance and systems for the period 2004-14 to ascertain whether PEPFAR's stated emphasis on strengthening health systems has been manifested financially. The main outcome variable in our analysis, the first of its kind using these data, was the share of PEPFAR's total annual budget for a country that was designated for governance and systems. The share of planned PEPFAR funding for governance and systems increased from 14.9 percent, on average, in 2004 to 27.5 percent in 2013, but it declined in 2014 to 20.8 percent. This study shows that the size of a country's PEPFAR budget was negatively associated with the share allocated for governance and systems (compared with other budget program areas); it also shows that there was no significant relationship between budgets for governance and systems and HIV prevalence. It is crucial for the global health policy community to better understand how such investments are allocated and used for health systems strengthening. Project HOPE—The People-to-People Health Foundation, Inc.

  4. INAA of airborne particulate matter collected in Bangkok 2002-2004

    International Nuclear Information System (INIS)

    Chueinta, W.; Bunprapob, S.; Tedthong, S.

    2006-01-01

    This paper presents the summary report of the monitoring study on ambient air quality in Bangkok metropolis and its boundary covering the period from 2002 to 2004. The work performed included sampling of fine and coarse fractions of particulate matter at the sites representing urban and suburban areas; measurement of particle mass concentration and elemental concentration; and data interpretation. Instrumental neutron activation by use of research reactor facilities at Office of Atoms for Peace was carried out for multielemental analysis of all filter samples collected. Twenty elements were determined. The database of the three consecutive years are summarized and reviewed in this paper. (author)

  5. Search and selection methodology of systematic reviews in orthodontics (2000-2004).

    Science.gov (United States)

    Flores-Mir, Carlos; Major, Michael P; Major, Paul W

    2006-08-01

    More systematic reviews related to orthodontic topics are published each year, although little has been done to evaluate their search and selection methodologies. Systematic reviews related to orthodontics published between January 1, 2000, and December 31, 2004, were searched for their use of multiple electronic databases and secondary searches. The search and selection methods of identified systematic reviews were evaluated against the Cochrane Handbook's guidelines. Sixteen orthodontic systematic reviews were identified in this period. The percentage of reviews documenting and using each criterion of article searching has changed over the last 5 years, with no recognizable directional trend. On average, most systematic reviews documented their electronic search terms (88%) and inclusion-exclusion criteria (100%), and used secondary searching (75%). Many still failed to search more than MEDLINE (56%), failed to document the database names and search dates (37%), failed to document the search strategy (62%), did not use several reviewers for selecting studies (75%), and did not include all languages (81%). The methodology of systematic reviews in orthodontics is still limited, with key methodological components frequently absent or not appropriately described.

  6. Stream traffic data archival, querying, and analysis with TransDec.

    Science.gov (United States)

    2011-01-01

    The goal of research was to extend the traffic data analysis of the TransDec (short for : Transportation Decision-Making) system, which was developed under METRANS 09-26 : research grant. The TransDec system is a real-data driven system to support de...

  7. Summary report of the 20th IAEA fusion energy conference (November 1-6, 2004, Vilamoura, Portugal)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-09-01

    Fusion Energy Conference has been held aiming to report and exchange the information concerning the nuclear fusion research every two years since 1961 by IAEA. The conference has authorities most in the field of the fusion research. The 20th Fusion Energy Conference was held at Vilamoura in Portugal on November 1st through 6th in 2004, and 700 researchers or more participated in the conference from 35 countries. This report is a summary of the conference that the JAERI researchers who participated in this conference (35 persons in total) have seen presentations of each contributed papers at the conference room and have understood from each point of view. The contents of this report are very comprehensible, because those are written from the viewpoint of each researchers of JAERI. The purpose of this report is to provide the information which is useful for many researchers to understand the latest study results over a wide field of fusion research. (author)

  8. Evaluation of DEC`s GIGAswitch for distributed parallel computing

    Energy Technology Data Exchange (ETDEWEB)

    Chen, H.; Hutchins, J.; Brandt, J.

    1993-10-01

    One of Sandia`s research efforts is to reduce the end-to-end communication delay in a parallel-distributed computing environment. GIGAswitch is DEC`s implementation of a gigabit local area network based on switched FDDI technology. Using the GIGAswitch, the authors intend to minimize the medium access latency suffered by shared-medium FDDI technology. Experimental results show that the GIGAswitch adds 16.5 microseconds of switching and bridging delay to an end-to-end communication. Although the added latency causes a 1.8% throughput degradation and a 5% line efficiency degradation, the availability of dedicated bandwidth is much more than what is available to a workstation on a shared medium. For example, ten directly connected workstations each would have a dedicated bandwidth of 95 Mbps, but if they were sharing the FDDI bandwidth, each would have 10% of the total bandwidth, i.e., less than 10 Mbps. In addition, they have found that when there is no output port contention, the switch`s aggregate bandwidth will scale up to multiples of its port bandwidth. However, with output port contention, the throughput and latency performance suffered significantly. Their mathematical and simulation models indicate that the GIGAswitch line efficiency could be as low as 63% when there are nine input ports contending for the same output port. The data indicate that the delay introduced by contention at the server workstation is 50 times that introduced by the GIGAswitch. The authors conclude that the GIGAswitch meets the performance requirements of today`s high-end workstations and that the switched FDDI technology provides an alternative that utilizes existing workstation interfaces while increasing the aggregate bandwidth. However, because the speed of workstations is increasing by a factor of 2 every 1.5 years, the switched FDDI technology is only good as an interim solution.

  9. INAA of Airborne Particulate Matter Collected in Bangkok and Pathumthani 2002-2004

    International Nuclear Information System (INIS)

    Chueinta, W.; Bunprapob, S.

    2005-01-01

    This paper presents the summary report of the monitoring study on ambient air quality in Bangkok metropolis and its boundary covering the period from 2002 to 2004. The work performed included sampling of fine and coarse fractions of particulate matter at the sites representing urban and suburban areas; measurement of particle mass concentration and elemental concentration; and data interpretation. Instrumental neutron activation by use of research reactor facilities at Office of Atoms for Peace was carried out for multielemental analysis of all filter samples collected. Twenty elements were determined. The database of the three consecutive years are summarized and reviewed in this paper

  10. The LNG Industry - 2004

    International Nuclear Information System (INIS)

    2005-04-01

    First estimates for the marketed production of natural gas in 2004 show a rise of about 2 % over 2003. The share of LNG in the gas trade accounts for 21.9 % of the total. This annual report presents: 1 - LNG contracts and trade, 2 - Contracts concluded in 2004, 3 - LNG imports - Sources of imports - Quantities received in 2005 by the importing countries from the exporting countries, 4 - LNG tankers, 5 - 21 Ships delivered in 2004, 6 - Tanker distribution (at the end of 2004), 7 - Liquefaction plants, 8 - re-gasification plants, 9 - Long-term and medium-term contracts in force in 2004, 10 - Spot and short term quantities received in 2004 by the importing countries from the exporting countries, 11 - Sea transportation routes, 12 - Liquefaction plants (table), 13 - re-gasification plants (table), 14 - Delivery date of the LNG tankers

  11. 14 CFR 415.57 - Payload review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Payload review. 415.57 Section 415.57... TRANSPORTATION LICENSING LAUNCH LICENSE Payload Review and Determination § 415.57 Payload review. (a) Timing. A payload review may be conducted as part of a license application review or may be requested by a payload...

  12. 14 CFR 415.23 - Policy review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Policy review. 415.23 Section 415.23... TRANSPORTATION LICENSING LAUNCH LICENSE Policy Review and Approval § 415.23 Policy review. (a) The FAA reviews a... raised during a policy review that would impede issuance of a policy approval. The applicant may respond...

  13. Annual report and balance 2004

    International Nuclear Information System (INIS)

    2005-01-01

    A summary of the research, development, services and production activities of the National Atomic Energy Commission (CNEA) of Argentina is given as well as details of management resources together with the evolution of the budget. The activities of the CNEA related companies during 2004 are also outlined. A special mention is made of the activities of the three CNEA educational and training institutes

  14. 7 CFR 3405.14 - Proposal review.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION, AND EXTENSION SERVICE, DEPARTMENT OF AGRICULTURE HIGHER EDUCATION CHALLENGE GRANTS PROGRAM Proposal Review and Evaluation § 3405.14 Proposal review. The proposal evaluation process includes both internal staff review and...

  15. 14 CFR 1262.309 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1262.309 Section 1262.309... PROCEEDINGS Procedures for Considering Applications § 1262.309 Judicial review. Judicial review of final... the determination to the court of the United States having jurisdiction to review the merits of the...

  16. Annals of Medical and Health Sciences Research – Jul. - Dec., 2011 ...

    African Journals Online (AJOL)

    EGOLUM

    2011-12-22

    Dec 22, 2011 ... Annals of Medical and Health Sciences Research – Jul. – Dec., 2011 – Vol. ... Method: The study was a cross-sectional survey of pregnant women in Enugu; South-East Nigeria. The ..... Medical Encyclopedia. {Assessed on ...

  17. EAMJ Dec Presure Ulcer 09.indd

    African Journals Online (AJOL)

    2009-12-01

    Dec 1, 2009 ... Geriatric surgery, comprehensive care of the elderly ... Galdin, J.E. Sepsis associated with decubitus ulcer. Amer. J. Med. 1976 ... Ann. Platy. ... A multisite study of the predictive validity of the. Braden scale. Nurs. Res. 1998; 47: ...

  18. 14 CFR 431.23 - Policy review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Policy review. 431.23 Section 431.23... TRANSPORTATION LICENSING LAUNCH AND REENTRY OF A REUSABLE LAUNCH VEHICLE (RLV) Policy Review and Approval for Launch and Reentry of a Reusable Launch Vehicle § 431.23 Policy review. (a) The FAA reviews an RLV...

  19. MetaUniDec: High-Throughput Deconvolution of Native Mass Spectra

    Science.gov (United States)

    Reid, Deseree J.; Diesing, Jessica M.; Miller, Matthew A.; Perry, Scott M.; Wales, Jessica A.; Montfort, William R.; Marty, Michael T.

    2018-04-01

    The expansion of native mass spectrometry (MS) methods for both academic and industrial applications has created a substantial need for analysis of large native MS datasets. Existing software tools are poorly suited for high-throughput deconvolution of native electrospray mass spectra from intact proteins and protein complexes. The UniDec Bayesian deconvolution algorithm is uniquely well suited for high-throughput analysis due to its speed and robustness but was previously tailored towards individual spectra. Here, we optimized UniDec for deconvolution, analysis, and visualization of large data sets. This new module, MetaUniDec, centers around a hierarchical data format 5 (HDF5) format for storing datasets that significantly improves speed, portability, and file size. It also includes code optimizations to improve speed and a new graphical user interface for visualization, interaction, and analysis of data. To demonstrate the utility of MetaUniDec, we applied the software to analyze automated collision voltage ramps with a small bacterial heme protein and large lipoprotein nanodiscs. Upon increasing collisional activation, bacterial heme-nitric oxide/oxygen binding (H-NOX) protein shows a discrete loss of bound heme, and nanodiscs show a continuous loss of lipids and charge. By using MetaUniDec to track changes in peak area or mass as a function of collision voltage, we explore the energetic profile of collisional activation in an ultra-high mass range Orbitrap mass spectrometer. [Figure not available: see fulltext.

  20. Chronique de jurisprudence suisse (1996-2004)

    DEFF Research Database (Denmark)

    Cavaleri, Sylvie Cécile

    2005-01-01

    The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy.......The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy....

  1. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... a case study of University of Lagos, 3 faculties within the university constituted the study population ... career advancement, women, academics, information communication ... provides a great development opportunity and.

  2. Summary of preliminary step-trend analysis from the Interagency Whitebark Pine Long-termMonitoring Program—2004-2013

    Science.gov (United States)

    Legg, Kristin; Shanahan, Erin; Daley, Rob; Irvine, Kathryn M.

    2014-01-01

    In mixed and dominant stands, whitebark pine (Pinus albicaulis) occurs in over two million acres within the six national forests and two national parks that comprise the Greater Yellowstone Ecosystem (GYE). Currently, whitebark pine, an ecologically important species, is impacted by multiple ecological disturbances; white pine blister rust (Cronartium ribicola), mountain pine beetle (Dendroctonus ponderosae), wildfire, and climate change all pose significant threats to the persistence of whitebark pine populations. Substantial declines in whitebark pine populations have been documented throughout its range.Under the auspices of the Greater Yellowstone Coordinating Committee (GYCC), several agencies began a collaborative, long-term monitoring program to track and document the status of whitebark pine across the GYE. This alliance resulted in the formation of the Greater Yellowstone Whitebark Pine Monitoring Working Group (GYWPMWG), which consists of representatives from the U.S. Forest Service (USFS), National Park Service (NPS), U.S. Geological Survey (USGS), and Montana State University (MSU). This groundbased monitoring program was initiated in 2004 and follows a peer-reviewed protocol (GYWPMWG 2011). The program is led by the Greater Yellowstone Inventory and Monitoring Network (GRYN) of the National Park Service in coordination with multiple agencies. More information about this monitoring effort is available at: http://science. nature.nps.gov/im/units/gryn/monitor/whitebark_pine.cfm. The purpose of this report is to provide a draft summary of the first step-trend analysis for the interagency, long-term monitoring of whitebark pine health to the Interagency Grizzly Bear Study Team (IGBST) as part of a synthesis of the state of whitebark pine in the GYE. Due to the various stages of the analyses and reporting, this is the most efficient way to provide these results to the IGBST.

  3. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... was small. ... organizational effectiveness and one of such .... Instead, contingency-situation theories were developed to indicate that ... development, a company will experience ..... Journal of Applied Psychology 53,. 87-92.

  4. 14 CFR 1262.308 - Agency review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Agency review. 1262.308 Section 1262.308... PROCEEDINGS Procedures for Considering Applications § 1262.308 Agency review. (a) Within 30 calendar days of... applicant or agency counsel may seek Agency review of the decision; or, the NASA Administrator, upon the...

  5. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... 2Justice Development and Peace Commission, Onitsha, Nigeria ... Community information comprises of services offered by libraries and information ... poor and marginalized groups to improve their standard of living and ...

  6. Energy materials coordinating committee (EMaCC). Annual technical report, fiscal year 2004

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2005-08-31

    The DOE Energy Materials Coordinating Committee (EMaCC) serves primarily to enhance coordination among the Department's materials programs and to further effective use of materials expertise within the Department. These functions are accomplished through the exchange of budgetary and planning information among program managers and through technical meetings/workshops on selected topics involving both DOE and major contractors. In addition, EMaCC assists in obtaining materials-related inputs for both intra- and interagency compilations. Topical subcommittees of the EMaCC are responsible for conducting seminars and otherwise facilitating information flow between DOE organizational units in materials areas of particular importance to the Department. The EMaCC Terms of Reference were recently modified and developed into a Charter that was approved on June 5, 2003. As a result of this reorganization, the existing subcommittees were disbanded and new subcommittees are being formed. The FY 2004 budget summary for DOE Materials Activities is presented on page 8. The distribution of these funds between DOE laboratories, private industry, academia and other organizations is presented in tabular form on page 10. Following the budget summary is a set of detailed program descriptions for the FY 2004 DOE Materials activities. These descriptions are presented according to the organizational structure of the Department. A mission statement, a budget summary listing the project titles and FY 2004 funding, and detailed project summaries are presented for each Assistant Secretary office, the Office of Science, and the National Nuclear Security Administration. The project summaries also provide DOE, laboratory, academic and industrial contacts for each project, as appropriate.

  7. 14 CFR 1264.141 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

  8. 14 CFR 294.51 - Presidential review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Presidential review. 294.51 Section 294.51... REGULATIONS CANADIAN CHARTER AIR TAXI OPERATORS Cancellation of Registration and Presidential Review § 294.51 Presidential review. A Department order under § 294.50 (e), (g) or (i) shall be subject to stay or disapproval...

  9. EAMJ The Prevalence Dec 09.indd

    African Journals Online (AJOL)

    2009-12-12

    Dec 12, 2009 ... Case definitions: The primary outcome was having a documented ADR after exposure to HAART. The cases were defined according to the guidelines contained in the Kenya National Clinical Manual for. ART providers (8), which mainly follows the criteria used by the AIDSClinical Trials Group (ACTG) (9).

  10. 14 CFR 1250.110 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...

  11. Dec 2011 NJS for Prof Anyanwu

    African Journals Online (AJOL)

    Missing intrauterine contraceptive device (IUCD) is a known complication of ... complaints of missing IUCD over an 11 year period, from 1 January 1990 to 31 ... removal were extracted and analysed using tabulations and simple ... Nigerian Journal of Surgery • Dec. ... abdominal pain 5(25%) and string not felt 4(20%).

  12. 195--10 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... Accepted: 25 June 2009. Published: ... This paper will focus on the Leuenberg Agreement as a possible ... to confuse the true meaning of the Confession. ... Differences were minimalised as a matter of terminology and words.

  13. Annual report for 2004

    International Nuclear Information System (INIS)

    2005-01-01

    Article VI.J of the IAEA's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the affairs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 2004. The Annual Report reviews the results of the Agency's programme according to the three pillars of technology, safety and verification. The main part of the report generally follows the programme structure as it applied in 2004. The introductory chapter, 'The Agency and the World in 2004', seeks to provide a thematic analysis, based on the three pillars, of the Agency's activities within the overall context of notable developments during the year. Information on specific issues can be found in the latest editions of the Agency's Nuclear Safety Review, Nuclear Technology Review and Technical Cooperation Report. For the convenience of readers, these documents are available on the CD-ROM attached to this report. Additional information covering various aspects of the Agency's programme is also provided on the attached CD-ROM, and is also available on the Agency's iaea.org web site (http://www.iaea.org/Worldatom/Documents/Anrep/Anrep2004/). The Board of Governors oversees the ongoing operations of the Agency. It comprises 35 Member States and generally meets five times a year or more frequently if required for specific situations. Among its functions, the Board adopts the Agency's programme for the incoming biennium and makes recommendations on the Agency's budget to the General Conference. In 2004, the Board considered the Nuclear Technology Review 2004 and various activities related to nuclear science, technology and applications. This included authorizing the implementation of the Programme of Action for Cancer Therapy (PACT). In the area of safety and security, it considered the Nuclear Safety Review for the Year 2003 and related activities. It approved four Action Plans on various safety related activities and

  14. Annual report for 2004

    International Nuclear Information System (INIS)

    2005-01-01

    Article VI.J of the IAEA's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the aff airs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 2004. The Annual Report reviews the results of the Agency's programme according to the three pillars of technology, safety and verification. The main part of the report generally follows the programme structure as it applied in 2004. The introductory chapter, 'The Agency and the World in 2004', seeks to provide a thematic analysis, based on the three pillars, of the Agency's activities within the overall context of notable developments during the year. Information on specific issues can be found in the latest editions of the Agency's Nuclear Safety Review, Nuclear Technology Review and Technical Cooperation Report. For the convenience of readers, these documents are available on the CD-ROM attached to this report. Additional information covering various aspects of the Agency's programme is also provided on the attached CD-ROM, and is also available on the Agency's iaea.org web site (http://www.iaea.org/Worldatom/Documents/Anrep/Anrep2004/). The Board of Governors oversees the ongoing operations of the Agency. It comprises 35 Member States and generally meets five times a year or more frequently if required for specific situations. Among its functions, the Board adopts the Agency's programme for the incoming biennium and makes recommendations on the Agency's budget to the General Conference. In 2004, the Board considered the Nuclear Technology Review 2004 and various activities related to nuclear science, technology and applications. This included authorizing the implementation of the Programme of Action for Cancer Therapy (PACT). In the area of safety and security, it considered the Nuclear Safety Review for the Year 2003 and related activities. It approved four Action Plans on various safety related activities

  15. 337-- 11 Dec 2009 [final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... deterministic, it can easily be so construed (as clearly illustrated by the Westminster .... from Britain (especially from Calvinist Scotland) and Germany would be sinful ..... The Cambridge history of the Bible 1, pp. 510–541,.

  16. Biomass Program 2007 Program Peer Review - Program Summary Section

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2009-10-27

    This document summarizes the comments provided by the peer reviewers at the U.S. Department of Energy (DOE) Biomass Program’s Peer Review meeting, held on November 14-15, 2007 in Baltimore, MD and Platform Reviews conducted over the summer of 2007. The Platform Reviews provide evaluations of the Program’s projects in applied research, development, and demonstration.

  17. Summaries of research and development activities by using JAERI computer system in FY2004 (April 1, 2004 - March 31, 2005)

    International Nuclear Information System (INIS)

    2005-08-01

    Center for Promotion of Computational Science and Engineering (CCSE) of Japan Atomic Energy Research Institute (JAERI) installed large computer systems including super-computers in order to support research and development activities in JAERI. CCSE operates and manages the computer system and network system. This report presents usage records of the JAERI computer system and the big users' research and development activities by using the computer system in FY2004 (April 1, 2004 - March 31, 2005). (author)

  18. Bancroftian filariasis: long-term effect of the DEC provocative day test on microfilaraemia

    DEFF Research Database (Denmark)

    Simonsen, Poul Erik; Meyrowitsch, Dan Wolf; Makunde, W.H.

    1997-01-01

    The diethylcarbamazine (DEC) provocative day test has been widely used for daytime diagnosis of Wuchereria bancrofti infections in areas where microfilariae exhibit nocturnal periodicity. Since DEC is also the primary drug for treatment of bancroftian filariasis, we examined the long term effect...... amicrofilaraemic. No significant reduction of microfilaraemia was observed in the placebo group. The results imply that the DEC provocative day test should not be used as a diagnostic tool in follow-up studies on microfilaraemias....

  19. NRC review of Electric Power Research Institute's Advanced Light Reactor Utility Requirements Document - Program summary, Project No. 669

    International Nuclear Information System (INIS)

    1992-08-01

    The staff of the US Nuclear Regulatory Commission has prepared Volume 1 of a safety evaluation report (SER), ''NRC Review of Electric Power Research Institute's Advanced Light Water Reactor Utility Requirements Document -- Program Summary,'' to document the results of its review of the Electric Power Research Institute's ''Advanced Light Water Reactor Utility Requirements Document.'' This SER provides a discussion of the overall purpose and scope of the Requirements Document, the background of the staff's review, the review approach used by the staff, and a summary of the policy and technical issues raised by the staff during its review

  20. 14 CFR 11.87 - Are there circumstances in which FAA may decide not to publish a summary of my petition for...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Are there circumstances in which FAA may decide not to publish a summary of my petition for exemption? 11.87 Section 11.87 Aeronautics and Space... in which FAA may decide not to publish a summary of my petition for exemption? The FAA may not...

  1. Aquatic and Terrestrial Environment 2004

    DEFF Research Database (Denmark)

    Andersen, J. M.; Boutrup, S.; Bijl, L. van der

    This report presents the 2004 results of the Danish National Monitoring and Assess-ment Programme for the Aquatic and Terrestrial Environments (NOVANA). 2004 was the first year in which terrestrial nature was included in the monitoring pro-gramme. The report reviews the state of the groundwater......, watercourses, lakes and marine waters and the pressures upon them and reviews the monitoring of terrestrial natural habitats and selected plants and animals. The report is based on the annual reports prepared for each subprogramme by the Topic Centres. The latter reports are mainly based on data collected...

  2. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... Selective Dissemination of Information (SDI) Services in a Nigerian University: A. Report. 75. Information ... that Libraries that are ICT driven have continued to provide ... take advantage of technology in providing reference and .... 6. Teaching Profile ... history, Varieties of English,. English. Syntax/Semantics,.

  3. 299---09 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... a country is going, the politics, social justice, whether elections will be ... money laundering, human trafficking and sexual exploitation, sex tourism, the ... to the transformation and improvement of education, including affordability and access. ..... extent do individuals and groups learn from their failures.

  4. 310---11 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... sola fides. God has done all this in his love and his sovereignty, ..... them across Europe to countries such as Scotland, England,. Italy and .... faith is, the seed of the word has preceded; where there is preaching there is the ...

  5. Evaluation of a Surveillance Review Software based on Automatic Image Summaries

    International Nuclear Information System (INIS)

    Rocchi, S.; Hadfi, G.; John, M.; Moeslinger, M.; Murray, J.; Juengling, K.; Sequeira, V.; Versino, C.; )

    2015-01-01

    Surveillance streams from safeguards instruments contain thousands of images. Inspectors review them in order to find safeguards-relevant events. Statistically a very small fraction of the images is expected to be safeguards-relevant. For this reason inspectors need a tool which helps them to focus their attention directly to the relevant parts of the surveillance stream. The current approach for surveillance review makes use of scene change detection within areas of interest (AOIs). The data reduction provided can be effective for the review of regular processes, and requires specific knowledge of the process/environment under review for the proper setting of the AOIs. The VideoZoom approach, developed by the European Commission Joint Research Centre-Institute for Transuranium Elements (JRC-ITU), detects scene changes on the whole image plane. Changes are then summarized and rendered at different levels of abstraction in four layers of summaries, each one revealing more information about the image changes. By means of a zooming interface, the reviewer is able to navigate the summary layers and decide which are to be examined with full photographic detail or skipped because they are clearly not safeguards-relevant. In this way reviewers can make best use of their time by investigating what really requires their attention. VideoZoom was evaluated by a group of IAEA inspectors on a benchmark of image reviews, with promising results in terms of identification of safeguards-relevant events, efficiency and usability. Following the positive results collected during the preliminary benchmark, the IAEA initiated a task under the European Commission Support Programme (EC SP), aimed at the research, development, and evaluation of surveillance review software based on VideoZoom and compatible with surveillance streams produced by NGSS cameras, the current safeguards surveillance technology deployed by the IAEA. This paper provides a description of the VideoZoom approach to

  6. Temperature, salinity, nutrients, oxygen, pH, and other measurements collected using bottle, CTD, XCTD, BT, from Kofu, Ryofu, Keifu, and other platforms in the Pacific Ocean and Sea of Japan during 2004 (NODC Accession 0002643)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data Report of Oceanographic and Marine Meteorological Observations, No. 95, Jan-Dec. 2004. The Japan Meteorologial Agency(JMA) has been carrying out oceanographic...

  7. 299---09 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... money laundering, human trafficking and sexual exploitation, sex ... to the transformation and improvement of education, including affordability and access. ... A greater understanding of differences, and what gives rise to them, will hopefully lead to ..... The bridging function of spirituality is premised by two.

  8. 75 FR 28517 - 2004 and 2006 Biennial Regulatory Reviews-Streamlining and Other Revisions of the Commission's...

    Science.gov (United States)

    2010-05-21

    ... Commission for the transmission of radio energy, the owner of the tower shall maintain the prescribed.... FOR FURTHER INFORMATION CONTACT: John Borkowski, Wireless Telecommunications Bureau, (202) 418-0626, e... its 2004 Biennial Review Comments, PCIA--the Wireless Infrastructure Association (PCIA) states that...

  9. Review of C-14 inventory for the SFR facility

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Graham; Merino, Joan; Kerrigan, Emma

    2002-08-01

    The Swedish Radiation Protection Authority (SSI) is currently reviewing SKB's continuing assessment for disposal of radioactive waste to the SFR facility at Forsmark. Among the wastes disposed are reactor operating wastes. Among the relevant radionuclides is C-14, which is relatively difficult to measure and to control because of its mobility. This report documents a review of the C-14 inventory material submitted by SKB for the SFR-facility, to determine its validity and comment on the appropriate assumptions for C-14 content of wastes due to be disposed of to the SFR. The review is based on information provided by SSI as well as other relevant international experience. Conclusions are drawn upon: the chemical form of the C-14 in the waste from BWRs and PWRs; the production rate of C-14 in BWRs and PWRs and quantification of the source term in the IEX waste; the distribution of the C-14 in the IEX waste from BWR between the resins used for treatment of the primary cooling water and the resins used for treatment of the condensate water; quantification of the uncertainties. A suggestion is made that the C-14 inventory could be better developed based upon a mass balance assessment of all the C-14 produced in reactors, and its ultimate fate in effluent and solid wastes, taking account of the reactor specific operational factors identified in the review as relevant to C-14 inventory assessment.

  10. Review of C-14 inventory for the SFR facility

    International Nuclear Information System (INIS)

    Smith, Graham; Merino, Joan; Kerrigan, Emma

    2002-08-01

    The Swedish Radiation Protection Authority (SSI) is currently reviewing SKB's continuing assessment for disposal of radioactive waste to the SFR facility at Forsmark. Among the wastes disposed are reactor operating wastes. Among the relevant radionuclides is C-14, which is relatively difficult to measure and to control because of its mobility. This report documents a review of the C-14 inventory material submitted by SKB for the SFR-facility, to determine its validity and comment on the appropriate assumptions for C-14 content of wastes due to be disposed of to the SFR. The review is based on information provided by SSI as well as other relevant international experience. Conclusions are drawn upon: the chemical form of the C-14 in the waste from BWRs and PWRs; the production rate of C-14 in BWRs and PWRs and quantification of the source term in the IEX waste; the distribution of the C-14 in the IEX waste from BWR between the resins used for treatment of the primary cooling water and the resins used for treatment of the condensate water; quantification of the uncertainties. A suggestion is made that the C-14 inventory could be better developed based upon a mass balance assessment of all the C-14 produced in reactors, and its ultimate fate in effluent and solid wastes, taking account of the reactor specific operational factors identified in the review as relevant to C-14 inventory assessment

  11. Annual report 2004

    International Nuclear Information System (INIS)

    Toncik, M.

    2005-04-01

    In this Annual report the operating of the Slovak Environmental Agency in 2004 is reported. The structure of the Agency, mission, personnel structure, financing, monitoring of the environment, international cooperation and coordination of research programmes are reviewed

  12. The Peer Reviewed Literature on Undergraduate Education for Public Health in the United States, 2004-2014

    Directory of Open Access Journals (Sweden)

    Connie J Evashwick

    2014-11-01

    Full Text Available The education of undergraduate college students in the field of public health has burgeoned over the past decade. Professional literature in peer-reviewed journals is one indicator of the status of a field of study and its related body of knowledge. It is also a mechanism for sharing information among professionals about challenges, issues, experiences and best practices.The purpose of the literature review conducted here was to describe the status of the peer reviewed literature over the past decade pertaining to the education of undergraduates about the field of public health in the U.S.A literature search was conducted of three data bases: PubMed, Scopus and ERIC. Inclusion criteria were publication date from January 1, 2004 through July 31, 2014; written in the English language; pertaining to undergraduate education in the U.S.; and a focus on public health as the primary discipline. Public health was searched as an overarching discipline; articles focused on sub-disciplines or other health professions disciplines were excluded.The search resulted in 158 articles. Each of the authors reviewed the abstracts for all articles and read full articles when necessary. The result was 23 articles that were then considered in depth. The articles were categorized according to their primary theme: curriculum, courses, learning objectives (N=14; evaluation of teaching method (N=3; case study (N=3; career path and advising (N=2; accreditation (N=1. Year of publication and journal were also examined.The results of the literature search lead to several observations about how the peer reviewed literature has been used to date and how it could be used to advance the emerging field of undergraduate education for public health.

  13. Spectral Estimation by the Random Dec Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Jensen, Jacob L.; Krenk, Steen

    1990-01-01

    This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...

  14. Spectral Estimation by the Random DEC Technique

    DEFF Research Database (Denmark)

    Brincker, Rune; Jensen, J. Laigaard; Krenk, S.

    This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...

  15. Res Dec 07 Final 05-12-07

    Indian Academy of Sciences (India)

    client1

    2007-12-05

    Dec 5, 2007 ... glycerol and aminoacids such as alanine and proline. They are believed to stabilize cellular proteins and membranes at low temperature and hence called cryoprotectants. The cryoprotec- tive role of glycine betaine (GB) in bacteria is beginning to be understood. Antifreeze Proteins: An Overview. Birds ...

  16. State and Territory Greenhouse Gas Emissions 2004

    International Nuclear Information System (INIS)

    2006-06-01

    This document provides an overview of the latest available estimates of greenhouse gas emissions for Australia's States and Territories. Australia's total greenhouse gas emissions in 2004 amounted to 564.7 million tonnes. The State and Territory breakdown was: New South Wales: 158.7 million tonnes (Mt); Queensland: 158.5 Mt; Victoria: 123.0 Mt; Western Australia: 68.5 Mt; South Australia: 27.6 Mt; Northern Territory: 15.6 Mt; Tasmania: 10.7 Mt; ACT: 1.2 Mt. The summary of State and Territory inventories presented in this document reports estimates of greenhouse gas emissions for each State and Territory for the period 1990 to 2004. It is the first time that a complete annual time-series has been reported

  17. Summary of the ECLOUD'04 Workshop

    International Nuclear Information System (INIS)

    Macek, R.; Furman, M.

    2004-01-01

    The 31st ICFA Advanced Beam Dynamics Workshop on Electron-Cloud Effects ''ECLOUD'04'' was held April 19-23, 2004 at Napa, CA, USA. A broad range of current topics in this field were illuminated by 53 talks in 7 sessions plus 6 session summaries at the final summary session. These covered a variety of experimental methods and results, along with progress on understanding of the topic obtained from simulations and analytic theory, and evaluations of the effectiveness of various methods/mechanisms for mitigation of the adverse impact on accelerator performance. In addition, a panel discussion was held on ''Future Needs and Future Directions''. A summary of progress on the major themes covered at ECLOUD'04 is presented

  18. 311----10 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... Fighting crime in the new South Africa has taken on new challenges under a ... spurred on by Gordon MacDonald's own 'renewed challenge of insisting that my life of following ... Postfoundationalism has emerged from the work of Wentzel van Huyssteen .... contribute to providing a solution in this regard.

  19. 161---8 Dec 2009.indd [final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... The theory is attractive to practical theologians for two reasons. ... They consider conforming to principles to be of more importance than cultivating harmony. ...... Francis, L.J. & Atkins, P., 2000, Exploring Luke's Gospel: A guide.

  20. 127 -08 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... (as opposed to it being entirely superseded by a new 'Christian' identity) and interpreting him as still operating .... the rich enterprise of cultural or social anthropology. ...... millennial hopes were not realised by Paul's messiah.

  1. Cultural significance of primary teeth for caregivers in Northeast Brazil O significado cultural dos dentes decíduos para cuidadoras no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Marilyn K Nations

    2008-04-01

    Full Text Available This anthropological study critically evaluates Brazilian caregivers' symbolic production and significance of their malnourished offspring's primary teeth, as well as their own, and describes popular dental practices. From January to June 2004, ethnographic interviews of 27 poor, low-literacy mothers were conducted at a public Malnutrition Treatment Center in Fortaleza, Ceará State. Participant observation of clinical pathways and home environments supplemented the data. Content analysis was performed. Results confirm that primary teeth are imbued with cultural significance in Northeast Brazil. Mothers examine mouths, perceive signs of decay, associate primary with permanent tooth healthiness, identify ethnodental illnesses, seek assistance, and perform rituals with exfoliated teeth. The mother's motivation to care for primary teeth is sparked by her memories of past toothache and attempts to avoid stigma and discrimination. Social determinants, not mothers' beliefs or behaviors, are the most critical obstacles to effective dental care. Legitimizing lay knowledge and empowering caregivers and children can improve oral health in Northeast Brazil.Este estudo antropológico analisa a produção simbólica de cuidadoras brasileiras sobre a sua dentição e a de seus filhos desnutridos, descrevendo práticas populares de cuidados em saúde bucal. De janeiro a junho de 2004, foram conduzidas entrevistas etnográficas com 27 cuidadoras, numa instituição pública, no tratamento de desnutrição em Fortaleza, Ceará. A observação participante da dinâmica de atendimento e do ambiente domiciliar suplementaram os dados. Foi utilizada a análise temática. Os resultados confirmam que os dentes decíduos são imbuídos de significados culturais no nordeste brasileiro. As mães examinam as bocas dos filhos, percebem sinais de cárie, associam dentes decíduos saudáveis com permanentes hígidos, identificam enfermidades etnodentárias, procuram assist

  2. Vært for @AUforsker på Twitter 5.-11. dec. 2013

    DEFF Research Database (Denmark)

    Damkjaer, Maja Sonne

    2013-01-01

    @AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk......@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk...

  3. 14 CFR 385.33 - Review by the staff.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Review by the staff. 385.33 Section 385.33...) ORGANIZATION STAFF ASSIGNMENTS AND REVIEW OF ACTION UNDER ASSIGNMENTS Procedure on Review of Staff Action § 385.33 Review by the staff. Where a petition for review is duly filed, the staff member may, upon...

  4. 151---8 Dec 2009.indd [ Final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... and sustained polemic against Paul himself. (Sim 2002:777). Here Sim .... implicit points resemble Luke's more explicit presentation in .... I now turn my attention. Matthew's ...... in memory of William G. Thompson, pp. 22–41 ...

  5. Esso Imperial Oil annual report to shareholders 2004 : 125 years of energy leadership

    International Nuclear Information System (INIS)

    2005-01-01

    This annual report presents financial information of Esso Imperial Oil to its shareholders, as well as a review of its 2004 operations. In 2004, the total return on shares was more than 25 per cent (TSX) and has averaged almost 20 per cent a year for the past 10 years. The highest earnings in the company's history were achieved in 2004, $2,052 million, a significant increase from the record $1,705 million earnings in 2003. In 2004, total distributions to shareholders were almost $1.2 billion, including $872 million to buy back around 14 million shares. Debt as a percentage of total capital was below 20 per cent. At year end, the balance of cash was $1,279 million. Capital expenditures for 2004 were $1,445 million. Investments included advancing major upstream projects and funding significant refinery upgrades to reduce sulphur levels in diesel fuel. Operating highlights included substantial progress on upstream projects with a focus on developing oil-sands leases in Alberta, natural gas in the Mackenzie Delta region of the Northwest Territories and offshore resources on Canada's East Coast. Total research expenditure in Canada was $38 million, with 3 new patents and 180 new or reformulated products commercialized. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements and common share information. This included accounts of Imperial Oil Inc., and its subsidiaries, as well as the company's proportionate share of the assets, liabilities, revenues, expenses and cash flows of joint ventures. Revenue and expenditure statements were summarized by source. tabs., figs

  6. Oak Ridge Reservation Annual Site Environmental Report Summary, 2004

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, JF

    2005-11-30

    The Department of Energy (DOE) and our contractors strive to provide our stakeholders a comprehensive understanding of the consequences of DOE operations past and present. Toward this end a far-reaching multimillion-dollar annual monitoring and surveillance program collects and analyzes tens of thousands of air, surface and groundwater, soil, mud, plant, and animal samples. This effort represents the work of many dedicated environmental scientists who carry out these extensive programs and work hard to protect and enhance the environment. We publish the results in a detailed Annual Site Environmental Report (ASER), and a separate Data Volume for those who wish to see the supporting data. These documents present all the facts and figures, but are highly technical and not easily understood, and it's essential we provide a summary document simple to read and understand. So each year I team with Karns High School and ask students to write an Annual Site Environmental Report Summary that will be both informative and enjoyable to read. These environmental documents are perhaps the most important DOE reports because they explain the environmental monitoring programs and show the consequences of our operations in great detail to our legislatures, stakeholders, and the public. This ASER summary is written for you, the public, our most important stakeholder, with the hope that you find it comprehensible and of value in gaining an accurate understanding of the Oak Ridge Reservation. All three documents can be found on the web, along with previous publications, at http://www.ornl.gov/aser. It's a great pleasure to meet my new class each year and capture fresh creative ideas. I'm always delighted to see their interest and desire to learn and to produce a document for the public that reflects their personality and skills, and one the public will utilize and find of value. I sincerely thank these talented Karns High School students and their exceptional teacher

  7. Site environmental report for 2004 Sandia National Laboratories, California.

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Barbara L. (Sandia National Laboratories, Livermore, CA)

    2005-06-01

    Sandia National Laboratories, California (SNL/CA) is a government-owned/contractor-operated laboratory. Sandia Corporation, a Lockheed Martin Company, operates the laboratory for the Department of Energy's (DOE) National Nuclear Security Administration. The DOE Sandia Site Office oversees operations at the site, using Sandia Corporation as a management and operating contractor. This Site Environmental Report for 2004 was prepared in accordance with DOE Order 231.1A. The report provides a summary of environmental monitoring information and compliance activities that occurred at SNL/CA during calendar year 2004. General site and environmental program information is also included.

  8. 164----8 Dec 2009 [Final Version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.

  9. 278----9 Dec 2009 [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... different to the opening word 'hkyaee' found in Lamentations 1, 2 and. 4. ... Remembrance of events gives way to remembrance .... presence of the Most High and of one's case being subverted. (cf. ... standard reading of Lamentations is the fact that the narrator, ..... The form of Lamentations is that of a long.

  10. 325-- 11 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... with some light clouds and there are no clouds without water; as there are no birds ... food security as a high priority in many countries. Water and .... The above reasons for the availability of water resources reiterate that all living ... government infrastructure at various levels of agreement and not necessarily ...

  11. 308 --- 16 Dec 2009 [ final version].indd

    African Journals Online (AJOL)

    2009-12-16

    Dec 16, 2009 ... Secondly, an effort has to be made to at least try to avoid the fallacies of ... The metaphor says one thing but means something else; it needs to ... New Testament scholarship with literary criticism, defines the parables as narrative ..... the parable in the context of Jesus' public career some forty years.

  12. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  13. Meshes optimized for discrete exterior calculus (DEC).

    Energy Technology Data Exchange (ETDEWEB)

    Mousley, Sarah C. [Univ. of Illinois, Urbana-Champaign, IL (United States); Deakin, Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Knupp, Patrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mitchell, Scott A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-12-01

    We study the optimization of an energy function used by the meshing community to measure and improve mesh quality. This energy is non-traditional because it is dependent on both the primal triangulation and its dual Voronoi (power) diagram. The energy is a measure of the mesh's quality for usage in Discrete Exterior Calculus (DEC), a method for numerically solving PDEs. In DEC, the PDE domain is triangulated and this mesh is used to obtain discrete approximations of the continuous operators in the PDE. The energy of a mesh gives an upper bound on the error of the discrete diagonal approximation of the Hodge star operator. In practice, one begins with an initial mesh and then makes adjustments to produce a mesh of lower energy. However, we have discovered several shortcomings in directly optimizing this energy, e.g. its non-convexity, and we show that the search for an optimized mesh may lead to mesh inversion (malformed triangles). We propose a new energy function to address some of these issues.

  14. Air quality monitoring programme. Annual summary for 2004

    Energy Technology Data Exchange (ETDEWEB)

    Kemp, K.; Ellermann, T.; Palmgren, F.; Waehlin, P.; Berkowicz, R. Brandt. j.

    2005-07-15

    The air quality in Danish cities has been monitored continuously since 1982 within the Danish Air Quality (LMP) network. The aim has been to follow the concentration levels of toxic pollutants in the urban atmosphere and to provide the necessary knowledge to assess the trends, to perform source apportionment, and to evaluate the chemical reactions and the dispersion of the pollutants in the atmosphere. In 2004 the air quality was measured in four Danish cities and at two background sites. NO{sup 2} and PM10 were at several stations found in concentrations above EU limit values, which the Member States have to comply with in 2005 and 2010. While the concentrations for most other pollutants have been strongly decreasing since 1982, only a slight decrease has been observed for NO{sup 2}. The measurement has been supplemented with dispersion models for a number of streets in Copenhagen and Aalborg. (au)

  15. 131-7 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-07

    Dec 7, 2009 ... This interpretation of love that Jesus offers in his story gives ... philosophy, shed light on a possible new reading of sacred texts in which the question of identity ... neither can a home (oikos) offer hospitality to all as that would.

  16. 161---8 Dec 2009.indd [final version].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... United Kingdom population norms, preachers within this sample were ... University of Warwick, .... hand, feeling types make judgements based on subjective, personal values. ... and female Bible College students (Francis, Penson & Jones. 2001) .... link between psychological type preference and choice of.

  17. Tolerability and efficacy of single dose albendazole, diethylcarbamazine citrate (DEC) or co-administration of albendazole with DEC in the clearance of Wuchereria bancrofti in asymptomatic microfilaraemic volunteers in Pondicherry, South India: a hospital-based study

    OpenAIRE

    Pani, SP; Subramanyam Reddy, G; Das, LK; Vanamail, P; Hoti, SL; Ramesh, J; Das, PK

    2002-01-01

    Background The tolerability and efficacy of single dose albendazole (400 mg), diethylcarbamazine citrate (DEC) (6 mg/kg bodyweight) or co-administration of albendazole (400 mg) + DEC (6 mg/kg bodyweight) was studied in 54 asymptomatic Wuchereria bancrofti microfilaraemic volunteers in a double blind hospital-based clinical study. Results There was no significant difference in the overall incidence of adverse reactions between the three drug groups [42.1% (albendazole), 52.9% (DEC) and 61.1% (...

  18. Evidence-based medical review update: pharmacological and surgical treatments of Parkinson's disease: 2001 to 2004.

    Science.gov (United States)

    Goetz, Christopher G; Poewe, Werner; Rascol, Olivier; Sampaio, Cristina

    2005-05-01

    The objective of this study is to update a previous evidence-based medicine (EBM) review on Parkinson's disease (PD) treatments, adding January 2001 to January 2004 information. The Movement Disorder Society (MDS) Task Force prepared an EBM review of PD treatments covering data up to January 2001. The authors reviewed Level I (randomized clinical trials) reports of pharmacological and surgical interventions for PD, published as full articles in English (January 2001-January 2004). Inclusion criteria and ranking followed the original program and adhered to EBM methodology. For Efficacy Conclusions, treatments were designated Efficacious, Likely Efficacious, Non-Efficacious, or Insufficient Data. Four clinical indications were considered for each intervention: prevention of disease progression; treatment of Parkinsonism, as monotherapy and as adjuncts to levodopa where indicated; prevention of motor complications; treatment of motor complications. Twenty-seven new studies qualified for efficacy review, and others covered new safety issues. Apomorphine, piribedil, unilateral pallidotomy, and subthalamic nucleus stimulation moved upward in efficacy ratings. Rasagiline, was newly rated as Efficacious monotherapy for control of Parkinsonism. New Level I data moved human fetal nigral transplants, as performed to date, from Insufficient Data to Non- efficacious for the treatment of Parkinsonism, motor fluctuations, and dyskinesias. Selegiline was reassigned as Non-efficacious for the prevention of dyskinesias. Other designations did not change. In a field as active in clinical trials as PD, frequent updating of therapy-based reviews is essential. We consider a 3-year period a reasonable time frame for published updates and are working to establish a Web-based mechanism to update the report in an ongoing manner. Copyright 2005 Movement Disorder Society.

  19. 309 ----10 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... parable showed traces of the sola fidei principle of the Reformation, .... (j. Sanh. 6.23c par; j. Hagh. 2.77). This folk-tale ends where Bar .... Egyptian and Jewish accounts. ...... (1989:151), the dogs that licked Lazarus are most probably wild .... and to finance his extravagant building projects (the building of ...

  20. 286---15 Dec 2009.indd [Final version] .indd

    African Journals Online (AJOL)

    2009-12-15

    Dec 15, 2009 ... on economic ethics to assess economic processes in relation to how they serve life. ... justice and fellowship – as gifts of God – that serve as an orientation ..... total ban, and pleaded for money to be allowed to make a profit,.

  1. Trends and Sources of Zoonoses, Zoonotic Agents and Antimicrobial resistance in the European Union in 2004

    DEFF Research Database (Denmark)

    Helwigh, Birgitte

    EFSA's Community Summary Report on Trends and Sources of Zoonoses, Zoonotic Agents and Antimicrobial resistance in the European Union in 2004 was published in December 2005. The zoonoses, meaning infectious diseases transmissible from animals to humans, affected over 380,000 EU citizens in 2004....... Often the human form of the disease is acquired through contaminated food. According to the report, the two most frequently reported zoonotic diseases in humans were Salmonella and Campylobacter infections. These bacteria were also commonly found in food and animals. The report includes information...... of 11 zoonoses, antimicrobial resistance in zoonotic agents as well as foodborne outbreaks. The national zoonoses country reports which have been used as a basis for this Summary report are below. The utmost effort was made to keep the information in the Summary Report and the national reports identical...

  2. Obesity and socioeconomic status in developing countries: a systematic review

    OpenAIRE

    Dinsa, GD; Goryakin, Y; Fumagalli, E; Suhrcke, M

    2012-01-01

    Summary We undertook a systematic review of studies assessing the association between socioeconomic status (SES) and measured obesity in low- and middle-income countries (defined by the World Bank as countries with per capita income up to US$12,275) among children, men and women. The evidence on the subject has grown significantly since an earlier influential review was published in 2004. We find that in low-income countries or in countries with low human development index (HDI), the associat...

  3. Targeting Antigens to Dec-205 on Dendritic Cells Induces Immune Protection in Experimental Colitis in Mice

    Science.gov (United States)

    Wadwa, Munisch; Klopfleisch, Robert; Buer, Jan; Westendorf, Astrid M.

    2016-01-01

    The endocytotic c-type lectin receptor DEC-205 is highly expressed on immature dendritic cells. In previous studies, it was shown that antigen-targeting to DEC-205 is a useful tool for the induction of antigen-specific Foxp3+ regulatory T cells and thereby can prevent inflammatory processes. However, whether this approach is sufficient to mediate tolerance in mucosal tissues like the gut is unknown. In this study, we established a new mouse model in which the adoptive transfer of naive hemagglutinin (HA)-specific CD4+Foxp3– T cells into VILLIN-HA transgenic mice leads to severe colitis. To analyze if antigen-targeting to DEC-205 could protect against inflammation of the gut, VILLIN-HA transgenic mice were injected with an antibody–antigen complex consisting of the immunogenic HA110–120 peptide coupled to an α-DEC-205 antibody (DEC-HA) before adoptive T cell transfer. DEC-HA-treated mice showed significantly less signs of intestinal inflammation as was demonstrated by reduced loss of body weight and histopathology in the gut. Strikingly, abrogated intestinal inflammation was mediated via the conversion of naive HA-specific CD4+Foxp3– T cells into HA-specific CD4+Foxp3+ regulatory T cells. In this study, we provide evidence that antigen-targeting to DEC-205 can be utilized for the induction of tolerance in mucosal organs that are confronted with large numbers of exogenous antigens. PMID:27141310

  4. 272--11 Dec 2009 [final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.

  5. Weakening of one more alcohol control pillar: a review of the effects of the alcohol tax cuts in Finland in 2004.

    Science.gov (United States)

    Mäkelä, Pia; Osterberg, Esa

    2009-04-01

    To review the consequences of the changes in Finnish alcohol policy in 2004, when quotas for travellers' tax-free imports of alcoholic beverages from other European Union (EU) countries were abolished, Estonia joined the EU and excise duties on alcoholic beverages were reduced in Finland by one-third, on average. A review of published research and routinely available data. Finland. Prices of alcoholic beverages, recorded and unrecorded alcohol consumption, data on criminality and other police statistics, alcohol-related deaths and hospitalizations, service use. Alcohol consumption increased 10% in 2004, clearly more than in the early 2000s. With few exceptions, alcohol-related harms increased. Alcohol-induced liver disease deaths increased the most, by 46% in 2004-06 compared to 2001-03, which indicates a strong effect on pre-2004 heavy drinkers. Consumption and harms increased most among middle-aged and older segments of the population, and harms in the worst-off parts of the population in particular. Alcohol taxation and alcohol prices affect consumption and related harms, and heavy drinkers are responsive to price. In Finland in 2004, the worst-off parts of the population paid the highest price in terms of health for cuts in alcohol prices. The removal of travellers' import quotas, which was an inherent part of creating the single European market, had serious public health consequences in Finland.

  6. Esso Imperial Oil annual report to shareholders 2004 : 125 years of energy leadership

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This annual report presents financial information of Esso Imperial Oil to its shareholders, as well as a review of its 2004 operations. In 2004, the total return on shares was more than 25 per cent (TSX) and has averaged almost 20 per cent a year for the past 10 years. The highest earnings in the company's history were achieved in 2004, $2,052 million, a significant increase from the record $1,705 million earnings in 2003. In 2004, total distributions to shareholders were almost $1.2 billion, including $872 million to buy back around 14 million shares. Debt as a percentage of total capital was below 20 per cent. At year end, the balance of cash was $1,279 million. Capital expenditures for 2004 were $1,445 million. Investments included advancing major upstream projects and funding significant refinery upgrades to reduce sulphur levels in diesel fuel. Operating highlights included substantial progress on upstream projects with a focus on developing oil-sands leases in Alberta, natural gas in the Mackenzie Delta region of the Northwest Territories and offshore resources on Canada's East Coast. Total research expenditure in Canada was $38 million, with 3 new patents and 180 new or reformulated products commercialized. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements and common share information. This included accounts of Imperial Oil Inc., and its subsidiaries, as well as the company's proportionate share of the assets, liabilities, revenues, expenses and cash flows of joint ventures. Revenue and expenditure statements were summarized by source. tabs., figs.

  7. THE 3rd SCHIZOPHRENIA INTERNATIONAL RESEARCH SOCIETY CONFERENCE, 14-18 APRIL 2012, FLORENCE, ITALY: SUMMARIES OF ORAL SESSIONS

    Science.gov (United States)

    Abbs, Brandon; Achalia, Rashmin M; Adelufosi, Adegoke O; Aktener, Ahmet Yiğit; Beveridge, Natalie J; Bhakta, Savita G; Blackman, Rachael K; Bora, Emre; Byun, MS; Cabanis, Maurice; Carrion, Ricardo; Castellani, Christina A; Chow, Tze Jen; Dmitrzak-Weglarz, M; Gayer-Anderson, Charlotte; Gomes, Felipe V; Haut, Kristen; Hori, Hiroaki; Kantrowitz, Joshua T; Kishimoto, Taishiro; Lee, Frankie HF; Lin, Ashleigh; Palaniyappan, Lena; Quan, Meina; Rubio, Maria D; Ruiz de Azúa, Sonia; Sahoo, Saddichha; Strauss, Gregory P; Szczepankiewicz, Aleksandra; Thompson, Andrew D; Trotta, Antonella; Tully, Laura M; Uchida, Hiroyuki; Velthorst, Eva; Young, Jared W; O’Shea, Anne; DeLisi, Lynn E.

    2013-01-01

    The 3rd Schizophrenia International Research Society Conference was held in Florence, Italy, April 14-18, 2012.and this year had as its emphasis, “The Globalization of Research”. Student travel awardees served as rapporteurs for each oral session and focused their summaries on the most significant findings that emerged and the discussions that followed. The following report is a composite of these summaries. We hope that it will provide an overview for those who were present, but could not participate in all sessions, and those who did not have the opportunity to attend, but who would be interested in an update on current investigations ongoing in the field of schizophrenia research. PMID:22910407

  8. 16 CFR Appendix F to Part 698 - General Summary of Consumer Rights

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false General Summary of Consumer Rights F... FORMS AND DISCLOSURES Pt. 698, App. F Appendix F to Part 698—General Summary of Consumer Rights The... consumer. ER30NO04.002 ER30NO04.003 [69 FR 69787, Nov. 30, 2004] ...

  9. Technical Cooperation Report for 2004. Report by the Director General [supplement

    International Nuclear Information System (INIS)

    2005-09-01

    This report contains financial and statistical data supplementing the Technical Cooperation Report for 2004. Again this year, the information is grouped under three headings: a) Resources and contributions, b) Disbursement and implementation summaries and c) Non-financial indicators, which allow the reader to make a comprehensive review of all information related to one subject. However, in a continuing effort to provide concise and transparent information, changes have been made in some of the tables from the presentation in 2003. The countries are grouped by region in most of the tables. An alphabetical listing by region of all countries/territories is mentioned in this report. Unless otherwise specified, all amounts are expressed in United States dollars. As most figures are rounded to thousands of US dollars, the amounts in tables may not add up exactly to the totals shown due to rounding [fr

  10. Technical Cooperation Report for 2004. Report by the Director General [supplement

    International Nuclear Information System (INIS)

    2005-08-01

    This report contains financial and statistical data supplementing the Technical Cooperation Report for 2004. Again this year, the information is grouped under three headings: a) Resources and contributions, b) Disbursement and implementation summaries and c) Non-financial indicators, which allow the reader to make a comprehensive review of all information related to one subject. However, in a continuing effort to provide concise and transparent information, changes have been made in some of the tables from the presentation in 2003. The countries are grouped by region in most of the tables. An alphabetical listing by region of all countries/territories is mentioned in this report. Unless otherwise specified, all amounts are expressed in United States dollars. As most figures are rounded to thousands of US dollars, the amounts in tables may not add up exactly to the totals shown due to rounding [es

  11. Technical Cooperation Report for 2004. Report by the Director General [supplement

    International Nuclear Information System (INIS)

    2005-08-01

    This report contains financial and statistical data supplementing the Technical Cooperation Report for 2004. Again this year, the information is grouped under three headings: a) Resources and contributions, b) Disbursement and implementation summaries and c) Non-financial indicators, which allow the reader to make a comprehensive review of all information related to one subject. However, in a continuing effort to provide concise and transparent information, changes have been made in some of the tables from the presentation in 2003. The countries are grouped by region in most of the tables. An alphabetical listing by region of all countries/territories is mentioned in this report. Unless otherwise specified, all amounts are expressed in United States dollars. As most figures are rounded to thousands of US dollars, the amounts in tables may not add up exactly to the totals shown due to rounding [ru

  12. Technical Cooperation Report for 2004. Report by the Director General [supplement

    International Nuclear Information System (INIS)

    2005-07-01

    This report contains financial and statistical data supplementing the Technical Cooperation Report for 2004. Again this year, the information is grouped under three headings: a) Resources and contributions, b) Disbursement and implementation summaries and c) Non-financial indicators, which allow the reader to make a comprehensive review of all information related to one subject. However, in a continuing effort to provide concise and transparent information, changes have been made in some of the tables from the presentation in 2003. The countries are grouped by region in most of the tables. An alphabetical listing by region of all countries/territories is mentioned in this report. Unless otherwise specified, all amounts are expressed in United States dollars. As most figures are rounded to thousands of US dollars, the amounts in tables may not add up exactly to the totals shown due to rounding

  13. Anthropological Research in Light of Research-Ethics Review: Canadian Master's Theses, 1995-2004.

    Science.gov (United States)

    van den Hoonaard, Will C; Connolly, Anita

    2006-06-01

    DESPITE CLAIMS THAT RESEARCH-ETHICS review is changing or discouraging social research, there are no studies that have tested this assumption. Examining Canadian Master's theses in anthropology between 1995 and 2004, this paper explores the extent to which the theses represent a change in number, topic, or methodology in relation to formal ethicsreview guidelines that came into force in Canada in 2001. ProQuest Digital Dissertations reveals that the number of theses has increased, and that there has not been a noticeable shift from research involving humans to research based on archival data, or theoretical or review theses. However, there has been a very significant increase in research that is called ethnography, but that relies exclusively on interviews. Possible reasons for the halving of percent of ethnographic or participantobservation research are explored.

  14. Annual energy reviews-2004

    International Nuclear Information System (INIS)

    2005-01-01

    The important items related to energy in 2004 fiscal year on present state on 1) energy demand and supply, 2) development and research trends on application technology of energy resources, 3) development and research trends on technology of energy conversion, 4) environment, and 5) miscellaneous are described. On the first item, trend on energy demand and supply, present state of energy supply, and trend of business field on energy demand are explained. On the second item, petroleum, coal, natural gas, nuclear energy, natural energy, waste resources, and secondary energy resources are explained. On the third item, combustion theory, trend on boiler trend on industrial furnace, trend on engine, trend on high efficiency power generation technology are explained. And, on the last item, trend on environment problem, and developmental trend on environmental conversion technology are explained. (J.P.N.)

  15. Topics raised by the summary report of the first review meeting

    International Nuclear Information System (INIS)

    2001-01-01

    This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 7 of the document contains topics raised by the summary report of the first review meeting. The chapter covers status and position of the regulatory body, collective doses, effluents release trends, adoption of the ICRP 60 and basic safety standards, regulatory strategy, quality assurance, monitoring safety management, international cooperation, probabilistic safety assessment and safety improvement programmes

  16. Analysis of emission data from global commercial aviation: 2004 and 2006

    Directory of Open Access Journals (Sweden)

    J. T. Wilkerson

    2010-07-01

    Full Text Available The global commercial aircraft fleet in 2006 flew 31.26 million flights, burned 188.20 million metric tons of fuel, and covered 38.68 billion kilometers. This activity emitted substantial amounts of fossil-fuel combustion products within the upper troposphere and lower stratosphere that affect atmospheric composition and climate. The emissions products, such as carbon monoxide, carbon dioxide, oxides of nitrogen, sulfur compounds, and particulate matter, are not emitted uniformly over the Earth, so understanding the temporal and spatial distributions is important for modeling aviation's climate impacts. Global commercial aircraft emission data for 2004 and 2006, provided by the Volpe National Transportation Systems Center, were computed using the Federal Aviation Administration's Aviation Environmental Design Tool (AEDT. Continuous improvement in methodologies, including changes in AEDT's horizontal track methodologies, and an increase in availability of data make some differences between the 2004 and 2006 inventories incomparable. Furthermore, the 2004 inventory contained a significant over-count due to an imperfect data merge and daylight savings error. As a result, the 2006 emissions inventory is considered more representative of actual flight activity. Here, we analyze both 2004 and 2006 emissions, focusing on the latter, and provide corrected totals for 2004. Analysis of 2006 flight data shows that 92.5% of fuel was burned in the Northern Hemisphere, 69.0% between 30N and 60N latitudes, and 74.6% was burned above 7 km. This activity led to 162.25 Tg of carbon from CO2 emitted globally in 2006, more than half over three regions: the United States (25.5%, Europe (14.6, and East Asia (11.1. Despite receiving less than one percent of global emissions, the Arctic receives a uniformly dispersed concentration of emissions with 95.2% released at altitude where they have longer residence time than surface emissions. Finally, 85.2% of all

  17. Analysis of emission data from global commercial aviation: 2004 and 2006

    Science.gov (United States)

    Wilkerson, J. T.; Jacobson, M. Z.; Malwitz, A.; Balasubramanian, S.; Wayson, R.; Fleming, G.; Naiman, A. D.; Lele, S. K.

    2010-07-01

    The global commercial aircraft fleet in 2006 flew 31.26 million flights, burned 188.20 million metric tons of fuel, and covered 38.68 billion kilometers. This activity emitted substantial amounts of fossil-fuel combustion products within the upper troposphere and lower stratosphere that affect atmospheric composition and climate. The emissions products, such as carbon monoxide, carbon dioxide, oxides of nitrogen, sulfur compounds, and particulate matter, are not emitted uniformly over the Earth, so understanding the temporal and spatial distributions is important for modeling aviation's climate impacts. Global commercial aircraft emission data for 2004 and 2006, provided by the Volpe National Transportation Systems Center, were computed using the Federal Aviation Administration's Aviation Environmental Design Tool (AEDT). Continuous improvement in methodologies, including changes in AEDT's horizontal track methodologies, and an increase in availability of data make some differences between the 2004 and 2006 inventories incomparable. Furthermore, the 2004 inventory contained a significant over-count due to an imperfect data merge and daylight savings error. As a result, the 2006 emissions inventory is considered more representative of actual flight activity. Here, we analyze both 2004 and 2006 emissions, focusing on the latter, and provide corrected totals for 2004. Analysis of 2006 flight data shows that 92.5% of fuel was burned in the Northern Hemisphere, 69.0% between 30N and 60N latitudes, and 74.6% was burned above 7 km. This activity led to 162.25 Tg of carbon from CO2 emitted globally in 2006, more than half over three regions: the United States (25.5%), Europe (14.6), and East Asia (11.1). Despite receiving less than one percent of global emissions, the Arctic receives a uniformly dispersed concentration of emissions with 95.2% released at altitude where they have longer residence time than surface emissions. Finally, 85.2% of all flights by number in 2006

  18. PATRAM 2004 - The 14th international symposium on the packaging and transportation of radioactive materials. Conference proceedings

    International Nuclear Information System (INIS)

    2004-01-01

    The 14th International Symposium on the Packaging and Transport of Radioactive Materials, PATRAM 2004, was held at the Estrel Convention Center in Berlin, Germany, from 20-24 September 2004. PATRAM '04 was held under the auspices of the German Federal Ministry for Transport, Building and Housing (BMNBW), and was hosted by the German Bundesanstalt fur Materialforschung und -Prufung (BAM). Further, the conference was held in cooperation with the International Atomic Energy Agency (IAEA) and the US Institute for Nuclear Materials Management. As with past PATRAM conferences, this one covered a wide range of topics that are of concern to the nuclear materials transport industry; regulations, operations, technical analyses and testing, design, institutional issues, security, risk assessment and emergency response. Presentation of these topics was provided through a number of fora, plenary presentations, panel presentations, oral presentations, posters and technical tours. Coupled with the opening reception on Monday evening and the coffee breaks, a forum was provided at this PATRAM that allowed all participants ample opportunities to increase their technical knowledge, to learn about compelling issues around the world and to network with colleagues. (orig.)

  19. PATRAM 2004 - The 14th international symposium on the packaging and transportation of radioactive materials. Conference proceedings

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The 14th International Symposium on the Packaging and Transport of Radioactive Materials, PATRAM 2004, was held at the Estrel Convention Center in Berlin, Germany, from 20-24 September 2004. PATRAM '04 was held under the auspices of the German Federal Ministry for Transport, Building and Housing (BMNBW), and was hosted by the German Bundesanstalt fur Materialforschung und -Prufung (BAM). Further, the conference was held in cooperation with the International Atomic Energy Agency (IAEA) and the US Institute for Nuclear Materials Management. As with past PATRAM conferences, this one covered a wide range of topics that are of concern to the nuclear materials transport industry; regulations, operations, technical analyses and testing, design, institutional issues, security, risk assessment and emergency response. Presentation of these topics was provided through a number of fora, plenary presentations, panel presentations, oral presentations, posters and technical tours. Coupled with the opening reception on Monday evening and the coffee breaks, a forum was provided at this PATRAM that allowed all participants ample opportunities to increase their technical knowledge, to learn about compelling issues around the world and to network with colleagues. (orig.)

  20. Effects of mutants in bHLH region on structure stability and protein-DNA binding energy in DECs.

    Science.gov (United States)

    Kong, Yi; Wang, Zhen; Jia, Yanfei; Li, Ping; Hao, Shuhua; Wang, Yunshan

    2017-07-01

    The human DEC subfamily contains two highly conserved members belonging to basic helix-loop-helix (bHLH) transcription factors. This conserved family is spread widely among various species with the function of regulating various crucial molecular signaling pathways. Due to the significance of DECs for important biological processes, their relationship with diseases and the lack of experimentally proven structures, we have implemented a comparative modeling for the bHLH region of DECs as homodimers with themselves and heterodimers with HES-1. Three mutants with predicted roles in reducing intramolecular binding (H57A, R65A, and LL7879AA in DEC1 and LL7071AA in DEC2) were investigated on DEC monomers. Molecular dynamics (MD) simulations were also employed to evaluate the behavior of the mutant molecules in aqueous solution. The monomer was divided into subregions for accurate investigation. The fluctuation in the basic region of mutants was higher than that of wild-type molecules. The binding energy value between protein and DNA obviously increased in the homodimer harboring R65A mutants, which led to more unstable status between protein and DNA. Thus, the mutant R65A interfered DNA-binding affinity. A study on the spatial structures of wild-type and mutant DECs may facilitate functional prediction for mutation effects and dynamic behavior under various conditions and may ultimately help in targeted drug design.

  1. TMFunction data: 14 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available 0.14+_0.02 Ki (nM) Ki values for HU-210. ... CNR2_HUMAN (P34972) Helix ... Cannabinoids; CB2 receptor; G protein; Site directed mutagensis; adenylyl cyclase ...ens Human Rhee MH, Nevo I, Bayewitch ML, Zagoory O, Vogel Z J Neurochem. 2000 Dec;75(6):2485-91. AC activity

  2. 153--7 Dec 2009.indd [FINAL VERSION].indd

    African Journals Online (AJOL)

    2009-12-07

    Dec 7, 2009 ... Over the past century, many Western mission agencies and ... regard to travel.3 During this time, the evangelical movement influenced Korean Christians to become involved in world ... well as effective mission strategies and policies for the mature .... 'I have had no difficulties in adapting to the culture and.

  3. Opfølgning på bistand til risikovurdering. Fem forskellige afgrøder. Bt-resistens: oplysninger om Cry-type og pat-gen. Modtaget 22-07-2004, svar 09-08-2004

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta

    2012-01-01

    "Mail: Vi har nu set det eftersendte materiale igennem for B-notifikationerne: B/SE/04/6371 (Resume 2004-3), B/ES/04/11 (Resume 2004-13), B/ES/04/13 (Resume 2004-18), B/ES/04/15 (Resume 2004-14) og B/ES/04/16 (Resume 2004-18) De nye fortrolige oplysninger giver ikke anledning til nogen ændringer ...

  4. FY 1978-79 Zero-Base Budget Review. The Colorado State System of Community and Junior Colleges: A Summary.

    Science.gov (United States)

    Tollefson, Terrence A.

    Two reports are presented in this document prepared for the Colorado State Legislature. The first, a zero-base budget review, presents a summary of the characteristics of the student population served by Colorado's 11 junior colleges. The summary includes statistics on age range, state of residence, gender, ethnic background, types of financial…

  5. Molecular gradient for second-order Møller-Plesset perturbation theory using the divide-expand-consolidate (DEC) scheme

    DEFF Research Database (Denmark)

    Kristensen, Kasper; Jørgensen, Poul; Jansik, Branislav

    2012-01-01

    We demonstrate that the divide-expand-consolidate (DEC) scheme – which has previously been used to determine the second-order Møller–Plesset (MP2) correlation energy – can be applied to evaluate the MP2 molecular gradient in a linear-scaling and embarrassingly parallel manner using a set of local......-box manner to ensure that the error in the DEC-MP2 correlation energy compared to a standard MP2 calculation is proportional to a single input threshold denoted the fragment optimization threshold (FOT). The FOT also implicitly controls the error in the DEC-MP2 molecular gradient as substantiated...... by a theoretical analysis and numerical results. The development of the DEC-MP2 molecular gradient is the initial step towards calculating higher order energy derivatives for large molecular systems using the DEC framework, both at the MP2 level of theory and for more accurate coupled-cluster methods....

  6. 185---11 Dec 2009.indd Final version].indd

    African Journals Online (AJOL)

    2009-12-11

    Dec 11, 2009 ... period conceptions of how to live, despite death, coram Deo. ... analysing the moral sensitivities within these ancient holy texts without ... answer to the first question: No, not in any direct manner (what Smit [1992:316] terms deontological and .... is the case too now that hardly any Christian theologian of the.

  7. Direct Aminolysis of Ethoxycarbonylmethyl 1,4-Dihydropyridine-3-carboxylates

    Directory of Open Access Journals (Sweden)

    Brigita Vigante

    2015-11-01

    Full Text Available The ethoxycarbonylmethyl esters of 1,4-dihydropyridines were directly converted into carbamoylmethyl esters in the presence of 1,5,7-triazabicyclo[4.4.0]dec-5-ene (TBD in good to excellent yields under mild conditions. The use of TBD is crucial for the successful aminolysis of ethoxycarbonylmethyl ester of 1,4-dihydropyridines with secondary amines as without it the reaction does not proceed at all. The aminolysis reaction proceeded regioselectively, as the alkyl ester conjugated with the 1,4-dihydropyridine cycle was not involved in the reaction. Screening of other N-containing bases, such as triethylamine (TEA, pyridine, 4-(N,N-dimethylaminopyridine (DMAP, 1,8-diazabicyclo[5.4.0]undec-7-ene (DBU, 1,5-diazabicyclo[4.3.0]non-5-ene (DBN, imidazole, tetramethyl guanidine (TMG and 7-methyl-1,5,7-triazabicyclo[4.4.0]dec-5-ene (MTBD as catalysts revealed no activity in the studied reaction.

  8. Controlled trials to improve antibiotic utilization: a systematic review of experience, 1984-2004.

    Science.gov (United States)

    Parrino, Thomas A

    2005-02-01

    To review the effectiveness of interventions designed to improve antibiotic prescribing patterns in clinical practice and to draw inferences about the most practical methods for optimizing antibiotic utilization in hospital and ambulatory settings. A literature search using online databases for the years 1975-2004 identified controlled trials of strategies for improving antibiotic utilization. Due to variation in study settings and design, quantitative meta-analysis was not feasible. Therefore, a qualitative literature review was conducted. Forty-one controlled trials met the search criteria. Interventions consisted of education, peer review and feedback, physician participation, rewards and penalties, administrative methods, and combined approaches. Social marketing directed at patients and prescribers was effective in varying contexts, as was implementation of practice guidelines. Authorization systems with structured order entry, formulary restriction, and mandatory consultation were also effective. Peer review and feedback were more effective when combined with dissemination of relevant information or social marketing than when used alone. Several practices were effective in improving antibiotic utilization: social marketing, practice guidelines, authorization systems, and peer review and feedback. Online systems providing clinical information, structured order entry, and decision support may be the most promising approach. Further studies, including economic analyses, are needed to confirm or refute this hypothesis.

  9. Progress report on neutron science. April 1, 2004 - March 31, 2005

    International Nuclear Information System (INIS)

    Kurihara, Kazuo; Moriai, Atsushi; Matsuda, Masaaki

    2005-09-01

    This issue summarizes research progress in neutron science at Japan Atomic Energy Research Institute (JAERI) by utilizing the research reactor JRR-3 during the period between April 1, 2004 and March 31, 2005. This report contains highlights in research by 13 neutron research groups at JAERI and 91 summary articles. (author)

  10. Summary and analysis of water-quality data for the Arrowwood National Wildlife Refuge, east-central North Dakota, 1987-2004

    Science.gov (United States)

    Ryberg, Karen R.; Hiemenz, Gregory

    2009-01-01

    The Bureau of Reclamation collected water-quality samples at 16 sites on the James River and the Arrowwood National Wildlife Refuge, N. Dak., as part of its refuge-monitoring program from 1987-93 and as part of an environmental impact statement commitment from 1999-2004. Climatic and hydrologic conditions varied greatly during both sampling periods. The first period was dominated by drought conditions, which abruptly changed to cooler and wetter conditions in 1992-93. During the second period, conditions were near normal to very wet and included higher inflow from the James River into the refuge. The two periods also differed in the sites sampled, seasons sampled, and properties and constituent concentrations measured. Summary statistics were reported separately for the two sampling periods for all physical properties and constituents. Nonparametric statistical tests were used to further analyze some of the water-quality data. During the first sampling period, 1987-93, specific conductance, turbidity, hardness, alkalinity, total dissolved solids, total suspended solids, nonvolatile suspended solids, calcium, magnesium, sodium, potassium, sulfate, chloride, phosphate, total phosphorus, total organic carbon, chlorophyll a, and arsenic were determined to have significantly different medians among the sites tested. During the second sampling period, 1999-2004, the medians of pH, sodium, chloride, barium, and boron varied significantly among sites. Sites sampled and period of record varied between the two sampling periods and the period of record varied among the sites. Also, some constituents analyzed during the first period (1987-93) were not analyzed during the second period (1999-2004), and winter sampling was done during the second sampling period only. This variability reduces the number of direct comparisons that can be made between the two periods. Three sites had complete periods of record for both sampling periods and were compared. Differences in variability

  11. Nuclear Safety Review for the Year 2004

    International Nuclear Information System (INIS)

    2005-08-01

    In the nuclear area, challenges continue to emerge from the globalization of issues related to safety, technology, business, information, communication and security. Scientific advances and operational experience in nuclear, radiation, waste and transport technology are providing new opportunities to continuously improve safety and security by utilizing synergies between safety and security. The prime responsibility for nuclear, radiation, waste and transport safety rests with users and national governments. The Agency continues to support a Global Nuclear Safety Regime based on strong national safety infrastructures and widespread subscription to international legal instruments to maintain high levels of safety worldwide. Central to the Agency's role are the establishment of international safety standards and the provision for applying these standards, as well as the promotion of sharing information through managing the knowledge base. Nuclear power plant operational safety performance remains high throughout the world. Challenges facing the nuclear power industry include avoiding complacency, maintaining the necessary infrastructure, nuclear power plant ageing and long-term operation, as well as new reactor designs and construction. The research reactor community has a long history of safe operation. However nearly two-thirds of the world's operating research reactors are now over 30 years old and face safety and security challenges. In 2004, the Board of Governors approved the Code of Conduct on the Safety of Research Reactors to help address these challenges. In 2004, there was international consensus on radionuclide activity concentrations in materials below which regulatory controls need not apply. Key occupational radiation protection performance indicators continued to improve in 2004. Challenges include new medical practices where workers can receive high exposures, industrial radiography and worker exposure to naturally occurring radioactive material. New

  12. 77 FR 53865 - Export Trade Certificate of Review

    Science.gov (United States)

    2012-09-04

    ... DEPARTMENT OF COMMERCE International Trade Administration [Application No. 12-00004] Export Trade Certificate of Review ACTION: Notice of issuance of an Export Trade Certificate of Review to Colombia Poultry Export Quota, Inc. (``COLOM-PEQ)'') (Application 12-00004). SUMMARY: On August 14, 2012, the U.S...

  13. One-to-One Technology in K-12 Classrooms: A Review of the Literature from 2004 through 2014

    Science.gov (United States)

    Harper, Ben; Milman, Natalie B.

    2016-01-01

    This literature review examined empirical research conducted between 2004 and 2014 regarding 1:1 technologies in K-12 educational settings. Our overarching research question was: What does research tell us about 1:1 technology in K-12 classrooms? We used the constant-comparative method to analyze, code, and induce themes from 46 relevant articles.…

  14. Avaliação da anatomia de molares decíduos por meio de microtomografia computadorizada

    OpenAIRE

    Ana Caroline Fumes

    2013-01-01

    O conhecimento prévio da anatomia interna e externa dos dentes decíduos é de fundamental importância para o sucesso do tratamento endodôntico. O objetivo do presente estudo foi analisar a morfologia das raízes e dos canais radiculares de molares decíduos superiores e inferiores, por meio de microtomografia computadorizada (micro-CT). Foram usados 40 molares decíduos, divididos em quatro grupos, sendo 10 primeiros molares inferiores, 10 segundos molares inferiores, 10 primeiros molares superio...

  15. The effect of eight half-yearly single-dose treatments with DEC on Wuchereria bancrofti circulating antigenaemia

    DEFF Research Database (Denmark)

    Simonsen, Paul E; Magesa, Stephen M; Meyrowitsch, Dan W

    2005-01-01

    The effect of eight half-yearly treatment rounds with diethylcarbamazine (DEC; 6mg/kg bodyweight) on Wuchereria bancrofti-specific circulating filarial antigen (CFA), a marker of adult worm infection, was followed in 79 individuals who were CFA-positive before start of treatment. Half of these we...... values. Repeated DEC therapy thus appears to have a slow but profound and persistent macrofilaricidal effect, which in the long run may be beneficial to populations undergoing DEC-based control interventions by reducing the probability of future morbidity development....

  16. Annual report of the Association EURATOM-Cea 2004 (executive summary)

    International Nuclear Information System (INIS)

    2004-01-01

    Progress in fusion technology is constant over the years and this report once again highlights a number of important steps that have been accomplished in this domain. This document is the executive summary of the full annual report, summarizing activities performed by the EURATOM-Cea association. This report has been organized into 10 issues: 1) physics integration, 2) reactor vessel, 3) plasma facing components, 4) remote handling, 5) magnets structures, 6) tritium breeding blankets, 7) structural material, 8) safety and environment, 9) system study, and 10) ITER site preparation

  17. Progress report on neutron science. April 1, 2003 - March 31, 2004

    International Nuclear Information System (INIS)

    Matsuda, Masaaki; Kurihara, Kazuo; Moriai, Atsushi

    2005-03-01

    This issue summarizes research progress in neutron science at Japan Atomic Energy Research Institute (JAERI) by utilizing the research reactor JRR-3 during the period between April 1, 2003 and March 31, 2004. This report contains highlights in research from 10 neutron research groups at JAERI and summary reports of 82 papers. (author)

  18. European Patient Summary Guideline: Focus on Greece.

    Science.gov (United States)

    Berler, Alexander; Tagaris, Anastassios; Chronaki, Catherine

    2016-01-01

    The European Patient Summary (PS) guideline specifies a minimal dataset of essential and important information for unplanned or emergency care initially defined in the epSOS project with aim to improve patients' safety and quality of Care. The eHealth Network of European Union (EU) Member State (MS) representatives established under Article 14 of the EU directive 2011/24 on patient rights to cross-border healthcare adopted PS guideline in November 2013 and since then the guideline has been part of MS strategic eHealth implementation plans, standardization efforts, and concrete regional, national, European and international projects. This paper reviews implementation efforts for the implementation of an operational patient summary service in Greece drawing on challenges and lessons learned for sustainable standards-based large scale eHealth deployment in Europe and abroad, as well as the reuse of best practices from international standards and integration profiles.

  19. The social balance sheet 2004

    OpenAIRE

    Ph. Delhez; P. Heuse

    2005-01-01

    Each year, in the 4th quarter’s Economic Review, the National Bank examines the provisional results of the social balance sheets. As all the social balance sheets are not yet available for 2004, the study is based on a limited population of enterprises, compiled according to the principle of a constant sample. This population is made up of 38,530 enterprises employing around 1,331,000 workers in 2004. The main results of the analysis, in terms of employment, working hours, labour cost and tra...

  20. Podoplanin-mediated TGF-β-induced epithelial-mesenchymal transition and its correlation with bHLH transcription factor DEC in TE-11 cells.

    Science.gov (United States)

    Wu, Yunyan; Liu, Qiang; Yan, Xu; Kato, Yukio; Tanaka, Makiko; Inokuchi, Sadaki; Yoshizawa, Tadashi; Morohashi, Satoko; Kijima, Hiroshi

    2016-06-01

    Podoplanin is reported involved in the collective cell invasion, another tumor invasion style which is distinct from the single cell invasion, so-called epithelial-mesenchymal transition (EMT). In this study, we investigated the correlation between podoplanin and EMT-related markers in esophageal squamous cell carcinoma (ESCC), and evaluated its linkage with the basic helix-loop-helix (bHLH) transcription factor differentiated embryonic chondrocyte (DEC) 1 and DEC2. Three ESCC cell lines and human squamous cell carcinoma A431 cells were subjected to western blot analyses for podoplanin and EMT markers, as well as the expression of DEC1 and DEC2. By RT-qPCR and western blotting, we found that TGF-β increased the expression of podoplanin and mensenchymal markers (e.g., N-cadherin and vimentin), while decreased the expression of epithelial markers (e.g., Claudin-4 and E-cadherin), accompanied by Smad2 phosphorylation and slug activation. Moreover, TGF-β has different effects on the expression of DEC1 and DEC2, that is, it upregulates DEC1, but downregulates DEC2. Capability of cell proliferation, invasion and migration were further analyzed using CCK-8 assay, Matrigel-invasion assay, and the wound-healing assay, respectively. The proliferation, invasion and migration ability were significantly lost in podoplanin-knockdown cells when compared with the scrambled siRNA group. In addition to these changes, the expression of Claudin-4, but not that of Claudin-1 or E-cadherin, was induced by the siRNA against podoplanin. On the contrary, overexpression of DEC1 and DEC2 exhibits opposite effects on podoplanin, but only slight effect on Claudin-4 was detected. These data indicated that podoplanin is significantly associated with EMT of TE-11 cells, and may be directly or indirectly regulated by bHLH transcription factors DEC1 and DEC2.

  1. Dystrophin Expressing Chimeric (DEC) Human Cells Provide a Potential Therapy for Duchenne Muscular Dystrophy.

    Science.gov (United States)

    Siemionow, Maria; Cwykiel, Joanna; Heydemann, Ahlke; Garcia, Jesus; Marchese, Enza; Siemionow, Krzysztof; Szilagyi, Erzsebet

    2018-06-01

    Duchenne Muscular Dystrophy (DMD) is a progressive and lethal disease caused by mutations of the dystrophin gene. Currently no cure exists. Stem cell therapies targeting DMD are challenged by limited engraftment and rejection despite the use of immunosuppression. There is an urgent need to introduce new stem cell-based therapies that exhibit low allogenic profiles and improved cell engraftment. In this proof-of-concept study, we develop and test a new human stem cell-based approach to increase engraftment, limit rejection, and restore dystrophin expression in the mdx/scid mouse model of DMD. We introduce two Dystrophin Expressing Chimeric (DEC) cell lines created by ex vivo fusion of human myoblasts (MB) derived from two normal donors (MB N1 /MB N2 ), and normal and DMD donors (MB N /MB DMD ). The efficacy of fusion was confirmed by flow cytometry and confocal microscopy based on donor cell fluorescent labeling (PKH26/PKH67). In vitro, DEC displayed phenotype and genotype of donor parent cells, expressed dystrophin, and maintained proliferation and myogenic differentiation. In vivo, local delivery of both DEC lines (0.5 × 10 6 ) restored dystrophin expression (17.27%±8.05-MB N1 /MB N2 and 23.79%±3.82-MB N /MB DMD ) which correlated with significant improvement of muscle force, contraction and tolerance to fatigue at 90 days after DEC transplant to the gastrocnemius muscles (GM) of dystrophin-deficient mdx/scid mice. This study establishes DEC as a potential therapy for DMD and other types of muscular dystrophies.

  2. 14 CFR 23.605 - Fabrication methods.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fabrication methods. 23.605 Section 23.605... Fabrication methods. (a) The methods of fabrication used must produce consistently sound structures. If a... fabrication method must be substantiated by a test program. [Doc. No. 4080, 29 FR 17955, Dec. 18, 1964; 30 FR...

  3. Nuclear technology review 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-08-15

    The viability and credibility of a wide range of nuclear-based technologies require ready access to high-quality atomic, molecular and nuclear data. The demands of new nuclear technologies continue to determine the direction(s) of future data development, including the requirements for data that address innovative fuel cycles, accelerator-driven systems, nuclear incineration, fusion devices, diagnostic and therapeutic medical treatment by radiation, optimization of medical isotope production, non-destructive materials testing, radiation analytical techniques, minerals exploration and land-mine detection. Some recent data development projects with diverse applications are a search engine for Atomic and Molecular data to permit simultaneous data retrieval from a number of different sources for both numerical and bibliographic databases to aid designers. For over 50 years, research reactors have made valuable contributions to the development of nuclear power, basic science, materials development, radioisotope production for medicine and industry, and education and training. They remain core experimental instruments. As of June 2004, 672 research reactors are recorded in the IAEA's Research Reactor Data Base (RRDB), of which 274 are operational in 56 countries (85 in 39 developing countries), 214 are shut down, 168 have been decommissioned and 16 are planned or under construction. Nuclear power supplied 16% of global electricity generation in 2002, and as of 31 December 2003 there were 439 NPPs operating worldwide. Their global energy availability factor has risen steadily from 74.2% in 1991 to approximately 84% in 2003. In 2003 two new NPPs were connected to the grid, a 665 MW(e) pressurized heavy water reactor (PHWR) in China and a 960 MW(e) pressurized water reactor (PWR) in the Republic of Korea. In addition Canada restarted two units that had been shutdown. Construction started on one new NPP in India. Four 50 MW(e) units in the UK were retired, as were one 640 MW

  4. Nuclear technology review 2004

    International Nuclear Information System (INIS)

    2004-08-01

    The viability and credibility of a wide range of nuclear-based technologies require ready access to high-quality atomic, molecular and nuclear data. The demands of new nuclear technologies continue to determine the direction(s) of future data development, including the requirements for data that address innovative fuel cycles, accelerator-driven systems, nuclear incineration, fusion devices, diagnostic and therapeutic medical treatment by radiation, optimization of medical isotope production, non-destructive materials testing, radiation analytical techniques, minerals exploration and land-mine detection. Some recent data development projects with diverse applications are a search engine for Atomic and Molecular data to permit simultaneous data retrieval from a number of different sources for both numerical and bibliographic databases to aid designers. For over 50 years, research reactors have made valuable contributions to the development of nuclear power, basic science, materials development, radioisotope production for medicine and industry, and education and training. They remain core experimental instruments. As of June 2004, 672 research reactors are recorded in the IAEA's Research Reactor Data Base (RRDB), of which 274 are operational in 56 countries (85 in 39 developing countries), 214 are shut down, 168 have been decommissioned and 16 are planned or under construction. Nuclear power supplied 16% of global electricity generation in 2002, and as of 31 December 2003 there were 439 NPPs operating worldwide. Their global energy availability factor has risen steadily from 74.2% in 1991 to approximately 84% in 2003. In 2003 two new NPPs were connected to the grid, a 665 MW(e) pressurized heavy water reactor (PHWR) in China and a 960 MW(e) pressurized water reactor (PWR) in the Republic of Korea. In addition Canada restarted two units that had been shutdown. Construction started on one new NPP in India. Four 50 MW(e) units in the UK were retired, as were one 640 MW

  5. Dioxin air emission inventory 1990-2004

    Energy Technology Data Exchange (ETDEWEB)

    Capral Henriksen, T; Illerup, J B; Nielsen, Ole-Kenneth [DMU, Dept. of Policy Analysis (Denmark)

    2006-12-15

    The present Danish dioxin air emission inventory shows that the emission has been reduced from 68.6 g I-TEQ in 1990 to 22.0 g I-TEQ in 2004, or about 68% over this period. Most of the significant reductions have been achieved in the industrial sector, where emissions have been reduced from 14.67 g I-TEQ in 1990 to 0.17 g I-TEQ in 2004; a reduction of almost 99%. Lower emissions from steel and aluminium reclamation industries form the major part of the reduction within industry. Emissions from waste incineration reduced from 32.5 g I-TEQ in 1990 to 2.1 g ITEQ in 2004; which is approx. 94%. This is due to installation of dioxin abatement equipment in incineration plants. The most important source of emission in 2004 is residential wood combustion, at 8.5 g I-TEQ, or around 40% of the total emission. In 2004, accidental fires, which are estimated to emit 6.1 g I-TEQ/year, are the second most important source, contributing with around 28% of the total emission. The present dioxin emission inventory for Denmark shows how emissions in 2004 come from sources other than waste incineration plants and industry, which were the largest sources in 1990. (au)

  6. What Does 14th March Mean to Us

    Directory of Open Access Journals (Sweden)

    Şerife Mehlika Kuşkonmaz

    2015-01-01

    Full Text Available This short review aims to give a summary of modernization in medical education in the last century of Ottoman Empire in spite of the inevitable decline in economics and politics and to draw a link to March 14th which is first celebrated in 1919 by medical students of Mekteb-i Tıbbiye-i Şahane as a protest to the occupation of Istanbul.

  7. Encana Corp. annual report 2004

    International Nuclear Information System (INIS)

    2004-01-01

    This paper presents a financial review of Encana Corporation, a company with a strategic focus on North American natural gas and Canadian oil sands. Eighty-five per cent of its operating cash flow is from natural gas and fluids. Strategic assets were considered to be high-quality, long-life resource plays combined with extensive proved reserves and resource potential. The focus of Encana is on large reservoirs with large-scale drilling programs. Their primary goal in 2004 was to continue to increase net asset value per share by balancing capital investment between development of its large inventory of resource plays and the return of capital to shareholders. Performance highlights included 28 per cent natural gas reserves growth per share; 21 per cent natural gas sales growth per share; and 286 per cent natural gas production replacement with a proved reserve life index of 9.5 years. Net earnings were $3.5 billion, up 53 per cent over the previous year. Details of the corporation's risk management program were provided, as well as details of global activities. Technological advances were detailed, with a summary of key events and financial results. Highlights of continuing operations and operating earnings included: crude oil and natural gas liquids, capital expenditures including upstream core capital and activities on the East coast. Discontinued operations were also listed. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements and common share information. This included accounts, as well as the company's proportionate share of the assets, liabilities, revenues, expenses and cash flows of joint ventures. Revenue and expenditure statements were summarized by source. tabs., figs

  8. Institutional delivery in India, 2004-14: unravelling the equity-enhancing contributions of the public sector.

    Science.gov (United States)

    Joe, William; Perkins, Jessica M; Kumar, Saroj; Rajpal, Sunil; Subramanian, S V

    2018-06-01

    To achieve faster and equitable improvements in maternal and child health outcomes, the government of India launched the National Rural Health Mission in 2005. This paper describes the equity-enhancing role of the public sector in increasing use of institutional delivery care services in India between 2004 and 2014. Information on 24 661 births from nationally representative survey data for 2004 and 2014 is analysed. Concentration index is computed to describe socioeconomic-rank-related relative inequalities in institutional delivery and decomposition is used to assess the contributions of public and private sectors in overall socioeconomic inequality. Multilevel logistic regression is applied to examine the changes in socioeconomic gradient between 2004 and 2014. The analysis finds that utilization of institutional delivery care in India increased from 43% in 2004 to 83% in 2014. The bulk of the increase was in public sector use (21% in 2004 to 53% in 2014) with a modest increase in private sector use (22% in 2004 to 30% in 2014). The shift from a pro-rich to pro-poor distribution of public sector use is confirmed. Decomposition analysis indicates that 51% of these reductions in socioeconomic inequality are associated with improved pro-poor distribution of public sector births. Multilevel logistic regressions confirm the disappearance of a wealth-based gradient in public sector births between 2004 and 2014. We conclude that public health investments in India have significantly contributed towards an equitable increase in the coverage of institutional delivery care. Sustained policy efforts are necessary, however, with an emphasis on education, sociocultural and geographical factors to ensure universal coverage of institutional delivery care services in India.

  9. Incidence of type 1 diabetes mellitus in 0 to 14-yr-old children in Croatia--2004 to 2012 study.

    Science.gov (United States)

    Rojnic Putarek, Natasa; Ille, Jasenka; Spehar Uroic, Anita; Skrabic, Veselin; Stipancic, Gordana; Krnic, Nevena; Radica, Ana; Marjanac, Igor; Severinski, Srecko; Svigir, Alen; Bogdanic, Ana; Dumic, Miroslav

    2015-09-01

    The incidence of type 1 diabetes mellitus (T1DM) among children and adolescents increased during the last 50 yr. The T1DM incidence in Croatia was 8.87/100.000/yr over 1995-2003, with an annual increase of 9%, which placed Croatia among countries with moderate risk for T1DM. To investigate incidence rates and trends of T1DM from 2004 to 2012 in 0 to 14-yr-old Croatian children, and to compare the results with previous studies in Croatia and other European countries. T1DM crude incidence rates are estimated for the entire group and three subgroups: 0-4, 5-9, and 10-14 yr. Standardized incidence is calculated using the method of direct standardization according to World Health Organization (WHO) standard world population. The incidence rates by gender, age groups, seasonality, and calendar year, and their interactions were analyzed using Poisson regression model. A total of 1066 cases were ascertained over 2004-2012. The standardized incidence was 17.23/100.000/yr (95% CI: 16.19-18.26), with no significant differences in incidence rates or trends between boys and girls. Statistically significant annual increase of 5.87% (p Croatia, thus placing Croatia among countries with high risk for T1DM. The annual increment of 5.87% is considerably lower than 9.0% reported earlier, but still higher than the European average (3.9%). The increase in incidence ceased in youngest children. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  10. 14 CFR 1260.75 - Summary of report requirements.

    Science.gov (United States)

    2010-01-01

    ... AGREEMENTS General Post-Award Requirements § 1260.75 Summary of report requirements. (a) Intermediate report.... Instructions and answers to payment questions will be provided by the NASA Financial Management Office of the Center that has been assigned financial cognizance of the grant. (See § 1260.152.) (2) The annual...

  11. Genetics Home Reference: Tangier disease

    Science.gov (United States)

    ... Maxfield FR, Tabas I. Role of cholesterol and lipid organization in disease. Nature. 2005 Dec 1;438(7068):612-21. ... Hubácek JA. ATP-binding cassette (ABC) transporters in human metabolism and diseases. Physiol Res. 2004;53(3):235-43. Review. ...

  12. 76 FR 6094 - FAA Public Forum To Conduct Regulatory Review

    Science.gov (United States)

    2011-02-03

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Parts 27 and 29 FAA Public Forum To Conduct Regulatory Review AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of public meeting. SUMMARY: The FAA announces an informal meeting to discuss the FAA rotorcraft rules, 14...

  13. Summary Report of Working Group: Laser-Plasma Acceleration

    International Nuclear Information System (INIS)

    Esarey, Eric; Schroeder, Carl B.; Tochitsky, Sergei; Milchberg, Howard M.

    2004-01-01

    A summary is given on the work presented and discussed in the Laser-Plasma Acceleration Working Group at the 2004 Advanced Accelerator Concepts Workshop, including the Plasma Acceleration Subgroup (Group-Leader: Eric Esarey; Co-Group-Leader: Sergei Tochitsky) and the Plasma Guiding Subgroup (Group-Leader: Howard Milchberg; Co-Group-Leader: Carl Schroeder)

  14. Proceedings of the ninth annual DOE low-level waste management forum: executive summary, technical and special session summaries, attendees

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    This first volume of proceedings contains summaries of each of six technical sessions as well as three special sessions held during the conference. The six technical sessions were: Disposal technology and facility development (15 papers); Institutional and regulatory issues (10); Performance assessment (14); Waste characterization and verification (7); Site closure and stabilization (6); and Waste treatment (8). The three special sessions were: 1) Review of criteria for guidance on alternative disposal technology; 2) Hazardous waste regulatory update; and 3) Challenges to meeting the 1993 deadline. All papers have been indexed for inclusion on the Energy Data Base

  15. 49 CFR 392.14 - Hazardous conditions; extreme caution.

    Science.gov (United States)

    2010-10-01

    ... CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS DRIVING OF COMMERCIAL MOTOR VEHICLES Driving of Commercial Motor Vehicles § 392.14 Hazardous conditions... nearest point at which the safety of passengers is assured. [33 FR 19732, Dec. 25, 1968, as amended at 60...

  16. Biomass Program 2007 Program Peer Review - Biodiesel and Other Technologies Summary

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2009-10-28

    This document discloses the comments provided by a review panel at the U.S. Department of Energy Office of the Biomass Program Peer Review held on November 15-16, 2007 in Baltimore, MD and the Biodiesel and Other Technologies, held on August 14th and 15th in Golden, Colorado.

  17. Savannah River Site Environmental Report for 2004

    International Nuclear Information System (INIS)

    Mamatey, Albert R.

    2005-01-01

    The Savannah River Site Environmental Report for 2004 (WSRC-TR-2005-00005) is prepared for the U.S. Department of Energy (DOE) according to requirements of DOE Order 231.1A, ''Environment, Safety and Health Reporting,'' and DOE Order 5400.5, ''Radiation Protection of the Public and Environment''. The report's purpose is to present summary environmental data that characterize site environmental management performance; confirm compliance with environmental standards and requirements; highlight significant programs and efforts; and assess the impact of SRS operations on the public and the environment

  18. Review of Non-Neutron and Neutron Nuclear Data, 2004

    International Nuclear Information System (INIS)

    Holden, Norman E.

    2005-01-01

    Review articles are in preparation for the 2004 edition of the CRC Handbook of Chemistry and Physics dealing with the evaluation of both non-neutron and neutron nuclear data. Data on the discovery of element 110, Darmstadtium, and element 111 have been officially accepted, while data on element 118 have been withdrawn. Data to be presented include revised values for very short-lived nuclides, long-lived nuclides, and beta-beta decay measurements. There has been a reassessment of the spontaneous fission (sf) half-lives, which distinguishes between sf decay half-lives and cluster decay half-lives, and with cluster-fission decay. New measurements of isotopic abundance values for many elements will be discussed with an emphasis on the minor isotopes of interest for use in neutron activation analysis measurements. Neutron resonance integrals will be discussed emphasizing the differences between the calculated values obtained from the analytical integration over neutron resonances and the measured values in a neutron reactor-spectrum, which does not quite conform to the assumed 1/E neutron energy spectrum. The method used to determine the neutron resonance integral from measurement, using neutron activation analysis, will be discussed

  19. LLE Review Quarterly Report (July - September 2004). Volume 100

    Energy Technology Data Exchange (ETDEWEB)

    Schmid, Ansgar W. [Univ. of Rochester, NY (United States). Lab. for Laser Energetics

    2004-09-01

    The key article in this volume of the LLE Review, covering July-September 2004, addresses "Shock Propagation in Deuterium-Tritium-Saturated Foam" by T. J. B. Collins (LLE) and A. Poludnenko, A. Cunningham, and A. Frank (UR, Department of Physics and Astronomy) (p. 227). Testing the assumption of homogeneous mixing in fibrous foams saturated with cryogenic deuterium and tritium, shock passage in wetted-foam mixtures was simulated by the adaptive-mesh, two-dimensional hydrodynamic code AstroBEAR. For foam fibers of diameter ~1/10 µm and relevant foam densities, the mixing length behind the shock is found to be of the order of microns. Transverse motion dampens out sufficiently that, at the mixing region's edge farthest from the shock, Rankine-Hugoniot jump conditions are obeyed to within a few percent and shock speeds are also within a few percent of their homogeneous values. In addition, questions of feedthrough and feedout are addressed, showing that the stability of the shock front, once it leaves the wetted-foam layer, minimizes the effect of feedthrough. As a result, simulations of whole-foam-pellet implosions may model the wetted foam as a homogeneous mixture.

  20. 2004 Guidelines for Advancement and Promotion

    CERN Multimedia

    2004-01-01

    Original : English 1- General The Director-General has now fixed the guidelines and schedule for the 2004 annual advancement review in the framework of the Merit Advancement and Promotion Scheme (MAPS). Procedures are set out in Administrative Circular 26 (Rev. 4). Decisions will be made, where possible, by 1 July 2004 except for career path changes for staff in Career Paths A to D which will be made by 31 October 2004 and applied retroactively to 1 July 2004. The calendar for the interviews has been fixed between 1 January and 31 March 2004. Departments are invited to strictly comply with the target date of 31 March. Exceptions due to particular circumstances (e.g. long-term absences) must be documented. 2- Budget guidelines Within the annual advancement budget, the guideline allocations have been defined by the Director-General on a departmental basis for staff in Career Paths A to E and on a CERN-wide basis for staff in Career Paths F and G. Within their global advancement allocations, Department Head...

  1. Health System Decision Makers' Feedback on Summaries and Tools Supporting the Use of Systematic Reviews: A Qualitative Study

    Science.gov (United States)

    Ellen, Moriah E.; Lavis, John N.; Wilson, Michael G.; Grimshaw, Jeremy; Haynes, R. Brian; Ouimet, Mathieu; Raina, Parminder; Gruen, Russell

    2014-01-01

    Health system managers and policy makers need timely access to high quality, policy-relevant systematic reviews. Our objectives were to obtain managers' and policy makers' feedback about user-friendly summaries of systematic reviews and about tools related to supporting or assessing their use. Our interviews identified that participants prefer key…

  2. CROATIAN FISHERIES IN 2004

    Directory of Open Access Journals (Sweden)

    Irena Jahutka

    2005-10-01

    Full Text Available This work deals with all the relevant statistic data regarding fisheries of Republic of Croatia, including freshwater fisheries data (aquaculture of fish and other aquatic organisms, commercial and sports fisheries, marine fisheries data (mariculture, commercial fisheries, small–scale fisheries and processing of fish and other marine organisms, as well as data about import and export of fish and fish products and the data about financial subventions in fisheries. Regarding aquaculture (freshwater fish farming in 2004 there have been noticed slight changes comparing to 2003. The total freshwater fish production in 2004 was 5,618 tons (4,259 tons of warm–water species and 1,359 tons of cold–water species. Total areas and production areas were increased comparing to 2003 (total areas 1.94% and production areas 5.42%. Total catch of freshwater fish in 2004 was 567 tons. The total marine fish species production was increased cca. 20% comparing to 2003. Mussels farming, which is slightly increasing since 1999, during 2004 was decreased, while oysters farming were stagnating. The catch of marine fish was increased by 9.74% comparing to 2003. The biggest increase is noticed regarding catch of demersal and other fish species. As well as the increase of the total catch, the number of commercial fishermen and fishing vessels was also increased in 2003. The number of fishermen who fish for their own consumption (without the right to sell fish–small scale fishermen in 2004 was 13,700. The total production of fish products in 2004 was 14,270 tons, which is 24.89% less comparing to 2003. Along this decrease, there has been also noticed an increasing trend of the production assortments, specially salted anchovy. The value of import in 2004 was higher than the value of export, although the export/import balance was higher in amount on the import side. Financial subventions payments in 2004 were 67.21% higher comparing to the first year of payments (1997

  3. FOR INFORMATION - A Series of Seminars about NICE Environment during May / June 2004

    CERN Multimedia

    IT Department

    2004-01-01

    Recently deployed at CERN, Windows XP and Office 2003 offer new functionalities. IT/IS Group has prepared a series of seminars to both introduce the CERN NICE environment to beginners and also to show how to benefit from the advanced features offered by the new versions of Windows and Office. Particular attention will be paid to Collaborative Tasks, like reviewing a document, planning a meeting and to Mobile Computing like working offline, remotely accessing CERN resources, etc.. The topics and the dates are as follows: - Windows XP, une nouvelle experience (FR), Tuesday, 11th May 2004, 14.30 hrs. - Windows XP: a new experience (EN), Tuesday 8th of June, 14:30. - Lire votre email et plus avec Outlook 2003 (FR), Thursday 27th of May, 14:30. - Read your mail and more with Outlook 2003 (EN), Thursday 10th of June, 14:30. - Creer des documents Office avec Windows Word 2003 et Excel 2003 (FR), Thursday 3rd of June, 14:30. - Make Office documents with Windows Word 2003 and Excel 2003 (EN), Thursday 17th of June, 1...

  4. Field test measurements and system optimisation at a solar operated DEC ventilation system at industrial use; Feldtest-Messungen und Systemoptimierung an einer solarbetriebenen DEC-Klimatisierungsanlage im industriellen Einsatz

    Energy Technology Data Exchange (ETDEWEB)

    Bader, Tobias; Finkenzeller, Michael; Trinkl, Christoph; Zoerner, Wilfried [Hochschule Ingolstadt (Germany). Kompetenzfeld Erneuerbare Energien

    2010-07-01

    The field of competence for renewable energy at the Ingolstadt University (Federal Republic of Germany) examines and optimizes an innovative, solar powered air conditioning system with DEC technology (DEC = Desiccant and Evaporative Cooling) in a multi-functional industrial buildings. In addition to a geothermal heat pump system for basic energy supply of heating and cooling, the building is fitted with two solar thermal solar collector panels and a sorption supported air conditioning system. This air conditioner consists of two units, each with a nominal air flow of 8,000 m{sup 3} per hour. The two solar collector panels provide the heat necessary for the regeneration of the sorption rotors and support the domestic preparation of hot water.

  5. Proceedings of the 5. 2004 energy meetings

    International Nuclear Information System (INIS)

    2004-01-01

    The energy meetings is the biggest annual event for French local communities in the energy domain. The public is mainly composed of officials, representatives from local communities, institutions, private organisations and associations. The aim of the meetings is to debate and exchange on the actions to be implemented at the regional scale by local authorities in order to meet the climate and energy challenges of the century. Deregulation of energy markets for professionals, including the local authorities, in July 2004, represents a major step in the complete process of fully opening up to competition of the French energy sector. How to prepare to this important event, who will be our tomorrows' interlocutors and what will be their responsibilities have been the main questions addressed at these meetings. This 2004 edition is organised around 12 workshops. These proceedings brings together the available material: a summary of the meetings, a synthesis of the workshops, and the presentations (slides) given during the workshops with their abstracts

  6. Five-year summary and evaluation of operations and performance of the Utica aquifer and North Lake Basin Wetlands restoration project in 2004-2009.

    Energy Technology Data Exchange (ETDEWEB)

    LaFreniere, L. M. (Environmental Science Division)

    2011-09-13

    This document reviews the performance of the groundwater (and wetlands) restoration program implemented by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) at the former CCC/USDA grain storage facility in Utica, Nebraska, during the first five years (2004-2009) of this initiative. The report summarizes treatment system operational data and regulatory compliance monitoring results for the site during this period, together with the results of the targeted groundwater sampling and analysis for volatile organic compounds (VOCs) conducted in early 2010 (following completion of the fifth year of systems operation), to assess the initial five years of progress of the Utica remediation effort. On the basis of the 2003 groundwater sampling results, a remedial system employing 4 extraction wells (GWEX1-GWEX4), with groundwater treatment by spray irrigation and conventional air stripping, was implemented with the concurrence of the CCC/USDA and the agencies (Table 1.1). The principal components of the system are shown in Figure 1.3 and are briefly described in Section 1.2. Operation of well GWEX4 and the associated air stripper began on October 29, 2004, and routine operation of wells GWEX1-GWEX3 and the spray irrigation treatment units began on November 22, 2004.

  7. 1609.pdf | dec102000 | currsci | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; currsci; dec102000; 1609.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the ...

  8. ULSGEN (Uplink Summary Generator)

    Science.gov (United States)

    Wang, Y.-F.; Schrock, M.; Reeve, T.; Nguyen, K.; Smith, B.

    2014-01-01

    Uplink is an important part of spacecraft operations. Ensuring the accuracy of uplink content is essential to mission success. Before commands are radiated to the spacecraft, the command and sequence must be reviewed and verified by various teams. In most cases, this process requires collecting the command data, reviewing the data during a command conference meeting, and providing physical signatures by designated members of various teams to signify approval of the data. If commands or sequences are disapproved for some reason, the whole process must be restarted. Recording data and decision history is important for traceability reasons. Given that many steps and people are involved in this process, an easily accessible software tool for managing the process is vital to reducing human error which could result in uplinking incorrect data to the spacecraft. An uplink summary generator called ULSGEN was developed to assist this uplink content approval process. ULSGEN generates a web-based summary of uplink file content and provides an online review process. Spacecraft operations personnel view this summary as a final check before actual radiation of the uplink data. .

  9. Columbia River System Operation Review final environmental impact statement. Summary

    International Nuclear Information System (INIS)

    1995-11-01

    The Columbia River System Operation Review (SOR) is being conducted jointly by the US Army Corps of Engineers, the Bureau of Reclamation, and the Bonneville Power Administration. This summary of the SOR story begins where the Draft EIS summary left off. It is divided into seven parts, each of which reports some aspect of the study's outcome: Part 1 is a history. The SOR was not a simple study on any level, and to understand the EIS alternatives, some background is necessary. Part 2 reports the major findings of the technical analysis of alternative system operating strategies, and presents the agencies' Preferred Alternative. Part 3 explains actions the agencies may take with respect to the Columbia River Regional Forum, the Pacific Northwest Coordination Agreement, and the Canadian Entitlement Allocation Agreements. Part 4 presents the Purpose and Need, elements at the core of any Federal EIS. It includes a map showing the Columbia River Basin and information on the affected Federal projects. Part 5 describes the substantial public participation and outreach that occurred during the SOR, and Part 6 summarizes efforts to incorporate the Tribal perspective into the study. Part 7 describes other activities that will be taking place in the next few years, which are related to and build upon the SOR

  10. The Disasters Emergency Committee (DEC) and the Humanitarian Industry in Britain, 1963-85.

    Science.gov (United States)

    Jones, Andrew

    2015-01-01

    This article explores the history of modern British humanitarianism. Specifically, it charts the rise of an extensive humanitarian aid 'industry' in Britain, between 1963 and 1985. It does so through a focus on the Disasters Emergency Committee (DEC), an umbrella body for joint emergency fundraising established in 1963. The DEC is an enduring and important presence in the British humanitarian landscape, as it brings together leading aid agencies to make fundraising campaigns on television after major disasters. This article represents the first systematic historical analysis of the DEC, which it uses to illuminate larger questions about the politics of non-state humanitarianism, state-voluntary sector relations, the political impact of television, and the end of empire. It is shown that while DEC appeals fuelled the growth of its members, this was also a problematic process. Many principal aid agencies wished to shift their focus away from short-term disaster relief work to tackling the long-term structural causes of global poverty instead. It is argued that, despite an increasing political focus, humanitarian organizations were constrained from doing so by the power of television; a perceived lack of public support; the interventions of the British government; and competition between aid agencies in a crowded marketplace. Consequently, continued involvement in short-term, apolitical emergency assistance remained a requirement even for agencies sceptical about its value and impact. This analysis complicates linear narratives of a transition from emergency relief to development aid in post-war British humanitarianism, instead presenting the period as characterized by competing and even contradictory trajectories.

  11. 14 CFR 23.673 - Primary flight controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Primary flight controls. 23.673 Section 23... Control Systems § 23.673 Primary flight controls. Primary flight controls are those used by the pilot for the immediate control of pitch, roll, and yaw. [Doc. No. 4080, 29 FR 17955, Dec. 18, 1964, as amended...

  12. Small x phenomenology. Summary of the 3rd Lund small x workshop in 2004

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, J.R. [Cavendish Lab., Cambridge Univ. (United Kingdom); Baranov, S. [Lebedev Inst. of Physics, Moscow (Russian Federation); Bartels, J. [Hamburg Univ. (DE). FRG] (and others)

    2006-04-15

    A third workshop on small-x physics, within the Small-x Collaboration, was held in Hamburg in May 2004 with the aim of overviewing recent theoretical progress in this area and summarizing the experimental status. (Orig.)

  13. Small x phenomenology. Summary of the 3rd Lund small x workshop in 2004

    International Nuclear Information System (INIS)

    Andersen, J.R.; Baranov, S.; Bartels, J.

    2006-04-01

    A third workshop on small-x physics, within the Small-x Collaboration, was held in Hamburg in May 2004 with the aim of overviewing recent theoretical progress in this area and summarizing the experimental status. (Orig.)

  14. Robertsonian translocation 13/14 associated with rRNA genes ...

    African Journals Online (AJOL)

    Alexander A. Dolskiy

    2017-12-01

    Dec 1, 2017 ... Results: We describe a family case of a translocation rob (13; 14) and elevated rRNA expression in the proband with ..... Clin Genet 2010;78:299–309. ... [9] Bertini V, Fogli A, Bruno R, Azzarà A, Michelucci A, Mattina T, et al.

  15. German nuclear law day 2004 - a conference report

    International Nuclear Information System (INIS)

    Anon.

    2005-01-01

    Topical issues of nuclear law constituted the main subjects discussed at the 2004 German Nuclear Law Day organized in Berlin on November 11 to 12, 2004. The agenda included actual issues potentially arising from the topics final storage of nuclear waste, financing a new site search for a repository, and supervision of nuclear installations. Experts from the administration of justice, the federal and state governments, law offices, universities, and the industry discussed the matters in 14 lectures. (orig.)

  16. 48 CFR 1552.235-78 - Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997).

    Science.gov (United States)

    2010-10-01

    ...: Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997) The... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997). 1552.235-78 Section 1552.235-78 Federal...

  17. Pelviureteric Junction Obstruction: A Surgical Experience Fig. 1: PUJ ...

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... The left side was more commonly affected in a ratio of 8:5. ... have a right renal carcinoma, and a variant of polycystic kidney on the left. Both had .... review of 219 personal cases. ... A new plastic operation for stricture of the ...

  18. German atomic low meeting 2004

    International Nuclear Information System (INIS)

    Ossenbuehl, F.

    2005-01-01

    The conference report on the German atomic law meeting 2004 contains 14 contributions on the German atomic legislation within four parts: Damage precaution in the operational phase; Legal general requirements for the final disposal - considerations ''de lege lata'' and ''de lege ferenda''. Financing of the site searching by a statutory company (''Verbandsmodell''). Atomic supervision authority - federal executive administration or federal self administration?

  19. Ten year review og the international wind power industry 1995-2004. Forecast for 2015. Long term scenario to 2025

    International Nuclear Information System (INIS)

    2005-09-01

    Since 1995 BTM-Consult has published a World Market Report on International Wind Energy Development. Ten years on we are marking the anniversary with this special publication. That very first report was funded by the Danish Ministry of Energy under a dedicated programme for supporting new renewable energy sources. The primary target group was the emerging Danish wind power industry, represented by FDV, the Danish Wind Turbine Manufacturers Association. The aim of the report was to 'map the international wind power industry and evaluate the strengths and weaknesses of Danish manufacturers in this business environment. Although published in Danish, an English summary including the main factual data was distributed to all foreign companies which had contributed information to the survey. This summary was the starting point for publishing the annual publication World Market Update. During the process of conducting this initial survey, a global network was established alongside other information sources which BTM-C had already developed since its formation in 1986. In 1997 the first issue of World Market Update in the format and concept used now was published. A mountain of data has been collected since then, and in this report a selection of the findings over the period from 1995 to 2004 is presented and evaluated with the benefit of hindsight. Over the years, a continuing dialogue with our customers has been the most inspiring input to the ongoing process of improving the report's content. We are proud to have achieved the status of being 'the reference', the most cited report in the industry in terms of progress and future perspectives on wind power. Neither BTM Consult nor other analysts in the industry could imagine in 1995 that the wind power industry would progress as successfully as it has actually performed. The aggregate installed capacity has grown from 3,531 MW in 1994 to almost 48,000 MW by the end of 2004. This represents an average annual growth rate of

  20. Salt fortified with diethylcarbamazine (DEC) as an effective intervention for lymphatic filariasis, with lessons learned from salt iodization programmes.

    Science.gov (United States)

    Houston, R

    2000-01-01

    DEC-fortified salt has been used successfully as a principal public health tool to eliminate lymphatic filariasis (LF) in China and, less extensively, in several other countries. Studies from 1967 to the present conducted in Brazil, Japan, Tanzania, India, China, and Taiwan involving administration of DEC salt for 18 days to 1 year, have shown this intervention to be effective for both bancroftian and brugian filariasis, as measured by reductions in both microfilarial density and positivity, and in some studies through reduction in mosquito positivity rates as well. Furthermore, studies suggest specific advantages from using DEC salt, including lack of side effects, particularly for bancroftian filariasis, and ability to reduce prevalence below 1% when used in conjunction with standard regimens of DEC tablets. However, use of DEC salt as a control tool suffers from a concern that health authorities might find it difficult to manage a programme involving a commodity such as salt. In the past decade, the very successful global efforts to eliminate iodine deficiency through universal salt iodization have demonstrated that partnership with the salt industry can be both successful and effective as a public health tool. Use of DEC salt can be most successfully implemented in areas in which (a) there is adequate governmental support for its use and for elimination of filariasis, (b) filariasis-endemic areas are clearly defined, (c) political leaders, health officials and the salt industry agree that DEC salt is an appropriate intervention, (d) the salt industry is well-organized and has known distribution patterns, (e) a successful national salt iodization effort exists, (f) a monitoring system exists that ensures adequacy of salt iodine content during production and that can also measure household coverage, and (g) measurement of impact on transmission of LF with the new antigen or filarial DNA detection methods can be established. There are advantages and disadvantages

  1. Savannah River Site Environmental Report for 2004

    Energy Technology Data Exchange (ETDEWEB)

    Mamatey, Albert R.

    2005-06-07

    The Savannah River Site Environmental Report for 2004 (WSRC-TR-2005-00005) is prepared for the U.S. Department of Energy (DOE) according to requirements of DOE Order 231.1A, ''Environment, Safety and Health Reporting,'' and DOE Order 5400.5, ''Radiation Protection of the Public and Environment''. The report's purpose is to present summary environmental data that characterize site environmental management performance; confirm compliance with environmental standards and requirements; highlight significant programs and efforts; and assess the impact of SRS operations on the public and the environment.

  2. Phases of QCD: Summary of the Rutgers Long Range Plan Town Meeting, January 12-14, 2007

    International Nuclear Information System (INIS)

    Jacobs, Peter; Kharzeev, Dmitri; Muller, Berndt; Nagle, Jamie; Rajagopal, Krishna; Vigdor, Steve

    2007-01-01

    This White Paper summarizes the outcome of the Town Meeting on Phases of QCD that took place January 12-14, 2007 at Rutgers University, as part of the NSAC 2007 Long Range Planning process. The meeting was held in conjunction with the Town Meeting on Hadron Structure, including a full day of joint plenary sessions of the two meetings. Appendix A.1 contains the meeting agenda. This Executive Summary presents the prioritized recommendations that were determined at the meeting. Subsequent chapters present the essential background to the recommendations. While this White Paper is not a scholarly article and contains few references, it is intended to provide the non-expert reader

  3. Phases of QCD: Summary of the Rutgers Long Range Plan Town Meeting, January 12-14, 2007

    Energy Technology Data Exchange (ETDEWEB)

    Jacobs, Peter; Kharzeev, Dmitri; Muller, Berndt; Nagle, Jamie; Rajagopal, Krishna; Vigdor, Steve

    2007-05-14

    This White Paper summarizes the outcome of the Town Meeting on Phases of QCD that took place January 12-14, 2007 at Rutgers University, as part of the NSAC 2007 Long Range Planning process. The meeting was held in conjunction with the Town Meeting on Hadron Structure, including a full day of joint plenary sessions of the two meetings. Appendix A.1 contains the meeting agenda. This Executive Summary presents the prioritized recommendations that were determined at the meeting. Subsequent chapters present the essential background to the recommendations. While this White Paper is not a scholarly article and contains few references, it is intended to provide the non-expert reader

  4. Integrated Data Collection Analysis (IDCA) Program — IDCA Quarterly Program Review, September 14 and 15, 2010

    Energy Technology Data Exchange (ETDEWEB)

    Sandstrom, Mary M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Brown, Geoffrey W. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Warner, Kirstin F. [Naval Surface Warfare Center (IHD-NSWC), Indian Head, MD (United States). Indian Head Division; Remmers, Daniel L. [Naval Surface Warfare Center (IHD-NSWC), Indian Head, MD (United States). Indian Head Division; Shelley, Timothy J. [Air Force Research Lab. (AFRL/RXQF), Tyndall AFB, FL (United States); Reyes, Jose A. [Applied Research Associates, Inc., Tyndall AFB, FL (United States); Hsu, Peter C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Reynolds, John G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-02-07

    The IDCA conducted a program review at Los Alamos National Laboratory, September 14 and 15, 2010. The review was divided into three parts: 1) an update on the current status of the program, 2) an information exchange and discussion on technical details for current issues and future planning, and 3) a tour of the SSST testing facilities at LANL. The meeting started with an update from DHS by Laura Parker and a restating of some of the objectives of the Proficiency Test of which the IDCA is currently engaged. This update was followed by a discussion of some high level programmatic issues particularly about ways of communicating the overall goals of the IDCA to non-technical representatives. The final topic focused on the difficulty of releasing information, including the DHS approval process, ITAR, and open publication. Next JGR presented a technical summary of accomplishments, schedule, milestones, and future directions. These key points made were: 1) about 1/3 of the materials have been tested, 2) some participants are behind others causing a lag in report writing, 3) method reports have been assigned to various participants to speed up the process of reporting, 4) the SSST Compendium needs reformatting and restructuring, and 5) the Compendium needs a web site to house with access control. After the technical update, some of the Proficiency Test results were shown comparing data from the various laboratories. These results included comparisons of the RDX standard, KC/sugar mixtures (-100 mesh and as received), KC/dodecane, KP/Al, and KP/C. Impact, friction, ESD, and DSC results were the focus. All the participants were involved in these discussions. This report includes summary notes, presentations, and explanatory information.

  5. Cancer Information Summaries

    Science.gov (United States)

    Peer-reviewed, evidence-based summaries on topics including adult and pediatric cancer treatment, supportive and palliative care, screening, prevention, genetics, and complementary and alternative medicine. References to published literature are included.

  6. 77 FR 12836 - Draft Toxicological Review of Biphenyl: In Support of Summary Information on the Integrated Risk...

    Science.gov (United States)

    2012-03-02

    ... the draft human health assessment titled, ``Toxicological Review of Biphenyl: In Support of Summary... email: [email protected] . SUPPLEMENTARY INFORMATION: EPA's IRIS is a human health assessment... exposure to chemical substances found in the environment. Through the IRIS Program, EPA provides the...

  7. Efecto del cambio de posición de decúbito supino a decúbito prono en la presión intraabdominal y su relación con la función renal

    OpenAIRE

    Cuartero Sala, Mireia; Betbesé Roig, Antoni-Jordi; Universitat Autònoma de Barcelona. Departament de Medicina

    2012-01-01

    Es tracta d'un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l'oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...

  8. Efecto del cambio de posición de decúbito supino a decúbito prono en la presión intraabdominal y su relación con la función renal

    OpenAIRE

    Cuartero Sala, Mireia

    2012-01-01

    Es tracta d’un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l’oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...

  9. PROJECT HANFORD MANAGEMENT CONTRACT (PHMC) PERFORMANCE REPORT 05/2004 (WWW.HANFORD.GOV/EMPR.INDEX.CFM)

    International Nuclear Information System (INIS)

    PIELSTICK, R.M.

    2004-01-01

    This report is the monthly performance summary of the Central Plateau Contractors. FH work scope responsibilities are described, and other contractor/RL-managed work is excluded. Section A, Overview, provides a summary of the cost, schedule, and technical performance described in this report. It summarizes performance for the period covered, highlights areas worthy of management attention, and provides key performance activities as extracted from the contractor baseline. Subsequent sections of this report provide detailed performance data relative to contract sections (e.g., Project Hanford Cleanup Work Summary, Waste and Spent Nuclear Fuel Management Operations, Infrastructure and Hanford Site Services, and other Work Scope). All information is as of the end of May 2004 unless otherwise noted

  10. Jedenáctá mezinárodní konference o barokní hudbě, The Royal Northern College of Music, Manchester 14.–18. 7. 2004

    Czech Academy of Sciences Publication Activity Database

    Kapsa, Václav

    2004-01-01

    Roč. 41, 3-4 (2004), s. 399-402 ISSN 0018-7003. [Biennial International Conference on Baroque Music /11./. Manchester, 04.07.14-04.07.18] R&D Projects: GA ČR(CZ) GD408/03/H049 Institutional research plan: CEZ:AV0Z9058907 Keywords : baroque music * conference * report Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. Nevada Nuclear Waste Storage Investigations. FY 1979 peer review summaries and related documentation

    International Nuclear Information System (INIS)

    1980-06-01

    The NNWSI FY 1979 Project Plan (NVO-196-9) describes the accomplishment plan and objectives of the FY 1979 investigations. Three critical tasks and one critical subtask were selected by Project management for in-depth external peer review at meetings held at the DOE/NV in Las Vegas. The four technical peer review meetings held during FY 1979 were conducted to obtain an external assessment of the sufficiency and quality of the four selected critical investigative segments of the NNWSI. Peer reviewers representing appropriate fields of expertise were invited to attend each meeting. Within about two weeks of each meeting, the invited reviewers summarized their impressions of the technical activities presented to them and transmitted their summaries and recommendations to DOE/NV by letter. This document is a compilation, according to the individual meetings, of all correspondence between reviewers and Project personnel that is relevant to the technical activities of the NNWSI. The section for each meeting briefly summarizes the major activities of the NNWSI being reviewed and the effects of the reviewers comments and recommendations on Project planning. Each section also includes a list of the invited peer reviewers, a meeting agenda, and a copy of all technical correspondence relating to the review meeting. General impressions of the overall peer review process and improvements to be incorporated into future peer review activities are discussed in the next section as an introduction to the four subsequent sections which are devoted to the individual FY 1979 peer reviews

  12. IRIS Toxicological Review of 1,4-Dioxane (with Inhalation ...

    Science.gov (United States)

    EPA is conducting a peer review and public comment of the scientific basis supporting the human health hazard and dose-response assessment of 1,4-Dioxane (with inhalation update) that when finalized will appear on the Integrated Risk Information System (IRIS) database. 1,4-Dioxane is commonly used as a solvent, cleaning agent, chemical stabilizer, surface coating, adhesive agent, and an ingredient in chemical manufacture.

  13. Enbridge 2004 annual report : supply demand

    International Nuclear Information System (INIS)

    2004-01-01

    Financial information from Enbridge was presented and a review of their 2004 operations was made available for the benefit of shareholders. Calgary based Enbridge is a leading North American energy delivery company operating in Canada and the United States. Enbridge's core competencies include liquids pipelining, gas distribution and gas pipelining which continued to provide high earnings per share. 2004 was a successful year in terms of financial and operational results and also in terms of developing and fulfilling long-term strategies. Earnings in 2004 increased by 8 per cent in adjusted earnings per share. Highlights of the year include broadening the access to markets for customers of crude oil pipelines; expanding the gas pipelines business; expanding the Ontario gas distribution network; increasing sponsored investments; and evaluating opportunities for growth in the international division. A key relationship was also established for developing oil sands and broadening US and Canadian markets. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements, and common share information including the accounts of Enbridge and the company's proportionate share of the assets, liabilities, revenues, expenses and cash flows of joint ventures. Revenue and expenditure statements were summarized by source. tabs., figs

  14. Independent Orbiter Assessment (IOA): Assessment of the landing/deceleration (LDG/DEC) subsystem FMEA/CIL

    Science.gov (United States)

    Odonnell, R. A.; Weissinger, D.

    1988-01-01

    The results of the Independent Orbiter Assessment (IOA) of the Failure Modes and Effects Analysis (FMEA) and Critical Items List (CIL) are presented. The IOA effort first completed an analysis of the Landing/Deceleration (LDG/DEC) hardware, generating draft failure modes and potential critical items. To preserve independence, this analysis was accomplished without reliance upon the results contained within the NASA FMEA/CIL documentation. The IOA contained within the NASA FMEA/CIL documentation. The IOA results were then compared to the NASA FMEA/CIL baseline with proposed Post 51-L updates included. A resolution of each discrepancy from the comparison is provided through additional analysis as required. This report documents the results of that comparison for the Orbiter LDG/DEC hardware. The IOA product for the LDG/DEC analysis consisted of 259 failure mode worksheets that resulted in 124 potential critical items being identified. Comparison was made to the NASA baseline which consisted of 267 FMEA's and 120 CIL items. This comparison produced agreement on all but 75 FMEA's which caused differences in 51 CIL items.

  15. Composição florística da floresta estacional decídua montana de Serra das Almas, CE, Brasil

    OpenAIRE

    Lima,Jacira Rabelo; Sampaio,Everardo Valadares de Sá Barretto; Rodal,Maria Jesus Nogueira; Araújo,Francisca Soares

    2009-01-01

    No domínio semi-árido brasileiro, a flora das bacias sedimentares ainda é pouco conhecida, mas os levantamentos já existentes indicam que há grande heterogeneidade florística e fisionômica. Mesmo áreas geográficas próximas podem apresentar dissimilaridade florística. Visando testar esta hipótese, a composição florística e o espectro biológico da floresta estacional decídua de Serra das Almas, estado do Ceará, foram analisados e comparados com os de 14 áreas sedimentares no Nordeste. Foram enc...

  16. Report of the 2004 Workshop on In Situ Iron Enrichment Experiments in the Eastern and Western Subarctic Pacific

    OpenAIRE

    Takeda, Shigenobu; Wong, C.S.

    2006-01-01

    Foreword 1. BACKGROUND AND OBJECTIVES (pdf, 0.1 Mb) 2. 2004 WORKSHOP SUMMARY (pdf, < 0.1 Mb) 2.1. What have we learned from the enrichment experiments? 2.2 What are the outstanding questions? 2.3 Recommendations for SEEDS-II 3. EXTENDED ABSTRACTS OF THE 2004 WORKSHOP 3.1 Synthesis of the Iron Enrichment Experiments: SEEDS and SERIES (pdf, 0.5 Mb) Iron fertilization experiment in the western subarctic Pacific (SEEDS) by At...

  17. PS2004 Light-harvesting Systems Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Blankenship, Robert E.

    2005-01-01

    This special issue of the international scientific research journal Photosynthesis Research consists of 25 original peer-reviewed contributions from participants in the PS 2004 Lisht-Harvesting Systems Workshop. This workshop was held from 26-29, 2004 at Hotel Le Chantecler, Sainte-Adele, Quebec, Canada. The workshop was a satellite meeting of the XIII International Congress on Photosynthesis held August 29-September 3, 2004 in Montreal, Canada. The workshope dealt with all types of photosynthetic antenna systems and types of organisms, including anoxygenic photosynthetic bacteria, cyanobacteria, algae and higher plants, as well as in vitro studies of isolated pigments. This collection of papers is a good representation of the highly interdisciplinary nature of modern research on photosynthetic antenna complexes, utilizing techniques of advanced spectroscopy, biochemistry, molecular biology, synthetic chemistry and structural determination to understand these diverse and elegant molecular complexes.

  18. Enhancing accountability in public–private partnerships in South Africa

    African Journals Online (AJOL)

    kirstam

    2014-12-09

    Dec 9, 2014 ... undermine public control (Sands 2004; Grimsey & Lewis 2007; ..... disclosure of information (IPPR 2001). ... In effect, there is no clarity as to what exactly is to be audited in ..... PPP arrangement, such as timely and efficient accounting systems, ... a code of conduct, internal review boards and professional ...

  19. FILOSOFIA THEORETICA VoI. 1 No. 1 Dec. 2011 MENTAL ...

    African Journals Online (AJOL)

    JONATHAN CHIMAKONAM OKEKE

    2011-12-01

    Dec 1, 2011 ... investigate the problem of personal identity (Furman and Avila, 146). Others include, Thomas Reid ... disembodied thoughts and memories are the bastion of personal identity. This does not suggest the .... may make a little sense to me when I say that I'm what I think I am, but how far does this go? How do I ...

  20. Some programming aids for the DEC PDP-10

    International Nuclear Information System (INIS)

    McNamara, B.

    1979-01-01

    A simplified system has been written to help in FORTRAN programming of physics and mathematical problems. The system is described in Appendix A. A magnetic tape has been made of the complete system as used on the DEC-10 by M-Division for Magnetic Fusion related calculations. The system turns out to use many of the locally developed goodies, such as the TEDI text editor, the TV80 graphics system, and Tektronix 4012 videos. The facilities are briefly described in the HLP files on the tape

  1. Noore teadlase preemia saab Jaan Raik

    Index Scriptorium Estoniae

    2004-01-01

    Vabariigi presidendi kultuurirahastu nõukogu otsustas tänavuse noore teadlase preemia anda Tallinna Tehnikaülikooli vanemteadurile, tehnikateaduste doktor Jaan Raik'ile. Ilmunud ka Pärnu Postimees, 2004/Dec/1, lk. 6 ; Mente et Manu, 2004/Dec/15, lk. 1

  2. Prevalencia del suicidio femenino en el departamento del Magdalena (Colombia: 2004-2010

    Directory of Open Access Journals (Sweden)

    Diego Pérez Manjarrez

    2013-10-01

    Full Text Available Title:  Prevalence of suicide girls in the department of Magdalena (Colombia: 2004-2010.ResumenEl suicidio es considerado una de las principales causas de muerte en el mundo, y por tanto es un problema de salud pública a nivel mundial. Se ha definido como aquella conducta en la cual el ser humano que logra terminar con su vida de manera voluntaria. Se efectuó un estudio descriptivo longitudinal retrospectivo, tomando como base los registros de los suicidios de mujeres para el departamento del Magdalena en el período 2004-2010, suministrados por el Instituto de Medicina Legal y Ciencias Forenses, regional Santa Marta. La presente investigación encontró que durante el periodo 2004-2010 en el departamento del Magdalena se presentaron 206 suicidios, de los cuales 30 (14.5% fueron consumados por mujeres, de las cuales dos (6.66% eran adolescentes. Se concluye que la prevalencia del suicidio femenino en el periodo estudiado fue del 14.5%. (DUAZARY 2012 No. 1, 87 - 93AbstractSuicide is considered a major cause of death in the world, therefore, is a public health problem worldwide. Suicide is defined as that human behavior that does end his life voluntarily. We conducted a retrospective, longitudinal study, based on records supplied by the Institute of Legal Medicine and Forensic Sciences, Santa Marta region for the period 2004-2010 of suicides by women for the Department of Magdalena. This investigation found that during the period 2004 to 2010 in the department of Magdalena showed 206 suicides, of which 30 (14.5% were accomplished by women, and of these, two women (6.66% were adolescents. It is concluded that the prevalence of female suicide in the study period was 14.5%.Keywords: Suicide; sex; women; prevalence. (MeSH.

  3. 14 CFR 21.125 - Production inspection system: Materials Review Board.

    Science.gov (United States)

    2010-01-01

    ... § 21.125 Production inspection system: Materials Review Board. Link to an amendment published at 74 FR... Materials Review Board action for at least two years. (b) The production inspection system required in § 21... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Production inspection system: Materials...

  4. Annual report and summary financial statement 1990-1991

    International Nuclear Information System (INIS)

    1992-01-01

    The 1990-1991 Annual Report for Scottish Hydro-Electric PLC includes their rotating territory in Scotland, details of the Board of Directors, the Chairman's Statement, the chief Executive's Review of Operations, a summary profit and loss account, a summary balance sheet and a summary financial statement. (UK)

  5. Combined DECS Analysis and Next-Generation Sequencing Enable Efficient Detection of Novel Plant RNA Viruses

    Directory of Open Access Journals (Sweden)

    Hironobu Yanagisawa

    2016-03-01

    Full Text Available The presence of high molecular weight double-stranded RNA (dsRNA within plant cells is an indicator of infection with RNA viruses as these possess genomic or replicative dsRNA. DECS (dsRNA isolation, exhaustive amplification, cloning, and sequencing analysis has been shown to be capable of detecting unknown viruses. We postulated that a combination of DECS analysis and next-generation sequencing (NGS would improve detection efficiency and usability of the technique. Here, we describe a model case in which we efficiently detected the presumed genome sequence of Blueberry shoestring virus (BSSV, a member of the genus Sobemovirus, which has not so far been reported. dsRNAs were isolated from BSSV-infected blueberry plants using the dsRNA-binding protein, reverse-transcribed, amplified, and sequenced using NGS. A contig of 4,020 nucleotides (nt that shared similarities with sequences from other Sobemovirus species was obtained as a candidate of the BSSV genomic sequence. Reverse transcription (RT-PCR primer sets based on sequences from this contig enabled the detection of BSSV in all BSSV-infected plants tested but not in healthy controls. A recombinant protein encoded by the putative coat protein gene was bound by the BSSV-antibody, indicating that the candidate sequence was that of BSSV itself. Our results suggest that a combination of DECS analysis and NGS, designated here as “DECS-C,” is a powerful method for detecting novel plant viruses.

  6. Scaling Up Optimal Heuristic Search in Dec-POMDPs via Incremental Expansion (extended abstract)

    NARCIS (Netherlands)

    Spaan, M.T.J.; Oliehoek, F.A.; Amato, C.

    2011-01-01

    We advance the state of the art in optimal solving of decentralized partially observable Markov decision processes (Dec-POMDPs), which provide a formal model for multiagent planning under uncertainty.

  7. Summary of DOE/PERF water program review.

    Energy Technology Data Exchange (ETDEWEB)

    Veil, J.; Gasper, J.; Puder, M.; Leath, P.; Environmental Science Division

    2006-01-31

    For many years, the U.S. Department of Energy (DOE) has supported and sponsored various types of water research relating to the oil and gas industry through its Office of Fossil Energy and its National Energy Technology Laboratory (NETL). In early 2005, the Petroleum Environmental Research Forum (PERF) submitted a proposal to DOE for funding an upcoming PERF meeting that would feature water research in the petroleum industry. PERF is a nonprofit organization created in 1986 to provide a stimulus to and a forum for the collection, exchange, and analysis of research information related to the development of technology concerning the petroleum industry, and a mechanism for establishing joint research projects in that field. Additional information on PERF can be accessed at http://www.perf.org. DOE agreed to provide funding to hold a review of its water research program in conjunction with the fall 2005 PERF meeting. Argonne National Laboratory (Argonne) was asked to coordinate and host the meeting, which was referred to as the DOE/PERF Water Program Review. The program review was held on November 1-4, 2005, in Annapolis, Maryland, at the Historic Inns of Annapolis. The purpose of the program review was to provide a forum for sharing information, reviewing current programs (especially recent unpublished research), and reviewing industry and regulatory needs regarding water use and reuse issues. PERF and DOE/NETL can use this information to plan for future water-related research projects. The water program review provided a unique opportunity in several ways. First, DOE was able to have all of the contractors currently receiving DOE funds for water research present in one room at the same time. Each contractor described his or her research and was able to learn about the research being conducted by the other researchers. Second, this forum allowed representatives of many large oil and gas companies to hear about the DOE research projects and offer their reactions to DOE

  8. 75 FR 10016 - Petition for Exemption; Summary of Petitions Received

    Science.gov (United States)

    2010-03-04

    ...] Petition for Exemption; Summary of Petitions Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of two petitions seeking relief from specified requirements of 14 CFR. The purpose of this notice is to improve the...

  9. POST-CLOSURE INSPECTION REPORT FOR CORRECTIVE ACTION UNIT 92: AREA 6 DECON PAD FACILITY, NEVADA. TEST SITE NEVADA, FOR THE PERIOD JANUARY 2004 - DECEMBER 2004

    International Nuclear Information System (INIS)

    BECHTEL NEVADA

    2005-01-01

    This Post-Closure Inspection Report provides an analysis and summary of inspections for Corrective Action Unit (CAU) 92, Area 6 Decon Pond Facility, Nevada Test Site, Nevada. CAU 92 was closed in accordance with the Resource Conservation and Recovery Act (RCRA) Part B Operational Permit (Nevada Division of Environmental Protection, 1995) and the Federal Facility Agreement and Consent Order of 1996 on May 11, 1999. CAU 92 consists of two Corrective Action Sites (CASs): CAS 06-04-01, Decon Pad oil/Water Separator; and CAS 06-05-02, Decontamination Pond (RCRA). Both CASs have use restrictions; however, only CAS 06-05-02, Decontamination Pond (RCRA), requires post-closure inspections. CAS 06-04-01, Decon Pad Oil/Water Separator, is located inside the fence at the Building 6-605 compound. This report covers the annual period January 2004 through December 2004

  10. ilc-25.pdf | dec2005 | jess | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; jess; dec2005; ilc-25.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...

  11. Reviews on 1,4-naphthoquinones from Diospyros L.

    Science.gov (United States)

    Nematollahi, Alireza; Aminimoghadamfarouj, Noushin; Wiart, Christophe

    2012-01-01

    The genus Diospyros is one of the most important sources of bioactive compounds, exclusively 1,4-naphthoquinones. The following information is an attempt to cover the developments in the biology and phytochemistry of 1,4-naphthoquinones isolated from this genus, as well as the studies done and the suggested mechanisms regarding their activities. During the past 60 years, many of these agents have been isolated from Diospyros L. Twelve considerable bioactive structures are reported in this review. The basic 1,4-naphthoquinone skeletons, on which a large number of studies have been done, are plumbagin and diospyrin. Today, the potential for development of leads from 1,4-naphthoquinones obtained from Diospyros L. is growing dramatically, mainly in the area of anticancer and antibacterial investigations. The data prepared and described here are intended to be served as a reference tool to the natural products and chemistry specialists in order to expand the rational drug design.

  12. 43 CFR 17.10 - Judicial review.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Judicial review. 17.10 Section 17.10... Origin § 17.10 Judicial review. Action taken pursuant to section 602 of the act is subject to judicial review as provided in section 603 of the act. [29 FR 16293, Dec. 4, 1964] ...

  13. The National Energy Board's annual report to Parliament 2004

    International Nuclear Information System (INIS)

    2004-01-01

    The National Energy Board (NEB) informs Canadians about energy market trends. This annual report provides a summary of Canadian energy supply, consumption, production, prices and trade with an emphasis on developments in 2004, a year marked by high and volatile energy prices led by crude oil prices. Although exploration efforts increased, producers were led to develop non-traditional supply sources due to the declining supply of domestic conventional crude oil and flat domestic natural gas production. 2004 saw the expansion of crude oil production from the East coast offshore and from Alberta's oil sands. The year also saw the development of natural gas supply sources in Canada's North, the development of coalbed methane sources and the import of liquefied natural gas. Regulatory highlights for 2004 include applications for new pipeline facilities, new international power lines, tolls and tariff filings, and activities on frontier lands. In 2004 Canada's energy industry accounted for 6 per cent of Canada's Gross Domestic product and employed 300,000 people. Revenue from energy exports accounted for 15 per cent of all Canadian exports. Total energy production in Canada increased by about 2 per cent in 2004, compared with a decline of 0.2 per cent in 2003. Petroleum and natural gas accounted for more than 75 per cent of total energy production. Export revenues remained similar to 2003 levels due to high oil prices. Hydroelectric production declined for the second year in a row due to drought conditions. Renewable and other energy sources increased by nearly 4 per cent, while nuclear energy production increased over 20 per cent due to refurbished nuclear generators in Ontario. tabs., figs

  14. Annual results 2004; Resultats annuels 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This 2004 annual evaluation of the french RTE company (electric power transport network) provides information on the 2004 results on: institutional information, financial results, customers and market, industrial resources, environment and consultation, human resources and international aspects. (A.L.B.)

  15. Trends in Canadian Sociology Master's Theses in Relation to Research Ethics Review, 1995-2004.

    Science.gov (United States)

    van den Hoonaard, Will C

    2006-12-01

    THIS PAPER EXAMINES TRENDS IN CANADIAN Master's theses in sociology, 1995-2004, in the course the implementation of Canada's national research-ethics guidelines (2001), using data available from ProQuest Dissertations. While there has been no decline in the number of theses completed during this period, nearly 1/4 fewer theses now involve research participants. The proportion of theses using quantitative methods shows decline; theses using qualitative methods, however, have increased significantly over time. A closer inspection qualitative theses shows an impressive increase in the proportion of theses using interviews, while the decrease in theses using field work is even more dramatic, from 40% to 5%. The decrease of theses involving field work is particularly alarming for a significant segment of sociology that must derive its material mainly from field work. Data drawn from a larger study supplement the findings in this article.

  16. Displaying DIII-D plasma data using DEC's X window system

    International Nuclear Information System (INIS)

    Greene, K.L.

    1992-01-01

    This paper reports on the DIII-D tokamak program funded by the Department of Energy, which carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for each shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support Xwindows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface

  17. TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITH NASADIG)

    Science.gov (United States)

    Anderson, G. E.

    1994-01-01

    . The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version

  18. TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITHOUT NASADIG)

    Science.gov (United States)

    Vogt, R. A.

    1994-01-01

    . The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version

  19. Omega-3 fatty acids and cardiovascular disease: summary of the 2016 agency of healthcare research and quality evidence review

    Science.gov (United States)

    We summarize the 2016 update of the 2004 Agency of Healthcare Research and Quality's evidence review of omega-3 fatty acids and cardiovascular disease (CVD). The overall findings for the effects of marine oil supplements on intermediate CVD outcomes remain largely unchanged. There is high strength o...

  20. Annual Site Environmental Report, 2004

    Energy Technology Data Exchange (ETDEWEB)

    Nuckolls, H.; /SLAC

    2006-04-19

    This report provides information about environmental programs during 2004 at the Stanford Linear Accelerator Center (SLAC). Seasonal activities that span calendar years are also included. Production of an annual site environmental report (ASER) is a requirement established by the United States Department of Energy (DOE) for all management and operating (M&O) contractors throughout the DOE complex. SLAC is a federally-funded, research and development center with Stanford University as the M&O contractor. The most noteworthy information in this report is summarized in this section. This summary demonstrates the effective application of SLAC environmental management in meeting the site's integrated safety management system (ISMS) goals. For normal daily activities, all SLAC managers and supervisors are responsible for ensuring that proper procedures are followed so that worker safety and health are protected; the environment is protected; and compliance is ensured. Throughout 2004, SLAC focused on these activities through the SLAC management systems (described in Chapter 3). These systems were also the way SLAC approached implementing ''greening of the government'' initiatives such as Executive Order 13148. The management systems at SLAC are effective, supporting compliance with all relevant statutory and regulatory requirements. There were no reportable releases to the environment from SLAC operations during 2004. In addition, many improvements were continued during 2004, in waste minimization, recycling, decreasing air emission rates, stormwater drain system, groundwater restoration, and planning for a chemical management system to manage chemical use better. Program-specific details discussed are: (1) Air Quality--SLAC operates its air quality management program in compliance with its established permit conditions: 2004 was the seventh consecutive year the air quality management program operated without receiving any notices of violation

  1. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    Energy Technology Data Exchange (ETDEWEB)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas [Department of Chemistry, qLeap Center for Theoretical Chemistry, University of Aarhus, DK-8000 Århus C (Denmark)

    2016-07-14

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  2. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    International Nuclear Information System (INIS)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas

    2016-01-01

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  3. Considerations on Fail Safe Design for Design Basis Accident (DBA) vs. Design Extension Condition (DEC): Lesson Learnt from the Fukushima Accident

    International Nuclear Information System (INIS)

    Ha, Jun Su; Kim, Sungyeop

    2014-01-01

    The fail safety design is referred to as an inherently safe design concept where the failure of an SSC (System, Structure or Component) leads directly to a safe condition. Usually the fail safe design has been devised based on the design basis accident (DBAs), because the nuclear safety has been assured by securing the capability to safely cope with DBAs. Currently regards have been paid to the DEC (Design Extension Condition) as an extended design consideration. Hence additional attention should be paid to the concept of the fail safe design in order to consider the DEC, accordingly. In this study, a case chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC standpoints. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well. One of the lessons learnt from the Fukushima accident should include considerations on the fail-safe design in a changing regulatory framework. Currently the design extension condition (DEC) including severe accidents should be considered during designing and licensing NPPs. Hence concepts on the fail safe design need to be changed to be based on not only the DBA but also the DEC. In this study, a case on a fail-safe design chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC conditions. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well

  4. Fleet average NOx emission performance of 2004 model year light-duty vehicles, light-duty trucks and medium-duty passenger vehicles

    International Nuclear Information System (INIS)

    2006-05-01

    The On-Road Vehicle and Engine Emission Regulations came into effect on January 1, 2004. The regulations introduced more stringent national emission standards for on-road vehicles and engines, and also required that companies submit reports containing information concerning the company's fleets. This report presented a summary of the regulatory requirements relating to nitric oxide (NO x ) fleet average emissions for light-duty vehicles, light-duty trucks, and medium-duty passenger vehicles under the new regulations. The effectiveness of the Canadian fleet average NO x emission program at achieving environmental performance objectives was also evaluated. A summary of the fleet average NO x emission performance of individual companies was presented, as well as the overall Canadian fleet average of the 2004 model year based on data submitted by companies in their end of model year reports. A total of 21 companies submitted reports covering 2004 model year vehicles in 10 test groups, comprising 1,350,719 vehicles of the 2004 model year manufactured or imported for the purpose of sale in Canada. The average NO x value for the entire Canadian LDV/LDT fleet was 0.2016463 grams per mile. The average NO x values for the entire Canadian HLDT/MDPV fleet was 0.321976 grams per mile. It was concluded that the NO x values for both fleets were consistent with the environmental performance objectives of the regulations for the 2004 model year. 9 tabs

  5. Annual report and summary financial statement 1991-1992

    International Nuclear Information System (INIS)

    1993-01-01

    The 1991-92 Annual Report for Scottish Hydro-Electric PLC is presented. It includes key financial statistics, the financial calendar, details of the Board of Directors, the Chairman's Statement, the Chief Executives' review of operations, operational statistics, a summary financial statement, a summary group profit and loss account, summary balance sheets, the Auditors' Report and a customer map. (UK)

  6. [NUTRITIONAL STATUS AND BIOCHEMICAL MARKERS OF DEFICIENCY OR EXCESS OF MICRONUTRIENTS IN 4 TO 14 YEAR-OLD CHILEAN CHILDREN: A CRITICAL REVIEW].

    Science.gov (United States)

    Rozowski Narkunska, Jaime; Castillo Valenzuela, Oscar; Figari Jullian, Nicole; García-Díaz, Diego F; Cruchet Muñoz, Sylvia; Weisstaub Nuta, Gerardo; Pérez-Bravo, Francisco; Gotteland Russel, Martín

    2015-12-01

    The prevalence of obesity in Chilean children has been increasing steadily for the last two decades. The first study to determine nutritional status and food intake in a representative sample of this population was carried out in 1960. Recently the National Food Consumption Survey (ENCA) carried out in 2012 was released by the Ministry of Health. However, this study did not include biochemical determinations of micronutrients which would allow a better diagnosis of nutritional status in children. to review the literature available from 2004 to 2014 in food intake and nutritional status in Chilean children aged 4 to 14 years. a total of 362 references published between 2004 and 2014 were obtained through searches in the databases PubMed, Lilacs, Embase and Scielo. From these, 40 articles were selected for a thorough review. food intake by children is characterized by a high-energy intake, a low consumption of fruits and vegetables and a high consumption of bread. The ENCA showed that 95% of the Chilean population has a deficient diet. A high prevalence of obesity is observed from very early in life. There is a dearth of data available on plasma indicators of vitamin and mineral status since 1960, which would provide more reliable information on nutritional assessment. It is imperative to implement a representative nutrition survey of children in Chile that includes biochemical indicators to get reliable information in order to develop strategies aimed to correct micronutrient malnutrition from excess or deficiency. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  7. Executive summary

    International Nuclear Information System (INIS)

    2002-01-01

    On 18 May 2001, the Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, within the municipality of Eurajoki. The Municipality Council and the government has made positive decisions earlier, at the end of 2000, and in compliance with the Nuclear Energy Act, Parliament's ratification was then required. The decision is valid for the spent fuel generated by the existing Finnish nuclear power plants and means that the construction of the final disposal facility is considered to be in line with the overall good of society. Earlier steps included, amongst others, the approval of the technical project by the Safety Authority. Future steps include construction of an underground rock characterisation facility, ONKALO (2003-2004), and application for separate construction and operating licences for the final disposal facility (from about 2010). How did this political and societal decision come about? The FSC Workshop provided the opportunity to present the history leading up to the Decision in Principle (DiP), and to examine future perspectives with an emphasis on stakeholder involvement. This Executive Summary gives an overview of the presentations and discussions that took place at the workshop. It presents, for the most part, a factual account of the individual presentations and of the discussions that took place. It relies importantly on the notes that were taken at the meeting. Most materials are elaborated upon in a fuller way in the texts that the various speakers and session moderators contributed for these proceedings. The structure of the Executive Summary follows the structure of the workshop itself. Complementary to this Summary and also provided with this document, is a NEA Secretariat's perspective aiming to place the results of all discussions, feedback and site visit into an international perspective. (authors)

  8. DecAID: a decaying wood advisory model for Oregon and Washington.

    Science.gov (United States)

    Kim Mellen; Bruce G. Marcot; Janet L. Ohmann; Karen L. Waddell; Elizabeth A. Willhite; Bruce B. Hostetler; Susan A. Livingston; Cay. Ogden

    2002-01-01

    DecAID is a knowledge-based advisory model that provides guidance to managers in determining the size, amount, and distribution of dead and decaying wood (dead and partially dead trees and down wood) necessary to maintain wildlife habitat and ecosystem functions. The intent of the model is to update and replace existing snag-wildlife models in Washington and Oregon....

  9. DMPD: CD14 and other recognition molecules for lipopolysaccharide: a review. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 7542643 CD14 and other recognition molecules for lipopolysaccharide: a review. Kiel...her recognition molecules for lipopolysaccharide: a review. PubmedID 7542643 Title CD14 and other recognitio...n molecules for lipopolysaccharide: a review. Authors Kielian TL, Blecha F. Publi

  10. Cost-of-illness studies in heart failure: a systematic review 2004-2016.

    Science.gov (United States)

    Lesyuk, Wladimir; Kriza, Christine; Kolominsky-Rabas, Peter

    2018-05-02

    Heart failure is a major and growing medical and economic problem worldwide as 1-2% of the healthcare budget are spent for heart failure. The prevalence of heart failure has increased over the past decades and it is expected that there will be further raise due to the higher proportion of elderly in the western societies. In this context cost-of-illness studies can significantly contribute to a better understanding of the drivers and problems which lead to the increasing costs in heart failure. The aim of this study was to perform a systematic review of published cost-of-illness studies related to heart failure to highlight the increasing cost impact of heart failure. A systematic review was conducted from 2004 to 2016 to identify cost-of-illness studies related to heart failure, searching PubMed (Medline), Cochrane, Science Direct (Embase), Scopus and CRD York Database. Of the total of 16 studies identified, 11 studies reported prevalence-based estimates, 2 studies focused on incidence-based data and 3 articles presented both types of cost data. A large variation concerning cost components and estimates can be noted. Only three studies estimated indirect costs. Most of the included studies have shown that the costs for hospital admission are the most expensive cost element. Estimates for annual prevalence-based costs for heart failure patients range from $868 for South Korea to $25,532 for Germany. The lifetime costs for heart failure patients have been estimated to $126.819 per patient. Our review highlights the considerable and growing economic burden of heart failure on the health care systems. The cost-of-illness studies included in this review show large variations in methodology used and the cost results vary consequently. High quality data from cost-of-illness studies with a robust methodology applied can inform policy makers about the major cost drivers of heart failure and can be used as the basis of further economic evaluations.

  11. Summary of the planning, management, and evaluation process for the Geothermal Program Review VI conference

    Energy Technology Data Exchange (ETDEWEB)

    1988-10-01

    The purpose of this document is to present an overview of the planning, facilitation, and evaluation process used to conduct the Geothermal Program Review VI (PR VI) conference. This document was also prepared to highlight lessons learned from PR VI and, by utilizing the evaluation summaries and recommendations, be used as a planning tool for PR VII. The conference, entitled Beyond Goals and Objectives,'' was sponsored by the US Department of Energy's (DOE) Geothermal Technology Division (GTD), PR VI was held in San Francisco, California on April 19--21, 1988 and was attended by 127 participants. PR VI was held in conjunction with the National Geothermal Association's (NGA) Industry Round Table. This document presents a brief summary of the activities, responsibilities, and resources for implementing the PR VI meeting and provides recommendations, checklists, and a proposed schedule for assisting in planning PR VII.

  12. Review Article

    African Journals Online (AJOL)

    2007-12-02

    Dec 2, 2007 ... Introduction. What prompted this review article is because of the wrong notion that the only standard abdominal incision is the midline incision. Cases have been seen in which an abdominal incision extends from the xyphoid process to the symphysis pubis just to remove a perforated appendix! The reason ...

  13. Efeito da rotação da cabeça na pressão intraocular em decúbito ventral: estudo randomizado

    Directory of Open Access Journals (Sweden)

    M. Nuri Deniz

    2013-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A elevação da pressão intraocular (PIO, que diminui a pressão de perfusão do nervo óptico, é aumentada pelo posicionamento em decúbito ventral. O objetivo de nosso estudo foi comparar o efeito da rotação lateral da cabeça a 45º em decúbito ventral no aumento da PIO de olhos posicionados para cima e olhos posicionados para baixo em pacientes submetidos à nefrolitotomia percutânea (NLPC. MÉTODOS: Quarenta e cinco pacientes foram randomicamente alocados em dois grupos. A PIO dos pacientes foi registrada bilateralmente em posição supina antes do início da operação. Os pacientes foram posicionados em decúbito ventral. A cabeça foi posicionada sobre um apoio sem compressão externa direta em ambos os olhos. Os pacientes do Grupo I foram estritamente mantidos em pronação neutra, enquanto os pacientes do Grupo II foram posicionados em pronação com rotação da cabeça a 45º para o lado direito. No fim da operação, os pacientes foram reposicionados em decúbito dorsal e a PIO foi imediatamente medida. RESULTADOS: Não houve diferença entre os dados demográficos, na duração da cirurgia, perda de sangue e reposição de líquido dos pacientes. Os valores pós-cirúrgicos da PIO em decúbito ventral aumentaram significativamente em comparação com os valores pré-operatórios em ambos os grupos (p < 0,05. Após a cirurgia em decúbito ventral, os valores da PIO nos olhos posicionados para cima no Grupo II foram significativamente menores do que no Grupo I e nos olhos posicionados para baixo no Grupo II (p < 0,05. CONCLUSÃO: A posição em decúbito ventral aumenta a PIO. Nos pacientes posicionados em decúbito ventral com rotação lateral da cabeça a 45º, a PIO nos olhos posicionados para cima foi significativamente menor.

  14. 14 and Younger: The Sexual Behavior of Young Adolescents. Summary.

    Science.gov (United States)

    Albert, Bill, Ed.; Brown, Sarah, Ed.; Flanigan, Christine M., Ed.

    This summary presents data from seven papers based on six different data sets (three national and three local). Data were collected for different purposes, in different years and places, using different interview techniques. Overall, nearly one in five adolescents has had sex before his/her 15th birthday. In early adolescence, being sexually…

  15. Environmental economy account for Denmark 2004

    International Nuclear Information System (INIS)

    Anon.

    2006-01-01

    The environmental economy account for Denmark shows that the contribution to acidification in Denmark decreased with 5,2% from 2003 to 2004, while the contribution to the greenhouse effect decreased with 4,4%. The reserves of petroleum and natural gas increased in 2004 with 14 b.DKK to 232 b.DKK. The environmental account for Denmark presents accounts of the energy consumption (and water consumption) of the industrial branches and the households together with their emission of pollutants to the atmosphere. The account also contains information about the environmental taxes and subsidies that rest with industry and households. Finally, volume and value are presented of the oil and gas reserves in the North Sea. The environmental account combines environmental data with the Danish National Accounts, making it possible to analyse the relation between economy and environment. (ln)

  16. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

  17. ARIES Oxide Production Program Annual Report - FY14

    Energy Technology Data Exchange (ETDEWEB)

    Kelley, Evelyn A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dinehart, Steven Mark [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-02-01

    A summary of the major accomplishments (September), milestones, financial summary, project performance and issues facing the ARIES Oxide Production Program at the close of FY14 is presented in this Executive Summary. Annual accomplishments are summarized in the body of the report.

  18. Review and analysis of the over exposure cases in the non-DAE institutions in India during 2004-2007

    International Nuclear Information System (INIS)

    Varadharajan, Geetha; Srivastava, Kshama; Kolambe, D.H.; Punekar, M.P.; Kher, R.K.

    2008-01-01

    The radiation protection programme aims at providing adequate protection from undue radiation exposure to the personnel directly or indirectly involved with radiation, without limiting the benefits of radiation. Personnel Monitoring of the radiation workers is an integral part of effective radiation protection programme and is mandatory as per the Radiation Protection Rule-71 (RPR-71) and its revised version in 2004 (RPR -2004). In India, countrywide personnel monitoring of 65,000 radiation workers is carried out by 14 TLD units spread all over the country using CaSO 4 :Dy based TLD Badge system developed by Bhabha Atomic Research Centre. Prior to the accreditation of the first private laboratory in 1999, the personnel monitoring service was provided by Bhabha Atomic Research Centre. At present the total workload of about 35000 workers in the non-DAE sector has been transferred to the three private accredited laboratories catering the service in different zones of the country. The effective radiation control and safe work practices can be ensured by proper reporting of doses and investigation and follow up of overexposure cases. Any exposure exceeding 10 mSv in a singe monitoring period is treated as a case of over exposure and such cases are discussed by an AERB appointed investigation committee. The committee decides the genuineness of the exposure after looking into the various aspects relevant to these cases. This paper presents the analysis of over exposure cases reported for non-DAE institutions in the field of medicine, industry and research in India during 2004-2007. (author)

  19. Accident investigation board report on the May 14, 1997, chemical explosion at the Plutonium Reclamation Facility, Hanford Site,Richland, Washington - summary report

    International Nuclear Information System (INIS)

    Gerton, R.E.

    1997-01-01

    This report is a summary of the Accident Investigation Board Report on the May 14, 1997, Chemical Explosion at the Plutonium Reclamation Facility, Hanford Site, Richland, Washington (DOE/RL-97-59). The referenced report provides a greater level of detail and includes a complete discussion of the facts identified, analysis of those facts, conclusions derived from the analysis, identification of the accident's causal factors, and recommendations that should be addressed through follow-up action by the U.S. Department of Energy and its contractors. This companion document provides a concise summary of that report, with emphasis on management issues. Evaluation of emergency and occupational health response to, and radiological and chemical releases from, this accident was not within the scope of this investigation, but is the subject of a separate investigation and report (see DOE/RL-97-62)

  20. Proceedings of the 2004 NASA/ONR Circulation Control Workshop, Part 2

    Science.gov (United States)

    Jones, Gregory S. (Editor); Joslin, Ronald D. (Editor)

    2005-01-01

    This conference proceeding is comprised of papers that were presented at the NASA/ONR Circulation Control Workshop held 16-17 March 2004 at the Radisson-Hampton in Hampton, VA. Over two full days, 30 papers and 4 posters were presented with 110 scientists and engineers in attendance, representing 3 countries. As technological advances influence the efficiency and effectiveness of aerodynamic and hydrodynamic applications, designs, and operations, this workshop was intended to address the technologies, systems, challenges and successes specific to Coanda driven circulation control in aerodynamics and hydrodynamics. A major goal of this workshop was to determine the state-of-the-art in circulation control and to assess the future directions and applications for circulation control. The 2004 workshop addressed applications, experiments, computations, and theories related to circulation control, emphasizing fundamental physics, systems analysis, and applied research. The workshop consisted of single session oral presentations, posters, and written papers that are documented in this unclassified conference proceeding. The format of this written proceeding follows the agenda of the workshop. Each paper is followed with the presentation given at the workshop. the editors compiled brief summaries for each effort that is at the end of this proceeding. These summaries include the paper, oral presentation, and questions or comments that occurred during the workshop. The 2004 Circulation Control Workshop focused on applications including Naval vehicles (Surface and Underwater vehicles), Fixed Wing Aviation (general aviation, commercial, cargo, and business aircraft); V/STOL platforms (helicopters, military aircraft, tilt rotors); propulsion systems (propellers, jet engines, gas turbines), and ground vehicles (automotive, trucks, and other); wind turbines, and other nontraditional applications (e.g., vacuum cleaner, ceiling fan). As part of the CFD focus area of the 2004 CC

  1. Computer Science Research Institute 2004 annual report of activities.

    Energy Technology Data Exchange (ETDEWEB)

    DeLap, Barbara J.; Womble, David Eugene; Ceballos, Deanna Rose

    2006-03-01

    This report summarizes the activities of the Computer Science Research Institute (CSRI) at Sandia National Laboratories during the period January 1, 2004 to December 31, 2004. During this period the CSRI hosted 166 visitors representing 81 universities, companies and laboratories. Of these 65 were summer students or faculty. The CSRI partially sponsored 2 workshops and also organized and was the primary host for 4 workshops. These 4 CSRI sponsored workshops had 140 participants--74 from universities, companies and laboratories, and 66 from Sandia. Finally, the CSRI sponsored 14 long-term collaborative research projects and 5 Sabbaticals.

  2. A Probabilistic Analysis to Quantify the Effect of March 11, 2004, Attacks in Madrid on the March 14 Elections in Spain: A Dynamic Modelling Approach

    Directory of Open Access Journals (Sweden)

    Juan-Carlos Cortés

    2015-01-01

    Full Text Available The bomb attacks in Madrid three days before the general elections of March 14, 2004, and their possible influence on the victory of PSOE (Spanish Workers Socialist Party, defeating PP (Popular Party, have been a matter of study from several points of view (i.e., sociological, political, or statistical. In this paper, we present a dynamic model based on a system of differential equations such that it, using data from Spanish CIS (National Center of Sociological Research, describes the evolution of voting intention of the Spanish people over time. Using this model, we conclude that the probability is very low that the PSOE would have won had the attack not happened. Moreover, after the attack, the PSOE increased an average of 5.6% in voting on March 14 and an average of 11.2% of the Spanish people changed their vote between March 11 and March 14. These figures are in accordance with other studies.

  3. Do existing research summaries on health systems match immunisation managers' needs in middle- and low-income countries? Analysis of GAVI health systems strengthening support

    Directory of Open Access Journals (Sweden)

    Kelly Marion

    2011-06-01

    Full Text Available Abstract Background The GAVI Alliance was created in 2000 to increase access to vaccines. More recently, GAVI has supported evidence-based health systems strengthening to overcome barriers to vaccination. Our objectives were: to explore countries' priorities for health systems strengthening; to describe published research summaries for each priority area in relation to their number, quality and relevance; and to describe the use of national data from surveys in identifying barriers to immunisation. Methods From 44 health systems strengthening proposals submitted to GAVI in 2007 and 2008, we analysed the topics identified, the coverage of these topics by existing systematic reviews and the use of nation-wide surveys with vaccination data to justify the needs identified in the proposals. Results Thirty topics were identified and grouped into three thematic areas: health workforce (10 topics; organisation and management (14; and supply, distribution and maintenance (6. We found 51 potentially relevant systematic reviews, although for the topic that appeared most frequently in the proposals ('Health information systems' no review was identified. Thematic and geographic relevance were generally categorised as "high" in 33 (65% and 25 (49% reviews, respectively, but few reviews were categorised as "highly relevant for policy" (7 reviews, 14%. With regard to methodological quality, 14 reviews (27% were categorised as "high". The number of topics that were addressed by at least one high quality systematic review was: seven of the 10 topics in the 'health workforce' thematic area; six of the 14 topics in the area of 'organisation and management'; and none of the topics in the thematic area of 'supply, distribution and maintenance'. Only twelve of the 39 countries with available national surveys referred to them in their proposals. Conclusion Relevant, high quality research summaries were found for few of the topics identified by managers. Few proposals

  4. Review of current summary of irradiated foods

    International Nuclear Information System (INIS)

    Dyakova, A.; Tsvetkova, E.; Miteva, D.; Dimov, K.

    2005-01-01

    The reasons about widely application of food irradiation as a technology for increasing food safety were presenting in this summary. Topics which are discussing are about: purpose of the irradiation, radiological safety, toxicology, microbiological conclusion, alimentary adequacy, packing, labeling, public acceptance, inspection of food irradiated plants

  5. Spent fuel sabotage aerosol ratio program : FY 2004 test and data summary.

    Energy Technology Data Exchange (ETDEWEB)

    Brucher, Wenzel (Gesellschaft fur Anlagen- und Reaktorsicherheit, Germany); Koch, Wolfgang (Fraunhofer Institut fur Toxikologie und Experimentelle Medizin, Germany); Pretzsch, Gunter Guido (Gesellschaft fur Anlagen- und Reaktorsicherheit, Germany); Loiseau, Olivier (Institut de Radioprotection et de Surete Nucleaire, France); Mo, Tin (U.S. Nuclear Regulatory Commission, Washington, DC); Billone, Michael C. (Argonne National Laboratory, Argonne, IL); Autrusson, Bruno A. (Institut de Radioprotection et de Surete Nucleaire, France); Young, F. I. (U.S. Nuclear Regulatory Commission, Washington, DC); Coats, Richard Lee; Burtseva, Tatiana (Argonne National Laboratory, Argonne, IL); Luna, Robert Earl; Dickey, Roy R.; Sorenson, Ken Bryce; Nolte, Oliver (Fraunhofer Institut fur Toxikologie und Experimentelle Medizin, Germany); Thompson, Nancy Slater (U.S. Department of Energy, Washington, DC); Hibbs, Russell S. (U.S. Department of Energy, Washington, DC); Gregson, Michael Warren; Lange, Florentin (Gesellschaft fur Anlagen- und Reaktorsicherheit, Germany); Molecke, Martin Alan; Tsai, Han-Chung (Argonne National Laboratory, Argonne, IL)

    2005-07-01

    This multinational, multi-phase spent fuel sabotage test program is quantifying the aerosol particles produced when the products of a high energy density device (HEDD) interact with and explosively particulate test rodlets that contain pellets of either surrogate materials or actual spent fuel. This program has been underway for several years. This program provides data that are relevant to some sabotage scenarios in relation to spent fuel transport and storage casks, and associated risk assessments. The program also provides significant technical and political benefits in international cooperation. We are quantifying the Spent Fuel Ratio (SFR), the ratio of the aerosol particles released from HEDD-impacted actual spent fuel to the aerosol particles produced from surrogate materials, measured under closely matched test conditions, in a contained test chamber. In addition, we are measuring the amounts, nuclide content, size distribution of the released aerosol materials, and enhanced sorption of volatile fission product nuclides onto specific aerosol particle size fractions. These data are the input for follow-on modeling studies to quantify respirable hazards, associated radiological risk assessments, vulnerability assessments, and potential cask physical protection design modifications. This document includes an updated description of the test program and test components for all work and plans made, or revised, during FY 2004. It also serves as a program status report as of the end of FY 2004. All available test results, observations, and aerosol analyses plus interpretations--primarily for surrogate material Phase 2 tests, series 2/5A through 2/9B, using cerium oxide sintered ceramic pellets are included. Advanced plans and progress are described for upcoming tests with unirradiated, depleted uranium oxide and actual spent fuel test rodlets. This spent fuel sabotage--aerosol test program is coordinated with the international Working Group for Sabotage Concerns of

  6. Spent fuel sabotage aerosol ratio program : FY 2004 test and data summary

    International Nuclear Information System (INIS)

    Brucher, Wenzel; Koch, Wolfgang; Pretzsch, Gunter Guido; Loiseau, Olivier; Mo, Tin; Billone, Michael C.; Autrusson, Bruno A.; Young, F. I.; Coats, Richard Lee; Burtseva, Tatiana; Luna, Robert Earl; Dickey, Roy R.; Sorenson, Ken Bryce; Nolte, Oliver; Thompson, Nancy Slater; Hibbs, Russell S.; Gregson, Michael Warren; Lange, Florentin; Molecke, Martin Alan; Tsai, Han-Chung

    2005-01-01

    This multinational, multi-phase spent fuel sabotage test program is quantifying the aerosol particles produced when the products of a high energy density device (HEDD) interact with and explosively particulate test rodlets that contain pellets of either surrogate materials or actual spent fuel. This program has been underway for several years. This program provides data that are relevant to some sabotage scenarios in relation to spent fuel transport and storage casks, and associated risk assessments. The program also provides significant technical and political benefits in international cooperation. We are quantifying the Spent Fuel Ratio (SFR), the ratio of the aerosol particles released from HEDD-impacted actual spent fuel to the aerosol particles produced from surrogate materials, measured under closely matched test conditions, in a contained test chamber. In addition, we are measuring the amounts, nuclide content, size distribution of the released aerosol materials, and enhanced sorption of volatile fission product nuclides onto specific aerosol particle size fractions. These data are the input for follow-on modeling studies to quantify respirable hazards, associated radiological risk assessments, vulnerability assessments, and potential cask physical protection design modifications. This document includes an updated description of the test program and test components for all work and plans made, or revised, during FY 2004. It also serves as a program status report as of the end of FY 2004. All available test results, observations, and aerosol analyses plus interpretations--primarily for surrogate material Phase 2 tests, series 2/5A through 2/9B, using cerium oxide sintered ceramic pellets are included. Advanced plans and progress are described for upcoming tests with unirradiated, depleted uranium oxide and actual spent fuel test rodlets. This spent fuel sabotage--aerosol test program is coordinated with the international Working Group for Sabotage Concerns of

  7. We Cannot Walk Away: DEC's Position of Child Abuse, Neglect, and Trauma

    Science.gov (United States)

    Corr, Catherine

    2016-01-01

    This article details two important reasons why supporting young children with disabilities who have experienced abuse and neglect and their families is the responsibility and obligation of the Division for Early Childhood of the Council for Exceptional Children (DEC): (1) Although prevalent in their work, this population is overlooked; and (2)…

  8. Summaries of special research project on nuclear fusion 1980

    International Nuclear Information System (INIS)

    Uchida, Taijiro

    1981-09-01

    This is a report of the research project entitled ''Nuclear fusion'', supported by the grant in aid for fusion research from the Ministry of Education in the fiscal year 1980. The research project was started in April, 1980, and comprises the following seventeen subjects of nuclear fusion research. 1) Heavy irradiation effects, 2) plasma-wall interaction, 3) neutronics, 4) welding engineering, 5) science and technology of tritium, 6) biological effects of tritium, 7) diagnostics of high temperature plasma, 8) new lasers, 9) fundamentals of plasma heating, 10) high efficiency energy conversion, 11) theory and computer simulation, 12) superconducting materials, 13) fundamental phenomena of superconductivity, 14) magnet technology, 15) heat transfer and structural engineering, 16) system design, and 17) resources and assessment of fusion energy. 43 summaries concerning reactor materials and plasma-wall interaction, 29 summaries concerning the science, technology and biological effects of tritium, 41 summaries concerning the fundamentals of reactor plasma control, 15 summaries concerning the technology of superconducting magnets, and 14 summaries concerning the design of fusion reactors and its evaluation are collected in this report, and their results and progress can be known. (Kako, I.)

  9. Electron-Cloud Build-Up: Summary

    International Nuclear Information System (INIS)

    Furman, M.A.

    2007-01-01

    I present a summary of topics relevant to the electron-cloud build-up and dissipation that were presented at the International Workshop on Electron-Cloud Effects 'ECLOUD 07' (Daegu, S. Korea, April 9-12, 2007). This summary is not meant to be a comprehensive review of the talks. Rather, I focus on those developments that I found, in my personal opinion, especially interesting. The contributions, all excellent, are posted in http://chep.knu.ac.kr/ecloud07/

  10. MO-E-17A-09: Has Cancer Risk for Pediatric CT Increased Or Decreased? An Analysis of Cohort Data From 2004-2013

    International Nuclear Information System (INIS)

    Brady, S; Kaufman, R

    2014-01-01

    Purpose: To analyze CT radiation dosimetry trends in a pediatric population imaged with modern (2004-2013) CT technology Methods: The institutional review board approved this retrospective review. Two cohorts of pediatric patients that received CT scans for treatment or surveillance for Wilms tumor (n=73) or Neuroblastoma (n=74) from 2004–2013 were included in this study. Patients were scanned during this time period on a GE Ultra (8 slice; 2004–2007), a GE VCT (2008–2011), or a GE VCT-XTe (2011–2013). Each patient's individual or combined chest, abdomen, and pelvic CT exams (n=4138) were loaded onto a PACS workstation (Intelerad, Canada) and measured to calculate their effective diameter and SSDE. Patient SSDE was used to estimate patient organ dosimetry based on previously published data. Patient's organ dosimetry were sorted by gender, weight, age, scan protocol (i.e., chest, abdomen, or pelvis), and CT scanner technology and averaged accordingly to calculate population averaged absolute and effective dose values. Results: Patient radiation dose burden calculated for all genders, weights, and ages decreased at a rate of 0.2 mSv/year (4.2 mGy/year; average organ dose) from 2004–2013; overall levels decreased by 50% from 3.0 mSv (60.0 mGy) to 1.5 mSv (25.9 mGy). Patient dose decreased at equal rates for both male and female, and for individual scan protocols. The greatest dose savings was found for patients between 0–4 years old (65%) followed by 5-9 years old (45%), 10–14 years old (30%), and > 14 years old (21%). Conclusion: Assuming a linear-nothreshold model, there always will be potential risk of cancer induction from CT. However, as demonstrated among these patient populations, effective and organ dose has decreased over the last decade; thus, potential risk of long-term side effects from pediatric CT examinations has also been reduced

  11. MO-E-17A-09: Has Cancer Risk for Pediatric CT Increased Or Decreased? An Analysis of Cohort Data From 2004-2013

    Energy Technology Data Exchange (ETDEWEB)

    Brady, S; Kaufman, R [St. Jude Children' s Research Hospital, Memphis, TN (United States)

    2014-06-15

    Purpose: To analyze CT radiation dosimetry trends in a pediatric population imaged with modern (2004-2013) CT technology Methods: The institutional review board approved this retrospective review. Two cohorts of pediatric patients that received CT scans for treatment or surveillance for Wilms tumor (n=73) or Neuroblastoma (n=74) from 2004–2013 were included in this study. Patients were scanned during this time period on a GE Ultra (8 slice; 2004–2007), a GE VCT (2008–2011), or a GE VCT-XTe (2011–2013). Each patient's individual or combined chest, abdomen, and pelvic CT exams (n=4138) were loaded onto a PACS workstation (Intelerad, Canada) and measured to calculate their effective diameter and SSDE. Patient SSDE was used to estimate patient organ dosimetry based on previously published data. Patient's organ dosimetry were sorted by gender, weight, age, scan protocol (i.e., chest, abdomen, or pelvis), and CT scanner technology and averaged accordingly to calculate population averaged absolute and effective dose values. Results: Patient radiation dose burden calculated for all genders, weights, and ages decreased at a rate of 0.2 mSv/year (4.2 mGy/year; average organ dose) from 2004–2013; overall levels decreased by 50% from 3.0 mSv (60.0 mGy) to 1.5 mSv (25.9 mGy). Patient dose decreased at equal rates for both male and female, and for individual scan protocols. The greatest dose savings was found for patients between 0–4 years old (65%) followed by 5-9 years old (45%), 10–14 years old (30%), and > 14 years old (21%). Conclusion: Assuming a linear-nothreshold model, there always will be potential risk of cancer induction from CT. However, as demonstrated among these patient populations, effective and organ dose has decreased over the last decade; thus, potential risk of long-term side effects from pediatric CT examinations has also been reduced.

  12. OL-DEC-MDP Model for Multiagent Online Scheduling with a Time-Dependent Probability of Success

    Directory of Open Access Journals (Sweden)

    Cheng Zhu

    2014-01-01

    Full Text Available Focusing on the on-line multiagent scheduling problem, this paper considers the time-dependent probability of success and processing duration and proposes an OL-DEC-MDP (opportunity loss-decentralized Markov Decision Processes model to include opportunity loss into scheduling decision to improve overall performance. The success probability of job processing as well as the process duration is dependent on the time at which the processing is started. The probability of completing the assigned job by an agent would be higher when the process is started earlier, but the opportunity loss could also be high due to the longer engaging duration. As a result, OL-DEC-MDP model introduces a reward function considering the opportunity loss, which is estimated based on the prediction of the upcoming jobs by a sampling method on the job arrival. Heuristic strategies are introduced in computing the best starting time for an incoming job by each agent, and an incoming job will always be scheduled to the agent with the highest reward among all agents with their best starting policies. The simulation experiments show that the OL-DEC-MDP model will improve the overall scheduling performance compared with models not considering opportunity loss in heavy-loading environment.

  13. Θ13 Neutrino Experiment at the Diablo Canyon Power Plant. LBNL Engineering Summary Report

    International Nuclear Information System (INIS)

    Oshatz, Daryl

    2004-01-01

    This summary document describes the results of conceptual design and cost estimates performed by LBNL Engineering staff between October 10, 2003 and March 12, 2004 for the proposed θ 13 neutrino experiment at the Diablo Canyon Power Plant (DCPP). This document focuses on the detector room design concept and mechanical engineering issues associated with the neutrino detector structures. Every effort has been made not to duplicate information contained in the last LBNL Engineering Summary Report dated October 10, 2003. Only new or updated information is included in this document

  14. LABORATORY DIRECTED RESEARCH AND DEVELOPMENT ANNUAL REPORT TO THE DEPARTMENT OF ENERGY - DECEMBER 2004

    Energy Technology Data Exchange (ETDEWEB)

    FOX,K.J.

    2004-12-31

    ideas, which becomes a major factor in achieving and maintaining staff excellence and a means to address national needs within the overall mission of the DOE and BNL. The LDRD Annual Report contains summaries of all research activities funded during Fiscal Year 2004. The Project Summaries with their accomplishments described in this report reflect the above. Aside from leading to new fundable or promising programs and producing especially noteworthy research, the LDRD activities have resulted in numerous publications in various professional and scientific journals and presentations at meetings and forums. All FY 2004 projects are listed and tabulated in the Project Funding Table. Also included in this Annual Report in Appendix A is a summary of the proposed projects for FY 2005. The BNL LDRD budget authority by DOE in FY 2004 was $9.5 million. The actual allocation totaled $8.5 million. The following sections in this report contain the management processes, peer review, and the portfolio's relatedness to BNL's mission, initiatives and strategic plans. Also included is a metric of success indicators and Self Assessment.

  15. Prevalência de perda precoce de molares decíduos: estudo retrospectivo = Prevalence of early loss of deciduous molars: a retrospective study

    Directory of Open Access Journals (Sweden)

    Alessandro Leite Cavalcanti

    2008-07-01

    Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce demolares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido,arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientescom sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiromolar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being themost involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the

  16. KURRI progress report 2004. April 2004 - March 2005

    International Nuclear Information System (INIS)

    2005-01-01

    The fiscal year 2004 was the 40-th anniversary of Kyoto University research Reactor (KUR) and also the 30-th anniversary of Kyoto University Critical Assembly (KUCA). The KUR and KUCA have been operated for 1,316 and 732 hours, respectively. Kyoto University Research Reactor Institute (KURRI) accepted 5,186 man-day researchers including students in total for their experiments in accordance with the joint use programs among Japanese universities and public research organizations, and for scientific meetings held at KURRI. Note here that, since the application of boron neutron capture therapy (BNCT) was expanded to the head and neck cancers in addition to the brain tumors and skin cancers, the number of patients treated with the BNCT was greatly increasing year by year. Number of clinical irradiations were 11 in FY2002, 36 in FY2003, and 54 in FY2004. The results of these activities are reported in this progress report. The total 153 research issues are categorized to the 10 topics as follows; (1) Slow Neutron Physics and Neutron Scattering includes the 8 issues as general researches. (2) Nuclear Physics and Nuclear Data includes the 15 issues for the project research and the 2 issues as general researches. (3) Reactor Physics and Reactor Engineering includes the 6 issues as general researches. (4) Material Science and Radiation Effects includes the 21 issues for the project research and the 21 issues as general researches. (5) Geochemistry and Environmental Science includes the 16 issues as general researches. (6) Life Science and Medical Science includes the 5 issues for the project research and the 14 issues as general researches. (7) Neutron Capture Therapy includes the 19 issues as general researches. (8) Neutron Radiography and Radiation Application includes the 9 issues for the project research and the 3 issues as general researches. (9) TRU and Nuclear Chemistry includes the 11 issues for the project research. (10) Health Physics and Waste Management includes

  17. Nuclear Physics Division - Inst. of Experimental Physics - Warsaw University - Annual Report 2004

    International Nuclear Information System (INIS)

    Kirejczyk, M.K.

    2005-01-01

    In the presented report the research activities of Nuclear Physics Division (NPD) of the Warsaw University Institute of Experimental Physics in year of 2004 are described. The report is divided into three parts: Reaction Mechanisms and Nuclear Structure, Experimental Methods and Instrumentation and the third one contains the lists of personnel, seminars held at the Nuclear Physics Division and list of published papers. A summary of the (NPD) activities are briefly presented in ''Preface'' written by NDP director prof. K. Siwek-Wilczynska

  18. Epidemiological data on food poisonings in Japan focused on Salmonella, 1998-2004.

    Science.gov (United States)

    Toyofuku, H

    2008-09-01

    In Japan, the numbers and cases of food poisonings must be reported as required by the Food Sanitation Law. This paper focuses on Salmonella, one of the leading food-borne pathogens in Japan, and it analyses the reported food poisoning data to assess the nature of Salmonella-associated food-borne disease. Obviously, these data do not exactly reflect the burden of food-borne illness associated with Salmonella; however, trends in Salmonella food poisoning and implicated foods could be identified for the purpose of setting priorities to mitigate the risk of food-borne salmonellosis. Summary information of Salmonella food poisoning investigation reports submitted by health departments of all prefectures and major cities between January 1998 and December 2004 was analysed. Both the number of reports and the cases of Salmonella food poisoning decreased drastically from 1999 (831 Salmonella food poisoning reports with 11,877 cases) to 2001 (265 reports with 7011 cases), increased in 2002, and then decreased again in 2003 and 2004 (231 reports with 3793 cases in 2004). About 80% of the Salmonella food poisoning reports and cases were associated with Salmonella enteritidis throughout the study period. Food vehicles were identified in 17-25% of the Salmonella food poisoning reports. Between 1998 and 2002, 45-60% of the Salmonella food poisoning cases were associated with eggs; however, the percentage dropped to 24.2% in 2003. The number of Salmonella food poisoning reports associated with beef, pork and poultry meat, and raw vegetables, which have been frequently reported in other countries, were very limited. Among the identified locations of disease break outs, 30-49% occurred in restaurant settings and the percentage of cases in restaurants increased during the study period. Thirteen to 41% of the Salmonella food poisoning cases occurred within the home, and the percentage declined. Phage types 1 and 4 were the predominant S. enteritidis isolated in 1998 and 1999; however

  19. President kinnitas riigieelarve

    Index Scriptorium Estoniae

    2003-01-01

    Pealkiri ajalehes Postimees (2003/Dec/30) lk. 3: "President kuulutas välja tuleva aasta riigieelarve". Ilmunud ka Meie Maa (2003/Dec/30) lk. 1 ; SL Õhtuleht (2003/Dec/30) lk. 2 ; Virumaa Teataja (2003/Dec/30) lk. 1. President Arnold Rüütel allkirjastas otsuse, millega kuulutas välja 2004. aasta riigieelarve

  20. Association Euratom - Risoe National Laboratory annual progress report 2004

    Energy Technology Data Exchange (ETDEWEB)

    Bindslev, H.; Singh, B.N (eds.)

    2005-06-01

    The programme of the Research Unit of the Fusion Association Euratom - Risoe National Laboratory covers work in fusion plasma physics and in fusion technology. The fusion plasma physics research focuses on turbulence and transport, and its interaction with the plasma equilibrium and particles. The effort includes both first principles based modelling, and experimental observations of turbulence and of fast ion dynamics by collective Thomson scattering. The activities in technology cover investigations of radiation damage of fusion reactor materials. These activities contribute to the Next Step, the Long-term and the Underlying Fusion Technology programme. A summary is presented of the results obtained in the Research Unit during 2004. (au)

  1. Analysis of events occurred at overseas nuclear power plants in 2004

    International Nuclear Information System (INIS)

    Miyazaki, Takamasa; Nishioka, Hiromasa; Sato, Masahiro; Chiba, Gorou; Takagawa, Kenichi; Shimada, Hiroki

    2005-01-01

    The Institute of Nuclear Safety Systems (INSS) investigates the information related to events and incidents occurred at overseas nuclear power plants, and proposes recommendations for the improvement of the safety and reliability of domestic PWR plants by evaluating them. Succeeding to the 2003 report, this report shows the summary of the evaluation activity and of the tendency analysis based on about 2800 information obtained in 2004. The tendency analysis was undertaken on about 1700 analyzed events, from the view point of mechanics, electrics and operations, about the causes, troubled equipments and so on. (author)

  2. Ansback AHP, Germany Limited Surface Observations Climatic Summary (LISOCS).

    Science.gov (United States)

    1984-09-01

    AL ., I V PSYCHROMETRIC SUMMARY ra ,. , a’ . .. MIT BULB TEMPERATURE DEPRESION (P) TOTAL TOTAL C 2,3 4 7 1 9.10 It 1213 14 15 16 17-1619 20*21 22 23...lt* a~ 4 * 4* 1lcl3 *,~ i, - . . . . . . ... . .... ... . .. . . * : .. .. . .... T "PSYCHROMETRIC SUMMARY - - ., WIT IUL$ ’IMPIIATUIE DEPRESION (F

  3. Optics and Plasma Research Department. Annual progress report for 2004

    International Nuclear Information System (INIS)

    Bindslev, H.; Lynov, J.P.; Pedersen, C.; Petersen, P.M.; Skaarup, B.

    2005-03-01

    The Optics and Plasma Research Department performs basic and applied research within three scientific programmes: (1) laser systems and optical materials, (2) optical diagnostics and information processing and (3) plasma physics and technology. The department has core competencies in optical sensors, optical materials, biophotonics, fusion plasma physics, and industrial plasma technology. The department employs key technologies in micro- and nanotechnology for optical systems, temperature calibration, and infrared measurement techniques. The research is supported by several EU programmes, including EURATOM, by Danish research councils and by industry. A summary of the activities in 2004 is presented. (au)

  4. Um comentário sobre Gerasa, a cidade de Decápolis

    Directory of Open Access Journals (Sweden)

    Marisa Balsamo Steingberg

    1969-09-01

    Full Text Available Num remoto e quieto vale, junto às montanhas de Gilead, extendem-se as ruínas de Gerasa (Jerash atual, cidade da Decápolis . Sente-se seu poderio através de suas ruas e monumentos em bom estado de conservação: um dos mais complexos de cidade provincial romana.

  5. A semi annual report on the activities in safety administration division. Report of the second half of 2004

    International Nuclear Information System (INIS)

    Yamamoto, Junta

    2005-07-01

    The activities of Safety Administration Division covers many fields in Tokai-Works such as the management of a safety and health, the crisis management and the security, and the management of a quality assurance. This report is summary of the activities of Safety Administration Division in October, 2004 to March, 2005. (author)

  6. 2009 Biomass Program Peer Review Report

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, John [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)

    2009-12-01

    This document summarizes the recommendations and evaluations provided by an independent external panel of experts at the U.S. Department of Energy Biomass Program‘s 2009 peer review meeting, held on July 14–15, 2009, in Arlington, Virginia. The document also includes summary information from the six separate platform reviews conducted between March and April 2009 in the Washington, D.C., and Denver, Colorado, areas. The platform reviews provide evaluations of the program‘s projects in applied research, development, and demonstration as well as analysis and deployment activities. The July program peer review was an evaluation of the program‘s overall strategic planning, management approach, priorities across research areas, and resource allocation.

  7. Summary and outlook

    Energy Technology Data Exchange (ETDEWEB)

    Jong, M. de, E-mail: mjg@nikhef.nl [Nikhef - National Institute for Subatomic Physics, Science Park 105, 1098 XG Amsterdam (Netherlands); LION - Leiden Institute of Physics, Leiden University, PO Box 9504, 2300 RA Leiden (Netherlands)

    2013-10-11

    In 2003, a series of Very Large Volume Neutrino Telescope Workshops (VLVnT) was initiated in Amsterdam, the Netherlands. The 5th workshop in this series took place in Erlangen, Germany, between 12–14 October 2011 and focused on the aspects of high-energy neutrino astronomy. In this summary report, an overview of the activities world-wide is presented as well as the perspectives of the field.

  8. 2. IAEA research co-ordination meeting on 'Atomic and molecular data for fusion plasma diagnostics'. Summary report

    International Nuclear Information System (INIS)

    Clark, R.E.H.

    2004-05-01

    This report briefly describes the proceedings, conclusions and recommendations of the 2nd Research Co-ordination Meeting (RCM) of the Co-ordinated Research Project (CRP) on 'Atomic and Molecular Data for Fusion Plasma Diagnostics' held on 16-18 June 2003 at IAEA Headquarters, Vienna. During the course of the meeting the progress achieved to data was thoroughly reviewed. It was noted that during the course of the research several new areas of data needs were revealed. During detailed discussions proposals from all participants on ongoing data needs indicated that a one year extension of the CRP would be extremely valuable with an additional RCM to be held in 2004. A specific proposal for such an extension was formulated along with the summary of the results achieved to date. (author)

  9. CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

  10. Systematic reviews of bruising in relation to child abuse-what have we learnt: an overview of review updates.

    Science.gov (United States)

    Maguire, Sabine; Mann, Mala

    2013-03-07

    Dogma has long prevailed regarding the ageing of bruises, and whether certain patterns of bruising are suggestive or diagnostic of child abuse. We conducted the first Systematic Reviews addressing these two issues, to determine the scientific basis for current clinical practice. There have been seven updates since 2004. An all language literature search was performed across 13 databases, 1951-2004, using >60 key words, supplemented by 'snowballing' techniques. Quality standards included a novel confirmation of abuse scale. Updates used expanded key words, and a higher standard for confirmation of abuse. Of 1495 potential studies, only three met the inclusion criteria for ageing of bruises in 2004, confirming that it is inaccurate to do so with the naked eye. This was roundly rejected when first reported, generating a wave of new studies attempting to determine a scientifically valid method to age bruises, none of which are applicable in children yet. Regarding patterns of bruising that may be suggestive or diagnostic of abuse, we included 23 of 167 studies reviewed in 2004, although only 2 were comparative studies. Included studies noted that unintentional bruises occur predominantly on the front of the body, over bony prominences and their presence is directly correlated to the child's level of independent mobility. Bruising patterns in abused children, differed in location (most common site being face, neck, ear, head, trunk, buttocks, arms), and tended to be larger. Updates have included a further 14 studies, including bruising in disabled children, defining distinguishing patterns in severely injured abused and non-abused children, and importance of petechiae. Systematic Reviews of bruising challenged accepted wisdom regarding ageing of bruises, which had no scientific basis; stimulated higher quality research on patterns of bruises distinguishing abusive and non-abusive bruising patterns, and highlighted the benefits of regular updates of these reviews

  11. Program summary report

    International Nuclear Information System (INIS)

    1978-01-01

    The report provides summary information on all phases of nuclear regulation, and is intended as an information and decision-making tool for mid and upper level management of the Nuclear Regulatory Commission. The report is divided functionally into ten sections: (1) nuclear power plants in the United States; (2) operating nuclear power plants; (3) reactors under construction; (4) operating license applications under NRC review; (5) construction permit applications and special projects under NRC review; (6) ACRS and ASLBP; (7) nuclear materials; (8) standards and regulations; (9) research projects; and (10) foreign reactors

  12. Ecological Characterization Data for the 2004 Composite Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Downs, Janelle L.; Simmons, Mary A.; Stegen, Jennifer A.; Bunn, Amoret L.; Tiller, Brett L.; Thorsten, Susan L.; Zufelt, Rhett K.

    2004-11-01

    A composite analysis is required by U.S. Department of Energy (DOE) Order 435.1 to ensure public safety through the management of active and planned low-level radioactive waste disposal facilities associated with the Hanford Site. The original Hanford Site Composite Analysis of 1998 must be revised and submitted to DOE Headquarters (DOE-HQ) in 2004 because of revisions to waste site information in the 100, 200, and 300 Areas, updated performance assessments and environmental impact statements (EIS), changes in inventory estimates for key sites and constituents, and a change in the definition of offsite receptors. Beginning in fiscal year (FY) 2003, the DOE Richland Operations Office (DOE-RL) initiated activities, including the development of data packages, to support the 2004 Composite Analysis. This report describes the data compiled in FY 2003 to support ecological site assessment modeling for the 2004 Composite Analysis. This work was conducted as part of the Characterization of Systems Task of the Groundwater Remediation Project (formerly the Groundwater Protection Program) managed by Fluor Hanford, Inc., Richland, Washington. The purpose of this report is to provide summaries of the characterization information and available spatial data on the biological resources and ecological receptors found in the upland, riparian, aquatic, and island habitats on the Hanford Site. These data constitute the reference information used to establish parameters for the ecological risk assessment module of the System Assessment Capability and other assessment activities requiring information on the presence and distribution of biota on the Hanford Site.

  13. Ecological Characterization Data for the 2004 Composite Analysis

    International Nuclear Information System (INIS)

    Downs, Janelle L.; Simmons, Mary A.; Stegen, Amanda A.; Bunn, Amoret L.; Tiller, Brett L.; Thorsten, Susan L.; Zufelt, Rhett K.

    2004-01-01

    A composite analysis is required by U.S. Department of Energy (DOE) Order 435.1 to ensure public safety through the management of active and planned low-level radioactive waste disposal facilities associated with the Hanford Site. The original Hanford Site Composite Analysis of 1998 must be revised and submitted to DOE Headquarters (DOE-HQ) in 2004 because of revisions to waste site information in the 100, 200, and 300 Areas, updated performance assessments and environmental impact statements (EIS), changes in inventory estimates for key sites and constituents, and a change in the definition of offsite receptors. Beginning in fiscal year (FY) 2003, the DOE Richland Operations Office (DOE-RL) initiated activities, including the development of data packages, to support the 2004 Composite Analysis. This report describes the data compiled in FY 2003 to support ecological site assessment modeling for the 2004 Composite Analysis. This work was conducted as part of the Characterization of Systems Task of the Groundwater Remediation Project (formerly the Groundwater Protection Program) managed by Fluor Hanford, Inc., Richland, Washington. The purpose of this report is to provide/SUMmaries of the characterization information and available spatial data on the biological resources and ecological receptors found in the upland, riparian, aquatic, and island habitats on the Hanford Site. These data constitute the reference information used to establish parameters for the ecological risk assessment module of the System Assessment Capability and other assessment activities requiring information on the presence and distribution of biota on the Hanford Site

  14. 14 CFR 121.1105 - Aging airplane inspections and records reviews.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aging airplane inspections and records... Improvements § 121.1105 Aging airplane inspections and records reviews. (a) Applicability. This section applies to all airplanes operated by a certificate holder under this part, except for those airplanes...

  15. Nuclear medical inpatient treatment in Germany. Analysis of the structured quality reports 2004 to 2008; Stationaere nuklearmedizinische Therapie in Deutschland. Analyse der strukturierten Qualitaetsberichte 2004 bis 2008

    Energy Technology Data Exchange (ETDEWEB)

    Lorenz, R.; Reiners, C. [Universitaetsklinikum Wuerzburg (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Dietlein, M. [Koeln Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin

    2010-07-01

    All public licensed hospitals of Germany are obligated since 2004 to establish and to publish a structured biennial quality report. The aim of this study was to analyse the quality reports from 2008 of clinics with nuclear-medicine therapy ward and to investigate developments for the inpatient nuclear-medicine therapy by comparing the results with the quality reports of the years 2004 and 2006. Methods: All available structured quality reports of clinics with a nuclear-medicine therapy ward of the years 2004, 2006 and 2008 were evaluated. Results: The total number of inpatient treatment cases in 2008 amounted to 54 190 (2006: 54 884; 2004: 57 366). This corresponds to a decrease of 5.5% in comparison to 2004. The number of the therapy wards decreased at the same time to currently 117 (2006: 120; 2004: 124). Remarkable changes were found in the spectrum of the main diagnosis. Thus, the most frequent diagnosis with the ICD-code E05 (hyperthyroidism) decreased continuously from 37 747 treatments in 2004 and 34 764 in 2006 to 31 756 in the year 2008. In contrast, the ICD-diagnoses for thyroid cancer (C73, Z08) with 14 761 cases in 2008 increased with time (2006: 13 426; 2004: 12 581). Conclusions: In analogy to the observations from Europe after introduction of an iodine prophylaxis the improved iodine supply in Germany has led to a decline of the radioiodine therapy due to hyperthyroidism.

  16. Comparison of Water Years 2004-05 and Historical Water-Quality Data, Upper Gunnison River Basin, Colorado

    Science.gov (United States)

    Spahr, Norman E.; Hartle, David M.; Diaz, Paul

    2008-01-01

    Population growth and changes in land use have the potential to affect water quality and quantity in the upper Gunnison River Basin. In 1995, the U.S. Geological Survey (USGS), in cooperation with the Bureau of Land Management, City of Gunnison, Colorado River Water Conservation District, Crested Butte South Metropolitan District, Gunnison County, Hinsdale County, Mount Crested Butte Water and Sanitation District, National Park Service, Town of Crested Butte, Upper Gunnison River Water Conservancy District, and Western State College, established a water-quality monitoring program in the upper Gunnison River Basin to characterize current water-quality conditions and to assess the effects of increased urban development and other land-use changes on water quality. The monitoring network has evolved into two groups of stations - stations that are considered long term and stations that are considered rotational. The long-term stations are monitored to assist in defining temporal changes in water quality (how conditions may change over time). The rotational stations are monitored to assist in the spatial definition of water-quality conditions (how conditions differ throughout the basin) and to address local and short-term concerns. Some stations in the rotational group were changed beginning in water year 2007. Annual summaries of the water-quality data from the monitoring network provide a point of reference for discussions regarding water-quality monitoring in the upper Gunnison River Basin. This summary includes data collected during water years 2004 and 2005. The introduction provides a map of the sampling sites, definitions of terms, and a one-page summary of selected water-quality conditions at the network stations. The remainder of the summary is organized around the data collected at individual stations. Data collected during water years 2004 and 2005 are compared to historical data, State water-quality standards, and Federal water-quality guidelines. Data were

  17. Crustáceos decápodos asociados a ensamblajes macroalgales en el litoral rocoso de Córdoba, Caribe colombiano

    Directory of Open Access Journals (Sweden)

    Néstor Hernando Campos

    2012-04-01

    Full Text Available Objetivo. Determinar la estructura de las poblaciones de crustáceos decápodos asociados a ensamblajes algales en el litoral rocoso del departamento de Córdoba. Materiales y métodos. Para la recolección de los especímenes se delimitó con un cuadrante de 625 cm2, un área con cinco repeticiones dispuestas al azar en cada estación. Para la separación de las macroalgas desde su disco de fijación en el sustrato, se empleó una espátula metálica. En un recipiente plástico se separaron los crustáceos decápodos del resto del material y se conservaron en alcohol al 70%. Resultados. Se identificaron representantes de 50 especies asociadas a los céspedes algales, agrupadas en 16 familias y 29 géneros. Especies como Acanthonyx petiverii, Epialtus bituberculatus, Eurypanopeus abbreviatus y Pachycheles serratus, presentaron un rango amplio de distribución, siendo características en las dos ecorregiones de estudio. Los cambios en cobertura de algas rojas como Gracilaria mammillaris, Hypnea musciformis y Acanthophora muscoides, determinaron la mayor asociación de crustáceos decápodos en la ecorregión Morrosquillo, mientras que los cambios en cobertura de G. damaecornis y Padina gymnospora, fueron las que determinaron la mayor asociación de crustáceos decápodos en el Darién cordobés. Conclusiones. Los resultados indicaron que las especies de crustáceos decápodos asociados a ensamblajes macroalgales, no se encontraron distribuidas de forma similar en las dos ecorregiones estudiadas, siendo P. armatus la especie con mayor porcentaje de abundancia en la ecorregión Morrosquillo, y E. bituberculatus en el sector comprendido entre los municipios de Moñitos y Los Córdobas.

  18. Stability, energetic particles, waves, and current drive summary

    International Nuclear Information System (INIS)

    Stambaugh, R.D.

    2005-01-01

    This is the summary paper for the subjects of plasma stability, energetic particles, waves, and current drive for the 20th IAEA Fusion Energy Conference, 1-6 November 2004, Vilamoura, Portugal. Material summarized herein was drawn from 65 contributed papers and 21 overview papers. The distribution of contributed papers by subjects is shown. Significant advances were reported on the principal instabilities in magnetically confined plasmas, even looking forward to the burning plasma state. Wave-plasma physics is maturing and novel methods of current drive and noninductive current generation are being developed. (author)

  19. Eastern Africa Social Science Research Review - Vol 20, No 2 (2004)

    African Journals Online (AJOL)

    Evading Household Indebtedness Through Participation in group solidarity coping strategies in Contemporary Botswana · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Barbara Ntombi Ngwenya, 1-30. http://dx.doi.org/10.1353/eas.2004.0009 ...

  20. Interoperability Assets for Patient Summary Components: A Gap Analysis.

    Science.gov (United States)

    Heitmann, Kai U; Cangioli, Giorgio; Melgara, Marcello; Chronaki, Catherine

    2018-01-01

    The International Patient Summary (IPS) standards aim to define the specifications for a minimal and non-exhaustive Patient Summary, which is specialty-agnostic and condition-independent, but still clinically relevant. Meanwhile, health systems are developing and implementing their own variation of a patient summary while, the eHealth Digital Services Infrastructure (eHDSI) initiative is deploying patient summary services across countries in the Europe. In the spirit of co-creation, flexible governance, and continuous alignment advocated by eStandards, the Trillum-II initiative promotes adoption of the patient summary by engaging standards organizations, and interoperability practitioners in a community of practice for digital health to share best practices, tools, data, specifications, and experiences. This paper compares operational aspects of patient summaries in 14 case studies in Europe, the United States, and across the world, focusing on how patient summary components are used in practice, to promote alignment and joint understanding that will improve quality of standards and lower costs of interoperability.

  1. Digital Equipment Corporation (DEC): A case study of indecision, innovation and company failure

    NARCIS (Netherlands)

    Goodwin, D.T.

    2016-01-01

    The minicomputer began a revolution in the computer industry and was influential in the industry for over twenty years until superseded by client server computing and the personal computer. The subject of the thesis is a case study of how DEC, which was number two in the world in 1988, became a

  2. Crisis Management: Research Summaries

    Science.gov (United States)

    Brock, Stephen E., Ed.; Dorman, Sally; Anderson, Luke; McNair, Daniel

    2013-01-01

    This article presents summaries of three studies relevant to school crisis response. The first report, "A Framework for International Crisis Intervention" (Sally Dorman), is a review of how existing crisis intervention models (including the NASP PREPaRE model) have been adapted for international use. The second article, "Responding…

  3. Terapia pulpar em dentes decíduos: possibilidades terapêuticas baseadas em evidências

    Directory of Open Access Journals (Sweden)

    Natalino Lourenço Neto

    Full Text Available INTRODUÇÃO: A pulpotomia em dentes decíduos é uma técnica conservadora de terapia pulpar amplamente utilizada em Odontopediatria, sendo de fundamental importância para evitar a perda prematura desses dentes, quer seja por alterações provocadas pela cárie dentária ou traumatismo dentário. Apesar de ser uma técnica estudada há muitos anos, causa muitas controvérsias e discussões, principalmente em termos de biocompatibilidade dos medicamentos empregados e pelas dificuldades e falhas no diagnóstico da condição pulpar. OBJETIVO: Por meio de uma revisão sistemática da literatura, no período compreendido entre 2000 e 2011, e com enfoque em estudos clínicos randomizados, revisões sistemáticas e meta-análises, este trabalho teve como objetivo discutir, com base em evidências científicas, alternativas para o tratamento de pulpotomia em dentes decíduos humanos. CONCLUSÃO: As evidências científicas fidedignas com o uso de materiais capeadores pulpares e as técnicas de Eletrocirurgia e Laser de Baixa Potência foram escassas. Desta forma, sugere-se a realização de estudos complementares bem delineados estatisticamente para maiores esclarecimentos. As informações geradas em tais experimentos poderão contribuir para um melhor entendimento dos mecanismos da terapia pulpar, podendo gerar o desenvolvimento de protocolos com novas formas terapêuticas, que visam a melhorar a terapia pulpar em dentes decíduos.

  4. Eastern Africa Social Science Research Review - Vol 20, No 2 (2004)

    African Journals Online (AJOL)

    Evading Household Indebtedness Through Participation in group solidarity coping strategies in Contemporary Botswana · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Barbara Ntombi Ngwenya, 1-30. http://dx.doi.org/10.1353/eas.2004.0009 ...

  5. Swiss energy statistics 2004; Schweizerische Gesamtenergiestatistik 2004/Statistique globale suisse de l'energie 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This comprehensive report by the Swiss Federal Office of Energy (SFOE) presents statistics on energy production and consumption in Switzerland in 2004. Facts and figures are presented in tables and diagrams. First of all, a general overview of Swiss energy consumption is presented that includes details on the shares taken by the various energy carriers involved and their development during the period reviewed. The report also includes graphical representations of energy usage in various sectors such as households, trade and industry, transport and the services sector. Also, economic data on energy consumption is presented. A second chapter takes a look at energy flows from producers to consumers and presents an energy balance for Switzerland in the form of tables and an energy-flow diagram. The individual energy sources and the import, export and storage of energy carriers are discussed as is the conversion between various forms and categories of energy. Details on the consumption of energy, its growth over the years up to 2004 and energy use in various sectors are presented. Also, the Swiss energy balance with reference to the use of renewable forms of energy such as solar energy, biomass, wastes and ambient heat is discussed and figures are presented on the contribution of renewables to heating and the generation of electrical power. The third chapter provides data on the individual energy carriers and the final chapter looks at economical and ecological aspects. An appendix provides information on the methodology used in collecting the statistics and on data available in the Swiss cantons.

  6. POST-CLOSURE INSPECTION AND MONITORING REPORT FOR CORRECTIVE ACTION UNIT 112: AREA 23 HAZARDOUS WASTE TRENCHES, NEVADA TEST SITE, NEVADA; FOR THE PERIOD OCTOBER 2003 - SEPTEMBER 2004

    International Nuclear Information System (INIS)

    BECHTEL NEVADA

    2004-01-01

    Corrective Action Unit (CAU) 112, Area 23 Hazardous Waste Trenches, Nevada Test Site (NTS), Nevada, is a Resource Conservation and Recovery Act (RCRA) unit located in Area 23 of the NTS. This annual Post-Closure Inspection and Monitoring Report provides the results of inspections and monitoring for CAU 112. This report includes a summary and analysis of the site inspections, repair and maintenance, meteorological information, and neutron soil moisture monitoring data obtained at CAU 112 for the current monitoring period, October 2003 through September 2004. Inspections of the CAU 112 RCRA unit were performed quarterly to identify any significant physical changes to the site that could impact the proper operation of the waste unit. The overall condition of the covers and facility was good, and no significant findings were observed. The annual subsidence survey of the elevation markers was conducted on August 23, 2004, and the results indicated that no cover subsidence4 has occurred at any of the markers. The elevations of the markers have been consistent for the past 11 years. The total precipitation for the current reporting period, october 2003 to September 2004, was 14.0 centimeters (cm) (5.5 inches [in]) (National Oceanographic and Atmospheric Administration, Air Resources Laboratory, Special Operations and Research Division, 2004). This is slightly below the average rainfall of 14.7 cm (5.79 in) over the same period from 1972 to 2004. Post-closure monitoring verifies that the CAU 112 trench covers are performing properly and that no water is infiltrating into or out of the waste trenches. Sail moisture measurements are obtained in the soil directly beneath the trenches and compared to baseline conditions for the first year of post-closure monitoring, which began in october 1993. neutron logging was performed twice during this monitoring period along 30 neutron access tubes to obtain soil moisture data and detect any changes that may indicate moisture movement

  7. Ten-Year Summary and Evaluation of Operations and Performance of the Utica Aquifer and North Lake Basin Wetlands Restoration Project, 2004-2014

    Energy Technology Data Exchange (ETDEWEB)

    LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-11-01

    This document reviews the performance of the groundwater (and wetlands) restoration program implemented by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) at the former CCC/USDA grain storage facility in Utica, Nebraska, during the first ten years of this initiative (2004-2014). The results of the program for the first five-year period of operation were previously discussed in detail (Argonne 2011). The present report focuses on treatment system operational data and regulatory compliance monitoring results for the site during the second five-year period of operation (2010-2014), together with the results of (1) ongoing monitoring and (2) targeted groundwater sampling for volatile organic compounds (VOCs) analyses conducted at Utica in 2015 (following completion of the tenth year of systems operation), to assess the 10-year progress of the Utica remediation effort.

  8. Toward a patient-centered ambulatory after-visit summary: Identifying primary care patients' information needs.

    Science.gov (United States)

    Clarke, Martina A; Moore, Joi L; Steege, Linsey M; Koopman, Richelle J; Belden, Jeffery L; Canfield, Shannon M; Kim, Min S

    2018-09-01

    The purpose of this study was to determine the information needs of primary care patients as they review clinic visit notes to inform information that should be contained in an after-visit summary (AVS). We collected data from 15 patients with an acute illness and 14 patients with a chronic disease using semi-structured interviews. The acute patients reviewed seven major sections, and chronic patients reviewed eight major sections of a simulated, but realistic visit note to identify relevant information needs for their AVS. Patients in the acute illness group identified the Plan, Assessment and History of Present Illness the most as important note sections, while patients in the chronic care group identified Significant Lab Data, Plan, and Assessment the most as important note sections. This study was able to identify primary care patients' information needs after clinic visit. Primary care patients have information needs pertaining to diagnosis and treatment, which may be the reason why both patient groups identified Plan and Assessment as important note sections. Future research should also develop and assess an AVS based on the information gathered in this study and evaluate its usefulness among primary care patients. The results of this study can be used to inform the development of an after-visit summary that assists patients to fully understand their treatment plan, which may improve treatment adherence.

  9. [Quality assessment of dermatology in the G-DRG system 2004].

    Science.gov (United States)

    Fürstenberg, T; Hensen, P; Rompel, R; Roeder, N

    2004-11-01

    Since January 2004, all German hospitals have been obliged to operate with a new hospital funding system based on DRGs. For the DRG system to serve as a fair basis for reimbursement requires that the dermatologic services be adequately covered in the classification system. The German Dermatologic Society (DDG) in cooperation with the DRG-Research Group of the University Hospital Muenster carried out a DRG evaluation study. Based on these results, suggestions for the adjustment of the G-DRG system were proposed by the DDG in the G-DRG adaptation round for 2004. Based on data of the DRG evaluation project (14,555 dermatological cases from 19 hospitals) the homogeneity in the G-DRG system 2004 was examined and compared with the quality of depiction in the G-DRG version 1.0. The correlation between expenditure and case mix index in the hospitals improved in the G-DRG system 2004. Most proposals submitted by the German Dermatologic Society for the adaptation into the G-DRG system 2004 were accepted. Some fundamental problems such as reimbursement of high cost drugs and special services, as well as the reimbursement of high and low outliers, were only marginally addressed. The G-DRG system 2004 will need to be continuously adapted in the field of dermatology. Based on this work, the German Dermatologic Society has made suggestions to be adapted in the G-DRG system 2005 and submitted them to the German DRG Institute.

  10. Formatos de vídeo, códec y otros aspectos del montaje audiovisual

    OpenAIRE

    Cuadrado Sánchez, Rocío

    2013-01-01

    Este trabajo es una investigación sobre qué es un formato, qué códec hay en el mercado y los procesos que entran en juego a la hora de crear y desarrollar un proyecto para después compartirlo sin ningún problema

  11. 2004 SITE ENVIRONMENTAL REPORT

    Energy Technology Data Exchange (ETDEWEB)

    BROOKHAVEN NATIONAL LABORATORY; SER TEAM; ENVIRONMENTAL INFORMATION MANAGEMENT SERVICES GROUP; ENVIROMENTAL AND WASTE MANAGEMENT SERVICES DIVISION FIELD SAMPLING TEAM; (MANY OTHER CONTRIBUTORS)

    2005-08-22

    Each year, Brookhaven National Laboratory (BNL) prepares an annual Site Environmental Report (SER) in accordance with DOE Order 231.1A, Environment, Safety and Health Reporting of the U.S. Department of Energy (DOE). The SER is written to inform the public, regulators, Laboratory employees, and other stakeholders of BNL's environmental performance during the calendar year in review. The report summarizes BNL's environmental data; environmental management performance; compliance with applicable DOE, federal, state, and local regulations; and restoration and surveillance monitoring programs. BNL has prepared annual SERs since 1971 and has documented nearly all of its environmental history since the Laboratory's inception in 1947. The SER is intended to be a technical document. It is available in print and as a downloadable file on the BNL web page at http://www.bnl.gov/esd/SER.htm. A summary of the SER is also prepared each year to provide a general overview of the report, and is distributed with a CD version of the full report. The summary supports BNL's educational and community outreach program.

  12. 7 CFR 3402.14 - Budget and budget narrative.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Budget and budget narrative. 3402.14 Section 3402.14... GRADUATE AND POSTGRADUATE FELLOWSHIP GRANTS PROGRAM Preparation of an Application § 3402.14 Budget and budget narrative. Applicants must prepare the Budget, Form CSREES-2004, and a budget narrative...

  13. Epidemiology of acute flaccid paralysis in Kermanshah province, 2004-2009

    Directory of Open Access Journals (Sweden)

    Keyghobad Ghadiri

    2011-09-01

    Full Text Available The aim of this study was to determine epidemiologic features of acute flaccid paralysis (AFP during 2004-2009 in Kermanshah province. This cross-sectional descriptive study was done based on data records from Kermanshah health care center. In total 89 patients, 0-14 years old were enrolled study, which 36 of them were male and 53 were female. 50.6% of subjects were diagnosed as Guillain-barre, 6.7% transverse synovitis and 5.6% as arthritis. No any cases of poliomyelitis were diagnosed. The prevalence of reported of AFP during 2004-2009 in Kermanshah province was more than expected rate of 1 per 100000 according to WHO.

  14. Learning from research on the information behaviour of healthcare professionals: a review of the literature 2004-2008 with a focus on emotion.

    Science.gov (United States)

    Fourie, Ina

    2009-09-01

    A review, focusing on emotion, was conducted of reported studies on the information behaviour of healthcare professionals (2004-2008). Findings were intended to offer guidelines on information services and information literacy training, to note gaps in research and to raise research interest. Databases were searched for literature published from January 2004 to December 2008 and indexed on eric, Library and Information Science Abstracts, medline, PsycINFO, Social Services Abstracts, Sociological Abstracts, Health Source: Nursing/Academic Edition; Library, Information Science & Technology Abstracts; Psychology and Behavioral Sciences Collection; Social Work Abstracts; SocINDEX with Full Text; SPORTDiscus; cinhal; and the ISI Web of Knowledge databases. Key journals were manually scanned and citations followed. Literature was included if reporting on issues concerning emotion. Emotion in information behaviour in healthcare contexts is scantily addressed. This review, however, offers some insight into the difficulty in identifying and expressing information needs; sense making and the need to fill knowledge gaps; uncertainty; personality and coping skills; motivation to seeking information; emotional experiences during information seeking; self-confidence and attitude; emotional factors in the selection of information channels; and seeking information for psychological or emotional reasons. Suggestions following findings, address information literacy programs, information services and research gaps.

  15. International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part II

    International Nuclear Information System (INIS)

    1980-10-01

    The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes

  16. International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part I

    International Nuclear Information System (INIS)

    1980-09-01

    The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes

  17. International Working Group on Past Reactors Thirteenth Annual Meeting. Summary Report. Part III

    International Nuclear Information System (INIS)

    1981-04-01

    The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes

  18. Consultants' Meeting on Review Benchmarking of Nuclear Data for the Th/U Fuel Cycle. Summary Report

    International Nuclear Information System (INIS)

    Capote Noy, R.

    2011-02-01

    A summary is given of the Consultants' Meeting (CM) on Review and Benchmarking of Nuclear Data for the Th/U Fuel Cycle. An IAEA Coordinated Research Project (CRP) on 'Nuclear Data for Th/U Fuel Cycle' was concluded in 2005. The CRP activities resulted in new evaluated nuclear data files for 232 Th, 231 , 233 Pa (later adopted for the ENDF/B-VII.0 library) and improvements to existing evaluations for 232 , 233 , 234 , 236 U. Available nuclear data evaluations for 230 - 232 Th, 231,233 Pa and 232 , 233 , 234 U were reviewed including ROSFOND2010, CENDL-3.1, JENDL-4, JEFF-3.1.1, MINSKACT, and ENDF/B-VII.0 libraries. Benchmark results of available evaluations for 232 Th and 233 U were also discussed. (author)

  19. NERI 2004 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    2004-01-01

    The United States Department of Energy (DOE) created the Nuclear Energy Research Initiative (NERI) in Fiscal Year (FY) 1999 in response to recommendations provided by the President's Committee of Advisors on Science and Technology. The purpose of NERI is to sponsor research and development (R&D) in the nuclear energy sciences to address the principal barriers to the future use of nuclear energy in the United States. NERI is helping to preserve the nuclear science and engineering infrastructure within the Nation's universities, laboratories, and industry, and is advancing the development of nuclear energy technology, enabling the United States to maintain a competitive position in nuclear science and technology. Research under this initiative also addresses issues associated with the maintenance of existing U.S. nuclear plants. The NERI program is managed and funded by DOE's Office of Nuclear Energy, Science and Technology. ''The Nuclear Energy Research Initiative 2004 Annual Report'' serves to inform interested parties of progress made in NERI on a programmatic level as well as research progress made on individual NERI projects. Section 2 of this report provides background on the creation and implementation of NERI and on the focus areas for NERI research. Section 3 provides a discussion on NERI's mission, goals and objectives, and work scope. Section 4 highlights the major accomplishments of the NERI projects and provides brief summaries of the NERI research efforts that were completed in 2004. Section 5 provides a discussion on the impact NERI has had on U.S. university nuclear programs. Sections 6 through 8 provide project status reports by research area for each of the fiscal year (FY) 2001 and 2002 projects that were active in FY 2004. Research objectives, progress made over the last year, and activities planned for the next year are described for each project. Sections 9 through 11 present each of the newly awarded 2005

  20. Annual review and summary financial statement [United Kingdom

    International Nuclear Information System (INIS)

    1992-01-01

    National Power owns and operates 35 power stations in England and Wales with a total generating capacity of 26,623 MW, of which 20,460 is coal-fired and the rest oil-fired. 89% of coal supplies have been domestic. Till now Port facilities have been constructed to increase the import of cheaper, lower sulphur content coal with the future objective of taking up to half of supplies from this source. A programme of construction of combined cycle gas turbine (CCGT) stations is underway, with two already being built, planning consent for a third having been obtained and applications submitted for a further two. Supplies of North Sea gas at economic prices have been secured for the next five years. Applications to burn the competitively priced fuel orimulsion at two stations are still being evaluated. Apart from the move to low sulphur coal and the low emission CCGT stations, other major initiatives are being taken to protect the environment in the course of power generation. These include : the installation of flue gas desulphurisation equipment at the largest power station, Drax; investment in special burners to reduce nitrogen oxide emissions; installing of equipment to reduce dust emissions at the largest stations; promotion of energy efficiency encouraging the development of wind power and the conversion of domestic waste into electricity. A summary financial statement is appended to the review showing a pre-tax profit of Pound 514 M for 1991/92, an increase of 18% on 1990/91. (Author)

  1. French diagnostic reference levels in diagnostic radiology, computed tomography and nuclear medicine: 2004-2008 Review

    International Nuclear Information System (INIS)

    Roch, P.; Aubert, B.

    2013-01-01

    After 5 y of collecting data on diagnostic reference levels (DRLs), the Nuclear Safety and Radiation Protection French Inst. (IRSN) presents the analyses of this data. The analyses of the collected data for radiology, computed tomography (CT) and nuclear medicine allow IRSN to estimate the level of regulatory application by health professionals and the representativeness of current DRL in terms of relevant examinations, dosimetric quantities, numerical values and patient morphologies. Since 2004, the involvement of professionals has highly increased, especially in nuclear medicine, followed by CT and then by radiology. Analyses show some discordance between regulatory examinations and clinical practice. Some of the dosimetric quantities used for the DRL setting are insufficient or not relevant enough, and some numerical values should also be reviewed. On the basis of these findings, IRSN formulates recommendations to update regulatory DRL with current and relevant examination lists, dosimetric quantities and numerical values. (authors)

  2. PetroKazakhstan Inc. 2004 annual report : going beyond boundaries

    International Nuclear Information System (INIS)

    2005-01-01

    PetroKazakhstan is a vertically integrated Calgary-based energy company that has been involved in the acquisition, exploration and production of oil and gas in Kazakhstan. The company also has shares listed in Canada, the United States, the United Kingdom and Germany. Financial information from PetroKazakhstan was presented and a review of their 2004 operations was made available for the benefit of shareholders. The company's proved plus probable reserve base as of January 1, 2005 has been assessed at 549.8 million barrels of equivalent. In 2004, the company generated record earnings of $0.5 billion, an increase of 58 per cent from 2003. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements, and common share information including the accounts of PetroKazakhstan and the company's proportionate share of the assets, liabilities, revenues, expenses and cash flows. Revenue and expenditure statements were summarized by source. tabs., figs

  3. Eastern Africa Social Science Research Review - Vol 20, No 1 (2004)

    African Journals Online (AJOL)

    The Impact of Different Policy Choices on Income Distribution After Food Production Shocks in Zimbabwe: A Computable General Equilibrium Analysis · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Margaret Chitiga, 1-26. http://dx.doi.org/10.1353/eas.2004.0002 ...

  4. Animal-caused fatalities in New Mexico, 1993-2004.

    Science.gov (United States)

    Lathrop, Sarah L

    2007-01-01

    To evaluate animal-caused fatalities in New Mexico using data collected during medicolegal death investigations, including toxicology, survival interval, and circumstances. A retrospective review of the computerized database and hard copies of files from a centralized, statewide medical examiner's office, excluding deaths due to zoonotic diseases and motor vehicle collisions involving animals. Between 1993 and 2004, 63 deaths caused by animals were reported in New Mexico. The majority of decedents were male (46/63, 73%) and non-Hispanic white (33/63, 52%). Horses were the most commonly implicated animals, with 43 (68%) deaths due to a person being thrown from, crushed, dragged, or kicked by a horse. Cattle caused 9 deaths (14%), dogs caused 3 (5%), and venomous animals caused 3, whereas a bear was responsible for 1 death. Ten decedents (16%) had alcohol present at the time of death, and 8 would have been over the legal blood alcohol concentration for driving (0.08%). Ten deaths (16%) were work-related and included deaths of jockeys and ranch workers. The majority of deaths (42/63, 67%) occurred in remote locations, potentially delaying access to treatment. Survival intervals ranged from 1 day to 33 years. Whereas both human and animal behavior can be difficult to predict, a review of animal-caused fatalities investigated by a medical examiner revealed that in many cases, deaths could have been prevented by either the use of protective gear or alterations in human behavior.

  5. Implications of applying methodological shortcuts to expedite systematic reviews: three case studies using systematic reviews from agri-food public health.

    Science.gov (United States)

    Pham, Mai T; Waddell, Lisa; Rajić, Andrijana; Sargeant, Jan M; Papadopoulos, Andrew; McEwen, Scott A

    2016-12-01

    The rapid review is an approach to synthesizing research evidence when a shorter timeframe is required. The implications of what is lost in terms of rigour, increased bias and accuracy when conducting a rapid review have not yet been elucidated. We assessed the potential implications of methodological shortcuts on the outcomes of three completed systematic reviews addressing agri-food public health topics. For each review, shortcuts were applied individually to assess the impact on the number of relevant studies included and whether omitted studies affected the direction, magnitude or precision of summary estimates from meta-analyses. In most instances, the shortcuts resulted in at least one relevant study being omitted from the review. The omission of studies affected 39 of 143 possible meta-analyses, of which 14 were no longer possible because of insufficient studies (studies generally resulted in less precise pooled estimates (i.e. wider confidence intervals) that did not differ in direction from the original estimate. The three case studies demonstrated the risk of missing relevant literature and its impact on summary estimates when methodological shortcuts are applied in rapid reviews. © 2016 The Authors. Research Synthesis Methods Published by John Wiley & Sons Ltd. © 2016 The Authors. Research Synthesis Methods Published by John Wiley & Sons Ltd.

  6. THYMOMA -A Review of Fourteen Patients

    International Nuclear Information System (INIS)

    Kim, S. K.; Lee, H. S.; Cho, K. H.; Suh, C. O.; Kim, G. E.

    1985-01-01

    Between Jan. 1977 and Dec. 1984, 14 patients diagnosed of thymoma has been analyzed retrospectively. 6 patients(6/14 patients 43%) had myasthenia gravis. 12 patients (12/14 patients 86%) had invasive thymoma. Complete resection was carried out in 6 patients (43%), 2 patients had partial resection (14%) and 6 patients had only biopsy (43%). Postoperative or radical radiotherapy was given to 8 patients, of whom 5 patients was still alive (4 yr. 2.8 yr. 1.6 yr. 1.4 yr. 1.3 yr) and 3 patients died (1 yr. 0.6 yr. 0.6 yr). External irradiation ranges 1,950-7,000 rads (mean 4,500, median 4,000 rads)

  7. THYMOMA -A Review of Fourteen Patients

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S. K.; Lee, H. S.; Cho, K. H.; Suh, C. O.; Kim, G. E. [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1985-06-15

    Between Jan. 1977 and Dec. 1984, 14 patients diagnosed of thymoma has been analyzed retrospectively. 6 patients(6/14 patients 43%) had myasthenia gravis. 12 patients (12/14 patients 86%) had invasive thymoma. Complete resection was carried out in 6 patients (43%), 2 patients had partial resection (14%) and 6 patients had only biopsy (43%). Postoperative or radical radiotherapy was given to 8 patients, of whom 5 patients was still alive (4 yr. 2.8 yr. 1.6 yr. 1.4 yr. 1.3 yr) and 3 patients died (1 yr. 0.6 yr. 0.6 yr). External irradiation ranges 1,950-7,000 rads (mean 4,500, median 4,000 rads)

  8. Executive summary

    International Nuclear Information System (INIS)

    1981-02-01

    This paper is an 'executive summary' of work undertaken to review proposals for transport, handling and emplacement of high level radioactive wastes in an underground repository, appropriate to the U.K. context, with particular reference to: waste block size and configuration; self-shielded or partially-shielded block; stages of disposal; transportation within the repository; emplacement in vertical holes or horizontal tunnels; repository access by adit, incline or shaft; and costs. The paper contains a section on general conclusions and recommendations. (U.K.)

  9. National Trends of Antiparkinsonism Treatment in Taiwan: 2004–2011

    Directory of Open Access Journals (Sweden)

    Weng-Ming Liu

    2016-01-01

    Full Text Available Background. Several guidelines for Parkinson’s disease (PD management were recently updated. We examined temporal trends for antiparkinsonism drugs in Taiwan. Methods. Antiparkinsonism prescriptions, including levodopa, ergot/nonergot dopamine agonists (DAs, amantadine, selegiline, entacapone, and anticholinergics, were identified in the Taiwan National Health Insurance Database from 2004 to 2011. Time trend analyses were estimated assuming Poisson distribution. Results. A total of 19,302 PD patients in 2004 and 41,606 PD patients in 2011 were analyzed. Antiparkinsonism prescriptions increased significantly from 187,137 in 2004 to 414,587 in 2011. Levodopa monotherapy or combination therapy was the mainstay. Levodopa monotherapy comprised 37.4% of prescriptions in 2004 and 44.2% in 2011, with an annual increase rate of 18.14%. There was a substantially increasing trend of DA prescriptions, which were higher in younger-aged patients (<60 years than in older-aged group (p=0.0006. Among combination therapy, DA combined with levodopa or other antiparkinsonism medications became the main combinations for younger-aged patients after 2009. After 2005, the proportion of ergot DA usage markedly decreased and PD patients using nonergot DA increased. Conclusions. Levodopa was the major treatment from 2004 to 2011. There was a steeply increased trend of DA use, especially in younger-aged patients. Nonergot agents comprised the major DA group after 2005.

  10. Umatilla River Subbasin Fish Habitat Improvement Program, 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    St. Hilaire, Danny R. (Oregon Department of Fish and Wildlife, Pendleton, OR)

    2006-02-01

    This annual report is in fulfillment of contractual obligations with Bonneville Power Administration (BPA), which is the funding source for the Oregon Department of Fish and Wildlife's (ODFW), Umatilla River Subbasin Fish Habitat Improvement Program (Program). The Program works cooperatively with private landowners to develop long-term restoration, under which, passive and active Habitat Improvement Projects are conducted. Historically, projects have included livestock exclusion fencing (passive restoration) to protect riparian habitats, along with the installation of instream structures (active restoration) to address erosion and improve fish habitat. In recent years, the focus of active restoration has shifted to bioengineering treatments and, more recently, to channel re-design and reconstruction aimed at improving fish habitat, by restoring stable channel function. This report provides a summary of Program activities for the 2004 calendar year (January 1 through December 31, 2004), within each of the four main project phases, including: (1) Implementation--Pre-Work, (2) Implementation--On Site Development, (3) Operation and Maintenance, and (4) Monitoring and Evaluation. This report also summarizes Program Administrative, Interagency Coordination, and Public Education activities.

  11. Research on English Teaching and Learning: Taiwan (2004-2009)

    Science.gov (United States)

    Chen, Suchiao; Tsai, Yachin

    2012-01-01

    This article analyzes research in second/foreign language teaching and learning conducted in Taiwan over the period 2004-2009. Representative articles published in local refereed journals and conference proceedings--not readily accessible outside Taiwan--are reviewed to reflect current trends in English teaching and learning. The main themes…

  12. Decúbito prono en pacientes con síndrome de distrés respiratorio agudo

    Directory of Open Access Journals (Sweden)

    Mariano Setten

    Full Text Available RESUMEN El síndrome de distrés respiratorio agudo ocupa gran atención en la unidad de cuidados intensivos. A pesar del amplio conocimiento alcanzado sobre la fisiopatología de éste síndrome, el enfoque en la unidad de cuidados intensivos consiste, en gran parte, en un tratamiento de soporte vital y en evitar los efectos secundarios de las terapéuticas invasivas. Si bien, durante los últimos 20 años, se generaron grandes avances en ventilación mecánica con un impacto importante sobre la mortalidad, ésta continúa siendo elevada. Una característica de los pacientes con síndrome de distrés respiratorio agudo, sobre todo los más severos, es la presencia de hipoxemia refractaria debido a la existencia de shunt, pudiendo requerir tratamientos adicionales a la ventilación mecánica, entre ellos la ventilación mecánica en decúbito prono. Este método, recomendado para mejorar la oxigenación por primera vez en 1974, puede ser implementado fácilmente en cualquier unidad de cuidados intensivos con personal entrenado. El decúbito prono tiene un sustento bibliográfico sumamente robusto. Varios ensayos clínicos randomizados han demostrado el efecto del decúbito prono sobre la oxigenación en pacientes con síndrome de distrés respiratorio agudo medida a través de la relación PaO2/FiO2 e incluso su impacto en el aumento de la sobrevida de estos pacientes. Los integrantes del Comité de Kinesiología Intensivista de la Sociedad Argentina de Terapia Intensiva realizaron una revisión narrativa con el objetivo de exponer la evidencia disponible en relación a la implementación del decúbito prono, los cambios producidos en el sistema respiratorio por la aplicación de la maniobra y su impacto sobre la mortalidad. Por último, se sugerirán lineamientos para la toma de decisiones.

  13. The Validity of Graduate Management Admission Test Scores: A Summary of Studies Conducted from 1997 to 2004

    Science.gov (United States)

    Talento-Miller, Eileen; Rudner, Lawrence M.

    2008-01-01

    The validity of Graduate Management Admission Test (GMAT) scores is examined by summarizing 273 studies conducted between 1997 and 2004. Each of the studies was conducted through the Validity Study Service of the test sponsor and contained identical variables and statistical methods. Validity coefficients from each of the studies were corrected…

  14. Researching children's perspectives in pediatric palliative care: A systematic review and meta-summary of qualitative research.

    Science.gov (United States)

    Ghirotto, Luca; Busani, Elena; Salvati, Michela; Di Marco, Valeria; Caldarelli, Valeria; Artioli, Giovanna

    2018-05-29

    Qualitative research is pivotal in gaining understanding of individuals' experiences in pediatric palliative care. In the past few decades, the number of qualitative studies on pediatric palliative care has increased slightly, as has interest in qualitative research in this area. Nonetheless, a limited number of such studies have included the first-person perspective of children. The aim of this article is to understand the contribution of previous qualitative research on pediatric palliative care that included the voices of children. A systematic review of qualitative studies and a meta-summary were conducted. MEDLINE, CINAHL, PsycINFO, PsycARTICLES, and ERIC were searched without limitations on publication date or language. Eligible articles were qualitative research articles in which the participants were children ranging in age from 3 to 18 years.ResultWe retrieved 16 qualitative research articles reporting on 12 unique studies, and we selected two mixed-method articles. The meta-summary shows eight themes: the relationship with professional caregivers, pain and its management, "living beyond pain," the relationship between pediatric patients and their families, children's view on their treatment and service provision, meanings children give to their end-of-life situation, consequences of clinical decisions, and the relationships among children in pediatric palliative care and their peers.Significance of resultsThis meta-summary presents the "state of the art" of pediatric palliative care qualitative research on children and highlights additional research areas that warrant qualitative study.

  15. The increasing use of theory in social gerontology: 1990-2004.

    Science.gov (United States)

    Alley, Dawn E; Putney, Norella M; Rice, Melissa; Bengtson, Vern L

    2010-09-01

    To determine how often theory is used in published research in social gerontology, compare theory use over a 10-year period (1990-1994 to 2000-2004), and identify the theories most frequently used in social gerontology research. Systematic review of articles published in eight leading journals from 2000 to 2004 (N = 1,046) and comparison with a review conducted 10 years earlier. Theory was mentioned in 39% of articles published from 2000 to 2004, representing a 12% increase in the use of theory over 10 years. This increase was driven by theories outside the core sociology of aging theories identified by Bengtson, V. L., Burgess, E. O., and Parrott, T. M. (1997). Theory, explanation, and a third generation of theoretical development in social gerontology. Journal of Gerontology: Social Sciences, 52B, S72-S88. The five most frequently used theories included the life course perspective, life-span developmental theories, role theory, exchange theory, and person-environment theory/ecological theories of aging. Commonly used models included stress process/stress and coping models, successful aging models, the Andersen behavioral model of health services use, models of control/self-efficacy/mastery, and disablement process models. Theory use in social gerontology increased between 1990 and 2004, with a shift toward theories that cross disciplines. However, the majority of research in social gerontology continues to be atheoretical. Models are widely used as a supplement to or substitute for theory. Many of these models are currently being debated and elaborated, and over time, they may emerge as important theoretical contributions to social gerontology.

  16. The new international standard ISO 14001: 2004 environmental management system

    International Nuclear Information System (INIS)

    Oheba, Jamal Basher

    2006-01-01

    ISO 14001 is one standard in the ISO 14000 series of standards developed by International Organization of Standardization (ISO). Since it was published in 19096, it has rapidly become the most important environmental standard in the world. ISO 14001 is an environmental management system (EMS) that can be classified into environmental technologies provides a systematic procedure to all kind of organizations to prevent pollutions, protect environment and to improve their overall environmental performance. This new standard ISO 14001 2004 was published on November 15, 2004. It cancels and replaced the old ISO 14001-1996. Because the important of the previous standard for our local industries, firms, ...etc, this paper presents ISO 14001 concepts, issues, benefits and focuses on the stages of implementation to achieve ISO 14001-2004 certification which includes general requirements environmental policy, planning (objectives, targets ..), implementation and operations, checking and management review ...etc and presents how to apply isotop time saver software to design records, and to save time to implement ISO 14001 2004 and finally a conclusion is provided.(Author)

  17. Technical meeting (TM) to 'Review of national programmes on fast reactors and accelerator driven systems (ADS)'. Technical Working Group on Fast Reactors (TWG-FR) (37th annual meeting). Working material

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The objectives of the 37th Annual Meeting of the Technical Working Group on Fast Reactors, were to: 1) exchange information on the national programmes on Fast Reactors (FR) and Accelerator Driven Systems (ADS); 2) review the progress since the 36th TWG-FR Annual Meeting, including the status of the actions; 3) consider meeting arrangements for 2004 and 2005; 4) review the Agency's co-ordinated research activities in the field of FRs and ADS, as well as co-ordination of the TWG-FR's activities with other organizations. The participants made presentations on the status of the respective national programmes on FR and ADS development. A summary of the highlights for the period since the 36th TWG-FR Annual Meeting is included in this proceedings. Annex IV contains the Review of National Programs on Fast Reactors and Accelerator Driven Systems (ADS), and the TWG-FR Activity Report for the Period May 2003-April 2004.

  18. Aplicação do triglicerídeos de cadeia média (TCM na prevenção de úlceras de decúbito

    Directory of Open Access Journals (Sweden)

    Vânia Declair

    1994-03-01

    Full Text Available Aproximadamente 75.000 das 1.000.000 pessoas hospitalizadas a cada ano desenvolvem Úlceras de Decúbito. Graças à tecnologia avançada, hoje temos várias opções de tratamento destas úlceras, ainda que isto seja dispendioso para os pacientes e hospitais. Porém, melhor que desenvolver um processo curativo, é poder desenvolver um processo preventivo eficaz. Com o objetivo de avaliar a eficácia do uso tópico de triglicerídeos de cadeia média (TCM na prevenção de Úlceras de Decúbito, a autora utilizou o método duplo-cego em 86 pacientes, onde 50% foi submetido ao uso de solução com TCM e 50% ao uso Solução Glicerinada. Em ambos os casos, houve diminuição da instalação de Úlceras de Decúbito, porém, dos pacientes que se submeteram ao uso de solução com TCM, apenas de 2 (dois desenvolveram Úlcera de Decúbito (Grau 1; e dos pacientes que se submeteram ao uso de Solução com Glicerina, 12 (doze desenvolveram Úlcera de Decúbito (Graus 1 e 2. Concluiu-se que o TCM é de grande auxílio na prevenção de Úlceras de Decúbito, tem excelente absorção para uso tópico, forma uma película protetora à pele, previne escoriações devido à sua alta capacidade de hidratação e proporciona nutrição celular local.

  19. Summary of main points

    International Nuclear Information System (INIS)

    2006-01-01

    In conjunction with its 6. annual meeting, the WPDD in close co-operation with the FSC held a Topical session on 'Stakeholder Involvement in Decommissioning' on November 14, 2005. The session was attended by 36 participants totally representing 14 NEA member countries and 2 international organisations. Two keynote addresses were given at the Topical Session. The first one treated of what is needed for robust decisions and how to bring all stakeholders into the debate. In the second keynote address a summary was made on what have been said on stakeholder involvement in decommissioning during earlier meetings of the WPDD. The main part of the session was then devoted to views from different stakeholders regarding their role and their involvement. This part contained viewpoints from local communities (Kaevlinge in Sweden and Port Hope in Canada), authorities (Scottish Executive and CSNC) and operators (EDF from France and EWN from Germany). Case studies from the decommissioning of Dounrey in the UK and from Trojan and Main Yankee in the USA were presented in the end part of the Topical session followed by a summary and lessons learnt report by the Rapporteur. A detailed programme of the Topical session can be seen in Appendix 1

  20. Environmental Impact Statement: Waste Isolation Pilot Plant (WIPP): Executive summary

    International Nuclear Information System (INIS)

    1980-10-01

    The purpose of this document is to provide a summary of the environmental impact statement for the Waste Isolation Pilot Plant (WIPP) project. The Draft Environmental Impact Statement for the WIPP was published by the US Department of Energy (DOE) in April 1979. This document was reviewed and commented on by members of the general public, private organizations, and governmental agencies. The Final Environmental Impact Statement was subsequently published in October, 1980. This summary is designed to assist decision-maker and interested individuals in reviewing the material presented in the environmental impact statement for the WIPP project. To make this material widely available, this summary is published in both Spanish and English. Additional, more detailed information concerning the environmental and safety consequences of the WIPP project is available in the Final Environmental Impact Statement. Written comments and public hearing comments on the Draft Environmental Impact Statement are available for review. 27 refs., 4 figs., 7 tabs

  1. Integrated Safeguards and Security Management Self-Assessment 2004

    Energy Technology Data Exchange (ETDEWEB)

    Lunford, Dan; Ramsey, Dwayne

    2005-04-01

    In 2002 Ernest Orlando Lawrence Berkeley National Laboratory deployed the first Integrated Safeguards and Security Management (ISSM) Self-Assessment process, designed to measure the effect of the Laboratory's ISSM efforts. This process was recognized by DOE as a best practice and model program for self-assessment and training. In 2004, the second Self-Assessment was launched. The cornerstone of this process was an employee survey that was designed to meet several objectives: (1) Ensure that Laboratory assets are protected. (2) Provide a measurement of the Laboratory's current security status that can be compared against the 2002 Self-Assessment baseline. (3) Educate all Laboratory staff about security responsibilities, tools, and practices. (4) Provide security staff with feedback on the effectiveness of security programs. (5) Provide line management with the information they need to make informed decisions about security. This 2004 Self Assessment process began in July 2004 with every employee receiving an information packet and instructions for completing the ISSM survey. The Laboratory-wide survey contained questions designed to measure awareness and conformance to policy and best practices. The survey response was excellent--90% of Berkeley Lab employees completed the questionnaire. ISSM liaisons from each division followed up on the initial survey results with individual employees to improve awareness and resolve ambiguities uncovered by the questionnaire. As with the 2002 survey, the Self-Assessment produced immediate positive results for the ISSM program and revealed opportunities for longer-term corrective actions. Results of the questionnaire provided information for organizational profiles and an institutional summary. The overall level of security protection and awareness was very high--often above 90%. Post-survey work by the ISSM liaisons and line management consistently led to improved awareness and metrics, as shown by a comparison of

  2. The Application of Social Networking Sites (SNSs) in e-Learning and Online Education Environments: A Review of Publications in SSCI-Indexed Journals from 2004 to 2013

    Science.gov (United States)

    Tsai, Chia-Wen; Shen, Pei-Di; Chiang, Yi-Chun

    2013-01-01

    In this paper, the authors reviewed the empirical studies on social networking sites (SNSs), especially those focused on adopting SNSs for students' learning, published in SSCI journals from 2004 to 2013. It was found that the number of articles has significantly increased, particularly after 2009. Among the 76 published papers, most studies were…

  3. International Consensus Statement on Allergy and Rhinology: Rhinosinusitis Executive Summary.

    Science.gov (United States)

    Orlandi, Richard R; Kingdom, Todd T; Hwang, Peter H

    2016-02-01

    The body of knowledge regarding rhinosinusitis (RS) continues to expand, with rapid growth in number of publications yet substantial variability in the quality of those presentations. In an effort to both consolidate and critically appraise this information, rhinologic experts from around the world have produced the International Consensus Statement on Allergy and Rhinology: Rhinosinusitis (ICAR:RS). This executive summary consolidates the findings of the ICAR:RS document. ICAR:RS presents over 140 topics in the forms of evidence-based reviews with recommendations (EBRRs) and evidence-based reviews (EBR). The structured recommendations of the EBRR sections are summarized in this executive summary. This summary compiles the EBRRs regarding medical and surgical management of acute RS (ARS) and chronic RS with and without nasal polyps (CRSwNP and CRSsNP). This ICAR:RS Executive Summary provides a compilation of the evidence-based recommendations for medical and surgical treatment of the most common forms of RS. © 2016 ARS-AAOA, LLC.

  4. Bioenergy. A sustainable and reliable energy source. A review of status and prospects. Executive Summary

    International Nuclear Information System (INIS)

    Bauen, A.; Vuille, F.; Berndes, G.; Junginger, M.; Londo, M.

    2009-08-01

    This publication is the Executive Summary of a report prepared for IEA Bioenergy. The full report 'Bioenergy - a Sustainable and Reliable Energy Source' will be available on the website of IEA Bioenergy in digital form and in hard copy in a few months time. The purpose of the project was to produce an authoritative review of the entire bioenergy sector aimed at policy and investment decision makers. The brief to the contractors was to provide a global perspective of the potential for bioenergy, the main opportunities for deployment in the short and medium term and the principal issues and challenges facing the development of the sector.

  5. [Consumption of antidepressants in Chile from 1992 to 2004].

    Science.gov (United States)

    Jirón, Marcela; Machado, Márcio; Ruiz, Inés

    2008-09-01

    Data from the Ministry of Health show that in Chile in 2004, 17% of the population had some form of depression, and mood disorders are the tenth cause of disability-adjusted life years (DALY) loss. To determine consumption of antidepressants (ADs) in Chile from 1992 to 2004. National sales data were obtained from the company IMS Health Chile and converted into defined daily doses (DDDs) per 1,000 inhabitants per day. Available ADs were classified in four pharmacological groups (i.e., serotonin-norepinephrine reuptake inhibitors, SNRLs; selective-serotonin reuptake inhibitors, SSRLs; tricyclic antidepressants, TCAs; and others). Total economic burden of ADs utilization and cost per DDDs were also calculated. Trends over time were analyzed using Pearson-R2. Total ADs consumption in Chile measured by DDDs per 1,000 inhabitants per day (DHD) increased linearly (y =0.901x + 1.9129; R2 =0.9296; p economic burden of ADs in Chile (total cost of DDDs consumed) increased from US$65.4 million in 2001 to US$74.6 million in 2004 (14% increase). Average cost per DDD of all AD increased linearly, however not significantly from US$ 0.94 in 2001 to US$ 1.04 in 2004 (y =0.0362x + 0.8784; R2 =0.7382; p =0,262). DDDs per 1,000 inhabitants per day increased linearly over 470% from 1992-2004. SSRLs were the most commonly consumed drugs in Chile. Future research should evaluate the cost-effectiveness of antidepressants in Chile, comparing the results with drug utilization, and determining if unnecessary expenditures have been paid out.

  6. Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

    CERN Multimedia

    Monique Duval

    2004-01-01

    The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

  7. Market review: Market values summary/May market review/current market data

    International Nuclear Information System (INIS)

    Anon.

    1996-01-01

    This article is the May 1996 Uranium transactions summary. Data on Uranium supply and demand is included, as is data on conversion services and separative work units supply and demand. The spot market was active during this period, with 3.6 million pounds U3O8 changing hands in nine transactions. This brought a strengthing of prices. There were also five deals in the long-term market and three deals for natural UF6

  8. 14 CFR 420.21 - Launch site location review-launch site boundary.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Launch site location review-launch site boundary. 420.21 Section 420.21 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... travels given a worst-case launch vehicle failure in the launch area. An applicant must clearly and...

  9. Strontium-90 and cesium-137 in total diet (from Jun. 1982 to Dec. 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in total diet (from Jun. to Dec. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 22 sampling locations. The results are shown in a table. (Namekawa, K.)

  10. Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)

  11. Displaying DIII-D plasma data using DEC's X window system

    International Nuclear Information System (INIS)

    Greene, K.L.

    1991-11-01

    The D3-D tokamak program, funded by the Department of Energy, carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1987 MFITD and MFITPLAY were written/modified. These two programs provide graphical output that allows the users to see, before the next shot, the plasma shape and the locations of the plasma and magnetic flux lines within the tokamak. MFITD performs the computations which calculate the shape and location of the plasma; it also graphically displays a small subset of timeslice data. MFITPLAY graphically displays the full set of timeslice data. Through interactive commands, MFITPLAY also allows the user to control the various aspects of how the data is displayed. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support X windows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface

  12. Vision Hampton Roads : public responsiveness summary.

    Science.gov (United States)

    2010-02-23

    All comments submitted to Vision Hampton Roads were reviewed prior to addition to the final : document. Using this Public Responsiveness Summary, citizens will be able to see and track how : their engagement has impacted results. On the following pag...

  13. International consensus statement on allergy and rhinology: allergic rhinitis-executive summary.

    Science.gov (United States)

    Wise, Sarah K; Lin, Sandra Y; Toskala, Elina

    2018-02-01

    The available allergic rhinitis (AR) literature continues to grow. Critical evaluation and understanding of this literature is important to appropriately utilize this knowledge in the care of AR patients. The International Consensus statement on Allergy and Rhinology: Allergic Rhinitis (ICAR:AR) has been produced as a multidisciplinary international effort. This Executive Summary highlights and summarizes the findings of the comprehensive ICAR:AR document. The ICAR:AR document was produced using previously described methodology. Specific topics were developed relating to AR. Each topic was assigned a literature review, evidence-based review (EBR), or evidence-based review with recommendations (EBRR) format as dictated by available evidence and purpose within the ICAR:AR document. Following iterative reviews of each topic, the ICAR:AR document was synthesized and reviewed by all authors for consensus. Over 100 individual topics related to AR diagnosis, pathophysiology, epidemiology, disease burden, risk factors, allergy testing modalities, treatment, and other conditions/comorbidities associated with AR were addressed in the comprehensive ICAR:AR document. Herein, the Executive Summary provides a synopsis of these findings. In the ICAR:AR critical review of the literature, several strengths were identified. In addition, significant knowledge gaps exist in the AR literature where current practice is not based on the best quality evidence; these should be seen as opportunities for additional research. The ICAR:AR document evaluates the strengths and weaknesses of the AR literature. This Executive Summary condenses these findings into a short summary. The reader is also encouraged to consult the comprehensive ICAR:AR document for a thorough description of this work. © 2018 ARS-AAOA, LLC.

  14. Proceedings of the FNCA 2004 workshop on the utilization of research reactors (Contract research)

    International Nuclear Information System (INIS)

    2006-07-01

    The FNCA 2004 Workshop on the Utilization of Research Reactors, which is the twelfth workshop on the theme of research reactor utilization, was held in Bangkok, Thailand from January 13 to 21, 2005. This workshop was executed based on the agreement in the fifth Coordinator's Meeting of Forum for Nuclear Cooperation in Asia (FNCA) held in Tokyo, March 2004. The workshop consisted of three groups under the themes of the following fields; 1) Neutron Activation Analysis, 2) Research Reactor Technology and 3) Tc-99m Generator Technology. The total number of participants for the workshop was 59 people from 8 countries; China, Indonesia, Korea, Malaysia, the Philippines, Thailand, Vietnam and Japan. This report consists of 6 papers for Neutron Activation Analysis, 5 papers for Research Reactor Technology, 5 Papers for Tc-99m Generator Technology and a summary report. The 15 of the presented papers are indexed individually. (J.P.N.)

  15. Efeito da perda prematura de molares decíduos na sobressaliência

    Directory of Open Access Journals (Sweden)

    Yérica M García

    2011-01-01

    Full Text Available A perda precoce de molares decíduos predispõe as maloclusões, entre estas o apinhamento dentário, impactação de dentes permanentes e alteração da relação molar e canino. O objetivo do estudo foi determinar o efeito das perdas precoces dos molares decíduos na relação horizontal incisiva. O estudo é do tipo documentado, retrospetivo e observacional. Foram avaliados os registros ortodônticos (histórias clínicas, fotografias e radiografias de 209 pacientes na faixa etária de 4 a 15 anos de idade. A relação incisiva horizontal foi considerada normal para os pacientes do GRUPO 1, com contato entre a face incisal dos incisivos inferiores e a face palatina dos incisivos superiores. No GRUPO 2, a relação incisiva horizontal foi considerada aumentada, com distância positiva entre eles e no GRUPO 3, a relação incisiva horizontal foi considerada negativa quando as faces incisais dos incisivos superiores e inferiores se encontravam a topo ou em mordida cruzada. Os dados foram analisados através do coeficiente Pearson (p ≤ 0,001. Na análise dos dados coletados, o total de quarenta e cinco pacientes (22% apresentaram perdas prematuras. A prevalência destas perdas não apresentou diferença significativa entre sexos e foi maior no grupo de faixa etária de 7 a 9 anos de idade. Dos pacientes com perda prematura seis (13,3% foram clasificados no GRUPO 1; doze (26,7% no GRUPO 2 e vinte e sete (60% no GRUPO 3. A relação entre o número de molares perdidos e a presença de mordida cruzada anterior foi encontrada, e a média de molares perdidos (4,7 foi maior no GRUPO 3. Os resultados mostraram que as perdas precoces dos molares decíduos apresentam uma relação estatisticamente significante com a mordida cruzada anterior, sugerindo que a falta de suporte oclusal pode favorecer o desenvolvimento protrusivo da mandibula.

  16. Characterizing and Quantifying Local and Regional Particulate Matter Emissions from Department of Defense Installations

    Science.gov (United States)

    2005-03-01

    region (Fig. 4.1). A summary of the annual and seasonal average temperature, precipitation , and wind conditions for El Paso is presented in Table 4.1... Precipitation (cm) 2 Average Wind Speed 2 (km/hr) Prevailing Wind Direction 2 (degrees) Annual 17.3 22.4 14.2 360 Winter (Dec...Chow, 2001; Chow et al., 2003). The Teflon-membrane filters were analyzed for mass by gravimetry using a Cahn 31 Electro-microbalance and for 40

  17. The Development and Evaluation of a Novel Instrument Assessing Residents' Discharge Summaries.

    Science.gov (United States)

    Hommos, Musab S; Kuperman, Ethan F; Kamath, Aparna; Kreiter, Clarence D

    2017-04-01

    To develop and determine the reliability of a novel measurement instrument assessing the quality of residents' discharge summaries. In 2014, the authors created a discharge summary evaluation instrument based on consensus recommendations from national regulatory bodies and input from primary care providers at their institution. After a brief pilot, they used the instrument to evaluate discharge summaries written by first-year internal medicine residents (n = 24) at a single U.S. teaching hospital during the 2013-2014 academic year. They conducted a generalizability study to determine the reliability of the instrument and a series of decision studies to determine the number of discharge summaries and raters needed to achieve a reliable evaluation score. The generalizability study demonstrated that 37% of the variance reflected residents' ability to generate an adequate discharge summary (true score variance). The decision studies estimated that the mean score from six discharge summary reviews completed by a unique rater for each review would yield a reliability coefficient of 0.75. Because of high interrater reliability, multiple raters per discharge summary would not significantly enhance the reliability of the mean rating. This evaluation instrument reliably measured residents' performance writing discharge summaries. A single rating of six discharge summaries can achieve a reliable mean evaluation score. Using this instrument is feasible even for programs with a limited number of inpatient encounters and a small pool of faculty preceptors.

  18. The function of self-esteem in terror management theory and sociometer theory: comment on Pyszczynski et al. (2004).

    Science.gov (United States)

    Leary, Mark R

    2004-05-01

    By applying different standards of evidence to sociometer theory than to terror management theory (TMT), T. Pyszczynski, J. Greenberg, S. Solomon, J. Arndt, and J. Schimel's (2004) review offers an imbalanced appraisal of the theories' merits. Many of Pyszczynski et al.'s (2004) criticisms of sociometer theory apply equally to TMT. and others are based on misconstruals of the theory or misunderstandings regarding how people respond when rejected. Furthermore, much of their review is only indirectly relevant to TMT's position on the function of self-esteem, and the review fails to acknowledge logical and empirical challenges to TMT. A more balanced review suggests that each theory trumps the other in certain respects, both have difficulty explaining all of the evidence regarding self-esteem, and the propositions of each theory can be roughly translated into the concepts of the other. For these reasons, declaring a theoretical winner at this time is premature. ((c) 2004 APA, all rights reserved)

  19. Interventions for replacing missing teeth: Antibiotics in dental implant placement to prevent complications: Evidence summary of Cochrane review.

    Science.gov (United States)

    Jayaraman, Srinivasan

    2015-01-01

    The failure of dental implant can occurs at the preoperative planning stage, at the surgical stage, and at the postoperative stage. The success of this treatment can be increased if the clinical implant practice guidelines are prepared based on the recommendations from the highest level of research evidence (i.e.,) from systematic review of randomized controlled trials (RCTs) with meta-analysis. The Cochrane reviews of interventions are basically systematic reviews of RCTs with meta-analysis but follow a systematic methodological approach following the guidelines from Cochrane handbook for Systematic Reviews of Intervention. They give the current best evidence as they are updated every 2 years which is being the minimum period for an update. This evidence summary recommends the use of antibiotics, single dose of 2 g of amoxicillin 1 h prior to implant surgery to prevent implant failure, based on the body of evidence from the Cochrane review that was first published in 2003, 2008, and then updated twice in 2010 and 2013. The included studies are not from our population for the research question asked in this updated Cochrane review; hence, the need to do primary research in our population to support the available evidence is mandatory.

  20. EERE Peer Review Guide - August 2004

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-01-18

    Provides guidance in establishing formal in-progress peer review that provides intellectually fair expert evaluation of EERE research, development, demonstration, & deployment (supporting business administration) programs, both retrospective and pr

  1. 305---14Dec .indd [ final version].indd

    African Journals Online (AJOL)

    2007-01-19

    Jan 19, 2007 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original ... With regard to their God talk, the author and these biblical writers express ..... In this regard, Luke coincides with both Paul and John. ...... theology, Collins, London.

  2. Executive Summary of Ares V: Lunar Capabilities Concept Review Through Phase A-Cycle 3

    Science.gov (United States)

    Holladay, J. B.; Baggett, K. E.; Feldman, S. M.

    2011-01-01

    This Technical Memorandum (TM) was generated as an overall Ares V summary from the Lunar Capabilities Concept Review (LCCR) through Phase A-Cycle 3 (PA-C3) with the intent that it may be coupled with separately published appendices for a more detailed, integrated narrative. The Ares V has evolved from the initial point of departure (POD) 51.00.48 LCCR configuration to the current candidate POD, PA-C3D, and the family of vehicles concept that contains vehicles PA-C3A through H. The logical progression from concept to POD vehicles is summarized in this TM and captures the trade space and performance of each. The family-of-vehicles concept was assessed during PA-C3 and offered flexibility in the path forward with the ability to add options deemed appropriate. A description of each trade space is given in addition to a summary of each Ares V element. The Ares V contributions to a Mars campaign are also highlighted with the goal of introducing Ares V capabilities within the trade space. The assessment of the Ares V vehicle as it pertains to Mars missions remained locked to the architecture presented in Mars Design Reference Authorization 5.0 using the PA-C3D vehicle configuration to assess Mars transfer vehicle options, in-space EDS capabilities, docking adaptor and propellant transfer assessments, and lunar and Mars synergistic potential.

  3. Powernext Day-AheadTM. Powernext futuresTM. Activity report - 2004

    International Nuclear Information System (INIS)

    2004-01-01

    The introduction of a power exchange in France is a direct response to the opening up of the European electricity markets. Powernext SA is a Multilateral Trading Facility in charge of managing the French power exchange through an optional and anonymous organised exchange offering: - Day-ahead contracts for the management of volume risk on Powernext Day-Ahead TM since 21 November 2001, - Medium term contracts for the management of price risk on Powernext Futures TM since 18 June 2004. This document is the 2004 activity report of Powernext SA, it presents the key figures of the power market and of Powernext in 2004: - Increasing volumes: Powernext Day-Ahead TM 's traded volumes increased by 89%, from 7.48 to 14.18 TWh. Powernext Futures TM kicks off to a promising debut with 12.86 TWh traded in less than 7 months. - Less volatile prices: During 2004, the base price averaged 28.13 euro/MWh, and the peak prices averaged 33.71 euro/MWh. Compared to 2003, these prices decreased by an average of 3.7% on base-load and 10.9% on peak-load. In comparison to the two previous years, the daily volatility has noticeably settled down with 27% on base-load and 37% on peak-load. - Increasing liquidity: 10 new members joined Powernext Day-Ahead TM in 2004. The activity level of the members remains very high as 89% of them trade on an actual daily basis during 2004. The market resiliency stays strong. In December, an additional market 50 MW order on each hour resulted in a balance price variation of only 0.16 euro/MWh, or 0.53% of this balance price. For a 100 MW order, the resiliency is 0.32 euro/MWh, or 1.07% of the balance price. Thus, in 2004, Powernext Day-Ahead TM consolidates its role as a short term reference price. Moreover, in 2004, Powernext launched a futures market, Powernext Futures TM . This new market segment proposes contracts tradable up to 2 years ahead of delivery

  4. Examining the relationship between infectious diseases and flooding in Europe: A systematic literature review and summary of possible public health interventions.

    Science.gov (United States)

    Brown, Lisa; Murray, Virginia

    2013-01-01

    Introduction Many infectious diseases are sensitive to climatic changes; specifically, flooding. This systematic literature review aimed to strengthen the quality and completeness of evidence on infectious diseases following flooding, relevant to Europe. Methods A systematic literature review from 2004-2012 was performed. Focused searches of the following databases were conducted: Medline, Scopus, PubMed, Cochrane Library, and Evidence Aid. Personal communications with key informants were also reviewed. Results Thirty-eight studies met the inclusion criteria. Evidence suggested that water-borne, rodent-borne, and vector-borne diseases have been associated with flooding in Europe, although at a lower incidence than developing countries. Conclusion Disease surveillance and early warning systems, coupled with effective prevention and response capabilities, can reduce current and future vulnerability to infectious diseases following flooding.

  5. Analysis of AEC-ERDA-DOE and USGS uranium program data: disipline reviews and summary reports. Final report

    International Nuclear Information System (INIS)

    1980-03-01

    Most of the literature dealing with the econmic geology and exploitation of uranium deposits in the United States has been published since 1950, primarily by the Department of Energy (DOE) and its predecessor agencies. The limited availability of much of these data, combined with the inexperience of many electric power utilities and, to some extent, mining companies with regard to uranium exploration, frequently resulted in the inauguration of ill-conceived and duplicative efforts. To assess the value of this literature in light of present knowledge, a systematic review of those publications dealing with uranium exploration, and the economic geology, evaluation, and exploitation of uranium deposits was undertaken. Matrix reports (summaries) have been prepared for each of the nearly 2500 documents reviewed. This material is available through the computerized literature search services of the Oak Ridge National Laboratory. In addition, thirteen discipline reviews and summary reports were compiled within the broad fields of uraium geology and mining engineering frm which any advances in knowledge would have the greatest impact on the future discovery and exploitation of uranium deposits. A final chapter presents a critique of the DOE National Uranium Resource Evaluation Program, as judged by members of the uranium industry. A two-part report summarizes and analyzes the results of this investigation. Part 1 is primarily an introduction to the various types of uranium deposits, the geologic and structural environments in which they occur, and the mechanisms for their emplacement. Part 2 considers the various techniques used to explore, evaluate, and exploit uranium deposits. The report is intended to serve as a major source of basic information concerning previous uranium-related studies for all those involved with the search for and utilization of uranium

  6. Intervention for replacing missing teeth: Different types of implants - evidence summary of updated Cochrane review

    Directory of Open Access Journals (Sweden)

    Balendra Pratap Singh

    2015-01-01

    Full Text Available Around 1300 different types of dental implants are available worldwide and the implant manufacturers are resorting to aggressive marketing strategies; claiming their implants to provide a superior outcome. The clinician is left with a constant dilemma on which implant to choose for better clinical outcome and welfare of the patient. Moreover, in India, economical consideration is a concern too. The dentist has to select an implant that provides a good result and is economical. Cochrane systematic reviews provide the gold standard evidence for intervention, diagnosis, etc., and follow a strict quality control. A Cochrane systematic review was done to shed light on whether the different implant surface modifications, shapes or materials significantly influence clinical outcomes. All randomized controlled trials (RCTs till January 17, 2014 were searched and out of the 81 trials, only 27 met the inclusion criteria. This evidence summary from the review concludes that based on the available literature; there is no evidence of any one type of implant being superior to another. There is weak evidence showing roughened dental implants are more prone to bone loss due to periimplantitis. This review indicated that there is a need for well-designed RCTs, with long-term follow-up and low bias. Moreover, none of the included studies was from India, which also points out the need for improving the quality of RCTs conducted in India.

  7. Hypoxic treatment inhibits insulin-induced chondrogenesis of ATDC5 cells despite upregulation of DEC1

    DEFF Research Database (Denmark)

    Chen, Li; Fink, Trine; Ebbesen, Peter

    2006-01-01

    Chondrogenesis occurs in vivo in a hypoxic environment, in which the hypoxia inducible factor 1, HIF-1, plays a regulatory role, possibly mediated through the transcription factor DEC1. We have analyzed the effect of hypoxia (1% oxygen) alone and in combination with insulin on the chondrogenic di...

  8. Energy economics basics - Emphasis programme 2004 - 2007; Schwerpunktprogramm EWG 2004 bis 2007

    Energy Technology Data Exchange (ETDEWEB)

    Gutzwiller, L.

    2005-07-01

    This report from the Swiss Federal Office of Energy (SFOE) examines the work done within the framework of the interdisciplinary energy economics programme on scenarios and instruments for energy policy-making and economics, as well as on social and environmental aspects. The report reviews the emphasis and goals of the next phase of the programme for the period 2004 - 2007. A research road map is discussed that is to identify promising technologies that will provide a substantial contribution to meeting the goal of creating the so-called '2000-Watt Society'. The road map is to also help identify technologies that provide socio-economic advantages and identify bottlenecks and restraints on the propagation of energy-efficient technologies in the building and transport areas.

  9. Summary report of the NAAL participation in the regional TC project RER/2/004

    International Nuclear Information System (INIS)

    2002-01-01

    At the end of 1995, the Agency's Laboratories Seibersdorf, together with their counterparts in the Programmatic Divisions in Vienna, agreed to introduce a comprehensive quality assurance system for all their measurements, products and services. The ISO 9000:1994 series of standards was selected as the quality system model for products and services provided, while ISO Guide 25 was selected as the standard for measurements and calibrations. A dedicated effort was initiated in 1997 to establish a quality system in the Chemistry Unit and a Quality Co-ordinator was appointed. This report provides a summary of the NAAL participation in the Project, main achievements and future plans

  10. Savannah River Site environmental report for 1991

    International Nuclear Information System (INIS)

    Arnett, M.W.; Karapatakis, L.K.; Mamatey, A.R.; Todd, J.L.

    1991-01-01

    This report describes environmental activities conducted on and in the vicinity of the Savannah River Site (SRS) in Aiken, S.C., from Jan. 1 to Dec. 31, 1991, with an update on compliance activities through April 1, 1992. The report is a single volume with a separate summary pamphlet highlighting the major findings for 1991. The report is divided into an executive summary and 14 chapters containing information on environmental compliance issues, environmental monitoring methods and programs, and environmental research activities for 1991, as well as historical data from previous years. Analytical results, figures, charts, and data tables relevant to the environmental monitoring program for 1991 at SRS are included

  11. Savannah River Site environmental report for 1991. [Contains Glossary

    Energy Technology Data Exchange (ETDEWEB)

    Arnett, M.W.; Karapatakis, L.K.; Mamatey, A.R.; Todd, J.L.

    1991-01-01

    This report describes environmental activities conducted on and in the vicinity of the Savannah River Site (SRS) in Aiken, S.C., from Jan. 1 to Dec. 31, 1991, with an update on compliance activities through April 1, 1992. The report is a single volume with a separate summary pamphlet highlighting the major findings for 1991. The report is divided into an executive summary and 14 chapters containing information on environmental compliance issues, environmental monitoring methods and programs, and environmental research activities for 1991, as well as historical data from previous years. Analytical results, figures, charts, and data tables relevant to the environmental monitoring program for 1991 at SRS are included.

  12. Savannah River Site environmental report for 1991

    Energy Technology Data Exchange (ETDEWEB)

    Arnett, M.W.; Karapatakis, L.K.; Mamatey, A.R.; Todd, J.L.

    1991-01-01

    This report describes environmental activities conducted on and in the vicinity of the Savannah River Site (SRS) in Aiken, S.C., from Jan. 1 to Dec. 31, 1991, with an update on compliance activities through April 1, 1992. The report is a single volume with a separate summary pamphlet highlighting the major findings for 1991. The report is divided into an executive summary and 14 chapters containing information on environmental compliance issues, environmental monitoring methods and programs, and environmental research activities for 1991, as well as historical data from previous years. Analytical results, figures, charts, and data tables relevant to the environmental monitoring program for 1991 at SRS are included.

  13. Regional Management Plan: Summary report

    International Nuclear Information System (INIS)

    Drobny, N.L.

    1986-01-01

    This summary report describes the results of a 16-month project to develop a Regional Management Plan for low-level radioactive waste management in a seven-state area. The seven states are Indiana, Iowa, Michigan, Minnesota, Missouri, Ohio, and Wisconsin. These states have formed the Midwest Interstate Low-Level Radioactive Waste Commission in accord with Congressional requirements established in 1980. 14 refs., 13 figs., 9 tabs

  14. Trust in Leadership DEOCS 4.1 Construct Validity Summary

    Science.gov (United States)

    2017-08-01

    Trust in Leadership DEOCS 4.1 Construct Validity Summary DEFENSE EQUAL OPPORTUNITY MANAGEMENT INSTITUTE...Report #04-18 1 Trust in Leadership DEOCS 4.1 Construct Validity Summary Background In 2014, DEOMI released DEOCS 4.0 for Department of Defense...and individual items on the DEOCS. The following details the efforts directed toward updating the factor of Trust in Leadership . Included is a review

  15. Husky Energy Inc. 2004 annual report : building on the horizon

    International Nuclear Information System (INIS)

    2005-01-01

    Financial information from Calgary-based Husky Energy Inc. was presented in this annual report and a review of their 2004 operations was made available for the benefit of shareholders. Husky Energy is one of Canada's largest producers of oil and gas. It is an integrated energy and energy-related company consisting of 3 segments: upstream, midstream and refined products. The report lists major achievements for 2004 as well as plans for future activities. Husky share prices at December 31 2004 were $34.25. Total shareholder return was 50 per cent, including ordinary and special dividends. Achievements for 2004 included 420 cold productions heavy wells drilled and new discoveries in the Ekwan/Bivouac and Lynx/Copton areas. International achievements included three successful wells drilled in Wenchang, China. In the midstream and refined products businesses, Husky Energy has achieved more than 900,000 barrels of oil equivalent per day as well as setting a new asphalt sales record. In addition, engineering for a de bottlenecking project is 60 per cent complete. Husky Energy has also commenced blending of the new Western Canada Select crude oil stream. Plans for 2005 included growth in heavy oil production up to 10 per cent, construction of the Tucker Oil Sands Project, additional drilling in Wenchang, China and the completion of 80 per cent of the Lloydminster ethanol plant. This annual report includes an auditor's report of the company's energy resource activities. An operations review was also presented along with consolidated financial statements, a summarized balance sheet of assets, liabilities/surplus and net assets, and common share information. Revenue and expenditure statements were summarized by source. tabs., figs

  16. Energy review 2004 Latin American and Caribbean

    International Nuclear Information System (INIS)

    2004-01-01

    In an environment of energy uncertain caused by the constant increases in the prices of the oil and its derivates, it is very important the selection of public policies that promote the diversification of the energetic matrix, the efficient use of the energy and, if possible, the maximum usage of local resources, which in turn generate the development of productive chains, to supports the social and economic development of our countries. We are in the constant search of mechanism that members assure the strengthening of our member countries, in this respect and to give support to the decisions making, the 2004 Energy Report of Latin America and the Caribbean for second consecutive year, makes an analysis of the energy situation, regional and by country in the different areas of specialization of our Organization: energy policy, hydrocarbons, electricity, renewable energy and environment, possessing the support of the statistical area and of energy information. We hope that this document helps to your institutions for the best understanding of the big challenges in the energy sector of our region, which undoubtedly will rebound in the development of our countries. (The author)

  17. Research on Social Networking Sites and Social Support from 2004 to 2015: A Narrative Review and Directions for Future Research.

    Science.gov (United States)

    Meng, Jingbo; Martinez, Lourdes; Holmstrom, Amanda; Chung, Minwoong; Cox, Jeff

    2017-01-01

    The article presents a narrative review of scholarship on social support through social networking sites (SNSs) published from 2004 to 2015. By searching keywords related to social support and SNSs in major databases for social sciences, we identified and content analyzed directly relevant articles (N = 88). The article summarizes the prevalence of theory usage; the function of theory usage (e.g., testing a theory, developing a theory); major theories referenced; and methodologies, including research designs, measurement, and the roles of social support and SNS examined in this literature. It also reports four themes identified across the studies, indicating the trends in the current research. Based on the review, the article presents a discussion about study sites, conceptualization of social support, theoretical coherence, the role of social networks, and the dynamic relationships between SNS use and social support, which points out potential avenues for shaping a future research agenda.

  18. [Petrous bone fracture. Our experience: 1999-2004].

    Science.gov (United States)

    Ramírez Sabio, J B; de Paula Vernetta, C; García Sanchís, J M; Callejo García, F J; Cortés Andrés, O; Quilis Quesada, V; Dualde Beltrán, D; Marco Algarra, J

    2006-12-01

    To review the petrous bone fractures during the last five years (1999-2004) in our hospital, its manage, control, and analysis onf the associated factors. To analyse the managing protocoles and current bibliography. We review 266 temporal bone fractures, 74 with petrous bone association. We analyse these fractures by sex distribution, injurie severity, otorhinolaryngological clinical findings, production mechanism and radiological findings. The cases are discussed and compared with current bibliography. Petrous bone fractures must be always suspected in patients with head trauma, specially if it associates severity and otorrhagia. It is necessary a deep colaboration between neurosurgeons, radiologists and otorhinolaryngologists to obtain a good management, control and follow up of the patients.

  19. Annual results 2004

    International Nuclear Information System (INIS)

    2005-01-01

    This 2004 annual evaluation of the french RTE company (electric power transport network) provides information on the 2004 results on: institutional information, financial results, customers and market, industrial resources, environment and consultation, human resources and international aspects. (A.L.B.)

  20. Gecat 2004; Gecat 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    Here are given the abstracts of the speeches and the posters presented at the conference 'GECAT 2004'. The thema dealt with here are in particular the catalytic depollution (water treatment, hydro-desulfurization, removal of volatile organic compounds) and the nano-structures in catalysis (catalysis by gold, preparation and application of nano-tubes and nano-fibers). (O.M.)

  1. Gecat 2004; Gecat 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    Here are given the abstracts of the speeches and the posters presented at the conference 'GECAT 2004'. The thema dealt with here are in particular the catalytic depollution (water treatment, hydro-desulfurization, removal of volatile organic compounds) and the nano-structures in catalysis (catalysis by gold, preparation and application of nano-tubes and nano-fibers). (O.M.)

  2. Summary of repository siting models. Final report

    International Nuclear Information System (INIS)

    Thomas, S.D.; Ross, B.; Mercer, J.W.

    1982-07-01

    This report is the first in a series of reports that will provide critical reviews and summaries of computer programs that can be used to analyze the potential performance of a high-level radioactive waste repository. The computer programs identified address the following phenomena: saturated and unsaturated subsurface flow, heat transport, solute transport, surface water runoff, geomechanical interactions, and geochemical interactions. The report identifies 183 computer programs that can be used to analyze a repository site and provides a summary description of 31 computer programs. The summary descriptions can be used: to assist in code evaluation, to facilitate code comparison, to determine applicability of codes to specific problems, to identify code deficiencies, and to provide a screening mechanism for code selection

  3. Trends in the Mental Health Act Review Tribunals: a Welsh experience 2004-2008.

    Science.gov (United States)

    Aziz, V M

    2009-10-01

    This study aims at identifying any local trend in the appeal process and to determine if we are complying with the MHA 1983 and the Code of Practice by reviewing all the appeals to Mental Health Review Tribunals in a psychiatric hospital in South Wales for the period from 2004 to 2008. The total numbers of sections and appeals remain steady over the years. Men are slightly more detained than women mainly under Sections 2 and 3 of the MH Act 1983. The main diagnoses for detention were: bipolar affective disorder, schizophrenia and psychosis. 95% of cases had appeals and 5% referrals. A hearing was held in 52% of cases (n=60), the RMO discharged 38% of patients and the patient withdrew appeal in 10% of cases. 95% of cases were British White ethnicity. Single men tended to appeal more than women 68% vs. 32%. There was no observed trend in the result of the appeals and the proportions of appeal discharged by the hearing remained unchanged. The results of the appeals were not associated with gender, ethnicity, marital status, age or the type of section involved. The patients who were previously detained tend to appeal more, i.e. the more number of detentions, the more number of appeals. In only 12% of cases who had the hearings, the appeal was successful and the patients were discharged from their sections. The study shows steady volume of sections and appeals and the appeals are no more likely to result in discharge. The amendments of the Act 2007 also attract an increase in the appeal process especially in relation to the Community Treatment Orders and the Deprivation of Liberty. The use of both the Act and the Mental Capacity Act 2005 will increase workload for all involved practitioners. 2009 Elsevier Ltd and Faculty of Forensic and Legal Medicine.

  4. Plutonium focus area. Technology summary

    International Nuclear Information System (INIS)

    1997-09-01

    The Assistant Secretary for the Office of Environmental Management (EM) at the U.S. Department of Energy (DOE) chartered the Plutonium Focus Area (PFA) in October 1995. The PFA open-quotes...provides for peer and technical reviews of research and development in plutonium stabilization activities...close quotes In addition, the PFA identifies and develops relevant research and technology. The purpose of this document is to focus attention on the requirements used to develop research and technology for stabilization, storage, and preparation for disposition of nuclear materials. The PFA Technology Summary presents the approach the PFA uses to identify, recommend, and review research. It lists research requirements, research being conducted, and gaps where research is needed. It also summarizes research performed by the PFA in the traditional research summary format. This document encourages researchers and commercial enterprises to do business with PFA by submitting research proposals or open-quotes white papers.close quotes In addition, it suggests ways to increase the likelihood that PFA will recommend proposed research to the Nuclear Materials Stabilization Task Group (NMSTG) of DOE

  5. Content Analyses of Scientific Articles from Issues Published in Sport Mont Journal in 2004

    Directory of Open Access Journals (Sweden)

    Milena Mitrovic

    2018-04-01

    Full Text Available Sport Mont Journal (SMJ is a print and electronic scientific journal aims to present easy access to the scientific knowledge for sport-conscious individuals using contemporary methods. SMJ publishes original scientific papers, review papers, editorials, short reports, peer review - fair review, as well as invited papers and award papers in the fields of Sports Science and Medicine. In this working paper, we will analyze the papers from the journals published in 2004. The newspaper was published in 2004 twice, in May and September. In May issue was published 55 articles, and 24 in September. All papers were classified according to the science fields: sports training and training methodology, anthropology, sports history, research methodology, sports pedagogy, sociopsychology of sports, sports management, biomechanics, physiology and other works. A significant number of monographs have also been published in this publication.

  6. Intra-cardiac masses in adults: A review of echocardiogram records ...

    African Journals Online (AJOL)

    2012-12-04

    Dec 4, 2012 ... TTE is the clinical procedure of choice for identification of left ventricular thrombi. ... Materials and Methods: We did a retrospective review of our echocardiogram reports from May 2003 to July 2012 ... Although many new.

  7. Annual Energy Review 2004

    Energy Technology Data Exchange (ETDEWEB)

    Seiferlein, Katherine E. [USDOE Energy Information Administration (EIA), Washington, DC (United States)

    2005-08-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are data on total energy production, consumption, and trade; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, international energy, as well as financial and environment indicators; and data unit conversion tables. Publication of this report is required under Public Law 95–91 (Department of Energy Organization Act), Section 205(c), and is in keeping with responsibilities given to the EIA under Section 205(a)(2), which states: “The Administrator shall be responsible for carrying out a central, comprehensive, and unified energy data and information program which will collect, evaluate, assemble, analyze, and disseminate data and information....” The AER is intended for use by Members of Congress, Federal and State agencies energy analysts, and the general public. EIA welcomes suggestions from readers regarding data series in the AER and in other EIA publications.

  8. W-519 Sagebrush Mitigation Project FY-2004 Final Review and Status

    Energy Technology Data Exchange (ETDEWEB)

    Durham, Robin E.; Sackschewsky, Michael R.

    2004-09-30

    This report summarizes activities conducted as mitigation for loss of sagebrush-steppe habitats due to Project W-519, the construction of the infrastructure for the Tank Waste Remediation System Vitrification Plant. The focus of this report is to provide a review and final status of mitigation actions performed through FY2004. Data collected since FY1999 have been included where appropriate. The Mitigation Action Plan (MAP) for Project W-519 prescribed three general actions to be performed as mitigation for the disturbance of approximately 40 ha (100 acres) of mature sagebrush-steppe habitat. These actions included: (1) transplanting approximately 130,000 sagebrush seedlings on the Fitzner-Eberhardt Arid Lands Ecology Reserve (ALE); (2) rectification of the new transmission line corridor via seeding with native grasses and sagebrush; and (3) research on native plant species with a goal of increasing species diversity in future mitigation or restoration actions. Nearly 130,000 Wyoming big sagebrush seedlings where planted on ALE during FY2000 and FY2001. About 39,000 of those seedlings were burned during the 24-Command Fire of June 2000. The surviving and subsequent replanting has resulted in about 91,000 seedlings that were planted across four general areas on ALE. A 50% survival rate at any monitoring period was defined as the performance standard in the MAP for this project. Data collected in 2004 indicate that of the over 5000 monitored plants, 51.1% are still alive, and of those the majority are thriving and blooming. These results support the potential for natural recruitment and the ultimate goal of wildlife habitat replacement. Thus, the basic performance standard for sagebrush survival within the habitat compensation planting has been met. Monitoring activities conducted in 2004 indicate considerable variation in seedling survival depending on the type of plant material, site conditions, and to a lesser extent, treatments performed at the time of planting

  9. W-519 Sagebrush Mitigation Project FY-2004 Final Review and Status

    International Nuclear Information System (INIS)

    Durham, Robin E.; Sackschewsky, Michael R.

    2004-01-01

    This report/SUMmarizes activities conducted as mitigation for loss of sagebrush-steppe habitats due to Project W-519, the construction of the infrastructure for the Tank Waste Remediation System Vitrification Plant. The focus of this report is to provide a review and final status of mitigation actions performed through FY2004. Data collected since FY1999 have been included where appropriate. The Mitigation Action Plan (MAP) for Project W-519 prescribed three general actions to be performed as mitigation for the disturbance of approximately 40 ha (100 acres) of mature sagebrush-steppe habitat. These actions included: (1) transplanting approximately 130,000 sagebrush seedlings on the Fitzner-Eberhardt Arid Lands Ecology Reserve (ALE); (2) rectification of the new transmission line corridor via seeding with native grasses and sagebrush; and (3) research on native plant species with a goal of increasing species diversity in future mitigation or restoration actions. Nearly 130,000 Wyoming big sagebrush seedlings where planted on ALE during FY2000 and FY2001. About 39,000 of those seedlings were burned during the 24-Command Fire of June 2000. The surviving and subsequent replanting has resulted in about 91,000 seedlings that were planted across four general areas on ALE. A 50% survival rate at any monitoring period was defined as the performance standard in the MAP for this project. Data collected in 2004 indicate that of the over 5000 monitored plants, 51.1% are still alive, and of those the majority are thriving and blooming. These results support the potential for natural recruitment and the ultimate goal of wildlife habitat replacement. Thus, the basic performance standard for sagebrush survival within the habitat compensation planting has been met. Monitoring activities conducted in 2004 indicate considerable variation in seedling survival depending on the type of plant material, site conditions, and to a lesser extent, treatments performed at the time of planting

  10. 2004 Electron Donor Acceptor Interactions Gordon Conference - August 8-13, 2004

    Energy Technology Data Exchange (ETDEWEB)

    GUILFORD JONES; S ST

    2005-09-14

    The 2004 Gordon Conference on Donor/Acceptor Interactions will take place at Salve Regina University in Newport, Rhode Island on August 8-13, 2004. The conference will be devoted to the consequences of charge interaction and charge motion in molecular and materials systems.

  11. Systematic review on the financial return of worksite health promotion programmes aimed at improving nutrition and/or increasing physical activity

    NARCIS (Netherlands)

    Dongen, J.M. van; Proper, K.I.; Wier, M.F. van; Beek, A.J. van der; Bongers, P.M.; Mechelen, W. van; Tulder, M.W. van

    2011-01-01

    Summary: This systematic review summarizes the current evidence on the financial return of worksite health promotion programmes aimed at improving nutrition and/or increasing physical activity. Data on study characteristics and results were extracted from 18 studies published up to 14 January 2011.

  12. IFT Scientific Status Summary 2008: Innovative Food Packaging Solutions

    Science.gov (United States)

    Food and beverage packaging comprises 55-65% of the $110 billion value of packaging in the United States. This review provides a summary of innovative technology developments in food packaging. The expanded role of food and beverage packaging is reviewed. Active and intelligent food packaging, ba...

  13. Summary of the workshop: towards 4π physics

    International Nuclear Information System (INIS)

    Ngo, C.

    1985-12-01

    This summary is not intended to give an extensive review of all what has been said during the three days about technics, experiments and theories. It will be rather a brief and simple overview of what I felt during the meeting while listening to the different talks, discussions and participating to the round tables which were also a very important part of the workshop and contributed a lot to its success. This summary will be organized as follows: in a first part I shall briefly describe the basic problems that one is faced with ''exclusive'' measurements. Finally, we shall briefly review some of the theoretical problems existing at intermediate bombarding energies since any experiment would initially rely heavily on theoretical considerations

  14. Not Fade Away? Commentary to Paper "Education and The Semantic Web" ("IJAIED" Vol.14, 2004)

    Science.gov (United States)

    Devedzic, Vladan

    2016-01-01

    If you ask me "Will Semantic Web 'ever' happen, in general, and specifically in education?", the best answer I can give you is "I don't know," but I know that today we are still far away from the hopes that I had when I wrote my paper "Education and The Semantic Web" (Devedzic 2004) more than 10 years ago. Much of the…

  15. Neutron radiobiology. Summary of a workshop

    International Nuclear Information System (INIS)

    1978-01-01

    This report is a summary of a workshop held in June 1977 at Oak Ridge National Laboratory to evaluate the progress of research in the field of neutron radiobiology. The participants reviewed the results of current research and identified unresolved questions and areas of uncertainty. They then defined areas in which additional research should be undertaken, and, finally, they reviewed ways in which results from current and projected research could be applied to inform and influence regulatory decisions

  16. Radioactive waste and recoverable material in France. Summary of the National Inventory 2006

    International Nuclear Information System (INIS)

    2006-01-01

    Thorough knowledge is needed if the various types of radioactive waste are to be managed openly, consistently and in a safe manner. All French radioactive material users have subscribed to this process for many years. Under the terms of the French Act of Parliament of 30 December 1991, the Government commissioned the French National Agency for Radioactive Waste Management (or ANDRA) to carry out a survey of all the radioactive waste present on French Territory. Through its efforts to collect and confirm information from many sources over the years, that is mainly from statements made by waste producers and handlers, ANDRA has built up a database on existing waste and its geographical location. This constantly updated resource has been regularly circulated. At the beginning of the century the Government decided to extend the areas covered by this database, in response to the recommendations made by the National Review Board (CNE) and the Parliamentary Office for Evaluating Scientific and Technology Options (OPECST). This is how the first edition of the National Inventory, published in 2004, came about. The National Inventory of Radioactive Waste and Recoverable Material, presents a full panorama of radioactive waste that it groups into waste families that present homogenous characteristics. It describes the state of the waste that may be conditioned (that is, in its final form) or may not be conditioned (that is, has not been put through sufficient treatments to arrive at its final form) at the end of 2004. Furthermore it presents not only a statistical and geographical summary, but a predictive summary, as it provides waste quantity forecasts for 2010, 2020 and beyond. The Inventory also includes recoverable materials that contain radioactivity. They are always accounted for separately because of their special nature. The data is presented in a synthesis report. This summary is the general public version of the report. The synthesis report offers more in

  17. Radioactive waste and recoverable material in France. Summary of the National Inventory 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    Thorough knowledge is needed if the various types of radioactive waste are to be managed openly, consistently and in a safe manner. All French radioactive material users have subscribed to this process for many years. Under the terms of the French Act of Parliament of 30 December 1991, the Government commissioned the French National Agency for Radioactive Waste Management (or ANDRA) to carry out a survey of all the radioactive waste present on French Territory. Through its efforts to collect and confirm information from many sources over the years, that is mainly from statements made by waste producers and handlers, ANDRA has built up a database on existing waste and its geographical location. This constantly updated resource has been regularly circulated. At the beginning of the century the Government decided to extend the areas covered by this database, in response to the recommendations made by the National Review Board (CNE) and the Parliamentary Office for Evaluating Scientific and Technology Options (OPECST). This is how the first edition of the National Inventory, published in 2004, came about. The National Inventory of Radioactive Waste and Recoverable Material, presents a full panorama of radioactive waste that it groups into waste families that present homogenous characteristics. It describes the state of the waste that may be conditioned (that is, in its final form) or may not be conditioned (that is, has not been put through sufficient treatments to arrive at its final form) at the end of 2004. Furthermore it presents not only a statistical and geographical summary, but a predictive summary, as it provides waste quantity forecasts for 2010, 2020 and beyond. The Inventory also includes recoverable materials that contain radioactivity. They are always accounted for separately because of their special nature. The data is presented in a synthesis report. This summary is the general public version of the report. The synthesis report offers more in

  18. Operation experience with the TRIGA reactor Wien 2004

    International Nuclear Information System (INIS)

    Boeck, H.; Villa, M.

    2004-01-01

    The TRIGA Mark-II reactor in Vienna is now in operation for more than 42 years. The average operation time is about 230 days per year with 90 % of this time at nominal power of 250 kW. The remaining 10 % operation time is used for students' training courses at low power level. Pulse operation is rather infrequent with about 5 to 10 pulses per year. The utilization of this facility is excellent, the number of students participating in practical exercises has strongly increased, and also training courses for outside groups such as the IAEA or for the 2004 Eugene Wigner Course are using the reactor, because it is the only TRIGA reactor remaining in Austria. Therefore, there is no need for decommissioning and it is intended to operate it as long as possible into the next decade. Nevertheless, in early 2004 it was decided to prepare a report on a decommissioning procedure for a typical TRIGA Mark II reactor which lists the volumes, the activity and the weight of individual materials such as concrete, aluminium, stainless steel, graphite and others which will accumulate during this process (a summary of possible activated and contaminated materials and the activity of a single TRIGA fuel element as a function of fuel type and decay time in Bq is presented). The status of the reactor (instrumentation, fuel elements, cooling circuit, ventilation system, re-inspection and maintenance program, cost/benefit) is outlined. (nevyjel)

  19. Canadian natural gas : review of 2003 and outlook to 2020

    International Nuclear Information System (INIS)

    2004-12-01

    This presentation provides a summary of natural gas industry trends in Canada and the United States and also reviews Canadian natural gas exports in order to initiate dialogue with the industry and obtain feedback on Natural Resources Canada's interpretations of natural gas issues. The objective of this report is to provide an understanding of the overall North American natural gas picture, largely excluding Mexico, in a graphical format. This document examines market fundamentals in 2003, in 2004 and early 2005, and the long-term to 2020. The presentation first takes a review of 2003 by examining natural gas demand, supply, resources and reserves, storage, prices, and Canadian exports, imports and domestic sales. It then presents its short-term outlook. It concludes with the outlook to 2020 including demand, supply, prices, and Canadian exports and domestic sales. The document also contains appendices on coalbed methane in Canada, liquefied natural gas in Canada, as well as a five year review and outlook of North American natural gas pipelines. 28 refs., 15 tabs., 59 figs., 3 appendices

  20. Salton Sea Scientific Drilling Project: A summary of drilling and engineering activities and scientific results

    Energy Technology Data Exchange (ETDEWEB)

    Ross, H.P.; Forsgren, C.K. (eds.)

    1992-04-01

    The Salton Sea Scientific g Project (SSSDP) completed the first major well in the United States Continental Scientific Drilling Program. The well (State 2-14) was drilled to 10,W ft (3,220 m) in the Salton Sea Geothermal Field in California's Imperial Valley, to permit scientific study of a deep, high-temperature portion of an active geothermal system. The program was designed to investigate, through drilling and testing, the subsurface thermal, chemical, and mineralogical environments of this geothermal area. Extensive samples and data, including cores, cuttings, geothermal fluids and gases, and geophysical logs, were collected for future scientific analysis, interpretation, and publication. Short duration flow tests were conducted on reservoirs at a depth of approximately 6,120 ft (1,865 m) and at 10,136 ft (3,089 m). This report summarizes all major activities of the SSSDP, from project inception in the fall of 1984 through brine-pond cleanup and site restoration, ending in February 1989. This report presents a balanced summary of drilling, coring, logging, and flow-test operations, and a brief summary of technical and scientific results. Frequent reference is made to original records, data, and publication of results. The report also reviews the proposed versus the final well design, and operational summaries, such as the bit record, the casing and cementing program, and the coring program. Summaries are and the results of three flow tests. Several teamed during the project.

  1. U.S. Department of Energy, Illness and Injury Surveillance Program, Worker Health Summary, 1995-2004

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Office of Health, Safety and Security, Office of Illness and Injury Prevention Programs

    2007-10-01

    The Department of Energy’s (DOE) Illness and Injury Surveillance Program has created an opportunity to assess illness and injury rates and patterns among workers at participating sites for well over a decade. The Worker Health Summary introduces an additional perspective on worker health with the introduction of analyses comparing the experience of sites in different program offices and a focus on time trends covering a decade of worker illness and injury experience. These analyses by program office suggest that illness and injury patterns among National Nuclear Security Administration (NNSA) workers diverge in many ways from those seen among Environmental Management (EM) and Science workers for reasons not yet understood. These differences will receive further investigation in future special focus studies, as will other findings of interest. With the time depth now available in our data, the Worker Health Summary reveals an additional nuance in worker health trends: changing health patterns in a specialized and skilled but aging work force. Older workers are becoming an increasing percentage of the work force, and their absence rates for diseases such as diabetes and hypertension are increasing as well. The impact of these emerging health issues, if properly addressed, can be managed to maintain or even enhance worker health and productivity. Prevention strategies designed to reduce the toll of these health conditions appear warranted, and this report gives us an indication of where to focus them. The analyses that follow reflect the Illness and Injury Surveillance Program’s continued commitment to apply a public health perspective in protecting the health of DOE’s work force.

  2. REVIEW OF RECONSTRUCTION IN ACEH FOLLOWING THE 2004 BOXING DAY TSUNAMI

    Directory of Open Access Journals (Sweden)

    Zygmunt Lubkowski

    2009-01-01

    Full Text Available This paper summarises the findings of two field trips to the Aceh Province, which were made by the authors, in early 2006 and late 2007. The purpose of the trips was to assess and provide guidance to the rebuilding process following the 26 December 2004 earthquake and tsunami. The paper will discuss the key issues raised and show how the various agencies involved in the rebuilding process have met the challenges encountered.

  3. De novo microdeletions of chromosome 6q14.1-q14.3 and 6q12.1-q14.1 in two patients with intellectual disability - further delineation of the 6q14 microdeletion syndrome and review of the literature

    DEFF Research Database (Denmark)

    Becker, Kerstin; Di Donato, Nataliya; Holder-Espinasse, Muriel

    2012-01-01

    with broad nasal tip, anteverted nares, long philtrum, and thin upper lip. In this study we describe two patients with overlapping 6q14 deletions presenting with developmental delay and characteristic dysmorphism. Molecular karyotyping using array CGH analysis revealed a de novo 8.9 Mb deletion at 6q14.1-q14.......3 and a de novo 11.3 Mb deletion at 6q12.1-6q14.1, respectively. We provide a review of the clinical features of twelve other patients with 6q14 deletions detected by array CGH analysis. By assessing all reported data we could not identify a single common region of deletion. Possible candidate genes in 6q14...

  4. A systematic review: effectiveness of mass media campaigns for reducing alcohol-impaired driving and alcohol-related crashes.

    Science.gov (United States)

    Yadav, Rajendra-Prasad; Kobayashi, Miwako

    2015-09-04

    Mass media campaigns have long been used as a tool for promoting public health. In the past decade, the growth of social media has allowed more diverse options for mass media campaigns. This systematic review was conducted to assess newer evidence from quantitative studies on the effectiveness of mass media campaigns for reducing alcohol-impaired driving (AID) and alcohol-related crashes, particularly after the paper that Elder et al. published in 2004. This review focused on English language studies that evaluated the effect of mass media campaigns for reducing AID and alcohol-related crashes, with or without enforcement efforts. A systematic search was conducted for studies published between January 1, 2002 and December 31, 2013. Studies from the review by Elder et al. were added as well. A total of 19 studies met the inclusion criteria for the systematic review, including three studies from the review by Elder et al. Nine of them had concomitant enforcement measures and did not evaluate the impact of media campaigns independently. Studies that evaluated the impact of mass media independently showed reduction more consistently (median -15.1%, range -28.8 to 0%), whereas results of studies that had concomitant enforcement activities were more variable (median -8.6%, range -36.4 to +14.6%). Summary effects calculated from seven studies showed no evidence of media campaigns reducing the risk of alcohol-related injuries or fatalities (RR 1.00, 95% CI = 0.94 to 1.06). Despite additional decade of evidence, reviewed studies were heterogeneous in their approaches; therefore, we could not conclude that media campaigns reduced the risk of alcohol-related injuries or crashes. More studies are needed, including studies evaluating newly emerging media and cost-effectiveness of media campaigns.

  5. NATIONAL SYNCHROTRON LIGHT SOURCE ACTIVITY REPORT 2004

    International Nuclear Information System (INIS)

    MILLER, L.

    2005-01-01

    for the environmental science community, is also very important, as it will help to satisfy the large over subscription rate for this technique at the NSLS. Two other important upgrades that were initiated this past year are the replacement of the X25 wiggler with an undulator and the construction of the X9 undulator beamline for small-angle scattering, with an emphasis on nanoscience research. Another key activity that will benefit all users was the restoration of the x-ray ring lattice symmetry, which reduced the horizontal emittance and made the operational lattice more robust. Similarly, all users will benefit from the introduction of the PASS (Proposal Allocation Safety Scheduling) system this past year, which has greatly improved the process of proposal submission, review, allocation, and scheduling. This coming year we will work to add Rapid Access to the capabilities of PASS. Overall, the success of these and the many other projects that space does not permit listing is a testament to the dedication, hard work, and skill of the NSLS staff. Safety has always been an important issue at a large, complex scientific facility like the NSLS and in 2004 it received renewed attention. Safety is our highest priority and we spent a great deal of time reviewing and refining our safety practices and procedures. A new 'Safety Highlights' web page was created for safety news, and a large number of safety meetings and discussions were held. These reviews and meetings generated many ideas on how the NSLS might improve its safety practices, and we are committed to putting these in place and improving our already very good safety program. We had no lost-time accidents in 2004, which is a notable accomplishment. Our goal is to be best in class and I'm confident that by working together we can achieve that status. Several activities took place this past year to advance our proposal to replace the NSLS with a new National Synchrotron Light Source-II facility. These included a major

  6. Regulatory licensing. Status summary report. Nuclear power plants data for decisions (Blue Book), August 17-September 15, 1982

    International Nuclear Information System (INIS)

    1982-09-01

    This management report, regulatory licensing status summary report, is designed to provide the necessary information for controlling the progress of review processes for central station nuclear reactor applications. Section I of this edition consists of the three summary of accomplishments, the new application forecast for OL's and CP's, and an abbreviation key. Section II represents the main body of the report and consists of the facility information. All OL's are listed first, followed by CP's, standard design reviews, other reviews, and finally, a non-power reactor summary. Each project consists of general facility data, current status for all phases of the review, and targeted and actual completion dates for all key milestones in the review

  7. Regulatory licensing status summary report. Nuclear power plants data for decisions (blue book), July 11-August 16, 1982

    International Nuclear Information System (INIS)

    1982-08-01

    This management report, Regulatory Licensing status summary report, is designed to provide the necessary information for controlling the progress of review processes for central station nuclear reactor applications. Section I of this edition consists of the three summary of accomplishments, the new application forecast for OL's and CP's, and an abbreviation key. Section II represents the main body of the report and consists of the facility information. All OL's are listed first, followed by CP's, standard design reviews, other reviews, and finally, a non-power reactor summary. Each project consists of general facility data, current status for all phases of the review, and targeted and actual completion dates for all key milestones in the review

  8. The Increasing Use of Theory in Social Gerontology: 1990–2004

    Science.gov (United States)

    Putney, Norella M.; Rice, Melissa; Bengtson, Vern L.

    2010-01-01

    Objectives. To determine how often theory is used in published research in social gerontology, compare theory use over a 10-year period (1990–1994 to 2000–2004), and identify the theories most frequently used in social gerontology research. Methods. Systematic review of articles published in eight leading journals from 2000 to 2004 (N = 1,046) and comparison with a review conducted 10 years earlier. Results. Theory was mentioned in 39% of articles published from 2000 to 2004, representing a 12% increase in the use of theory over 10 years. This increase was driven by theories outside the core sociology of aging theories identified by Bengtson, V. L., Burgess, E. O., and Parrott, T. M. (1997). Theory, explanation, and a third generation of theoretical development in social gerontology. Journal of Gerontology: Social Sciences, 52B, S72–S88. The five most frequently used theories included the life course perspective, life-span developmental theories, role theory, exchange theory, and person–environment theory/ecological theories of aging. Commonly used models included stress process/stress and coping models, successful aging models, the Andersen behavioral model of health services use, models of control/self-efficacy/mastery, and disablement process models. Discussion. Theory use in social gerontology increased between 1990 and 2004, with a shift toward theories that cross disciplines. However, the majority of research in social gerontology continues to be atheoretical. Models are widely used as a supplement to or substitute for theory. Many of these models are currently being debated and elaborated, and over time, they may emerge as important theoretical contributions to social gerontology. PMID:20675614

  9. EDF group - Reference Document 2004

    International Nuclear Information System (INIS)

    2005-01-01

    The EDF Group is an integrated energy supplier operating in a wide range of electricity-related businesses: generation, transmission, distribution, sale and trading of energy. It is the main operator in the French electricity market and one of the leading electricity groups in Europe. With an installed capacity of 125,4 GW, it contributes to the supply of energy and services to more than 42 million customers throughout the world (with approximately 36 million customers in Europe, more than 28 million of whom are in France). The EDF Group has built a business model balanced between deregulated and regulated operations in France and an international presence. In 2004, the Group recorded consolidated sales of euros 46,928 million, net income (Group share) of euros 1,341 million, and it achieved earnings before interests, taxes, depreciation and amortization of euros 12,127 million. This document is EDF Group's Reference Document for the year 2004. It contains information about: the Group activities, capital, relations with Gaz de France utility, strategy, industrial environment, history, activity in France, international activity, transverse activities and functions, disputes, arbitration and risk factors, Property, Plants and Equipment, Operating and Financial Review, Administrative, Management, and Supervisory Bodies and Senior Management, Remuneration and Benefits, recent trends and perspectives

  10. Use of the live attenuated Japanese Encephalitis vaccine SA 14-14-2 in children: A review of safety and tolerability studies.

    Science.gov (United States)

    Ginsburg, Amy Sarah; Meghani, Ankita; Halstead, Scott B; Yaich, Mansour

    2017-10-03

    Japanese encephalitis (JE) is the leading cause of viral neurological disease and disability in Asia. Some 50-80% of children with clinical JE die or have long-term neurologic sequelae. Since there is no cure, human vaccination is the only effective long-term control measure, and the World Health Organization recommends that at-risk populations receive a safe and effective vaccine. Four different types of JE vaccines are currently available: inactivated mouse brain-derived vaccines, inactivated Vero cell vaccines, live attenuated SA 14-14-2 vaccines and a live recombinant (chimeric) vaccine. With the rapidly increasing demand for and availability and use of JE vaccines, countries face an important decision in the selection of a JE vaccine. This article provides a comprehensive review of the available safety literature for the live attenuated SA 14-14-2 JE vaccine (LAJEV), the most widely used new generation JE vaccine. With well-established effectiveness data, a single dose of LAJEV protects against clinical JE disease for at least 5 years, providing a long duration of protection compared with inactivated mouse brain-derived vaccines. Since 1988, about 700 million doses of the LAJEV have been distributed globally. Our review found that LAJEV is well tolerated across a wide age range and can safely be given to children as young as 8 months of age. While serious adverse events attributable to LAJEV have been reported, independent experts have not found sufficient evidence for causality based on the available data.

  11. Summaries of FY 1996 engineering research

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    This report documents the Basic Energy Sciences (BES) Engineering Research Program for fiscal year 1996; it provides a summary for each of the program projects in addition to a brief program overview. The report is intended to provide staff of Congressional committees, other executive departments, and other DOE offices with substantive program information so as to facilitate governmental overview and coordination of Federal research programs. Of equal importance, its availability facilitates communication of program information to interested research engineers and scientists. Each BES Division administers basic, mission oriented research programs in the area indicated by its title. The BES Engineering Research Program is one such program; it is administered by the Engineering and Geosciences Division of BES. In preparing this report the principal investigators were asked to submit summaries for their projects that were specifically applicable to fiscal year 1996. The summaries received have been edited if necessary, but the press for timely publication made it impractical to have the investigators review and approve the revised summaries prior to publication. For more information about a given project, it is suggested that the investigators be contacted directly.

  12. ISEA2004 fashion show

    Index Scriptorium Estoniae

    2004-01-01

    Karolin Kuusiku, Vassilissa, Jaana Päeva ja Jaanika Pajuste moelooming Rahvusvahelise elektroonilise kunsti sümpoosioni ISEA2004 moeetendusel klubis Bon Bon (Tallinn). ISEA2004 moeetenduse koordinaatoriks oli Tanel Veenre

  13. Synthesizing Risk from Summary Evidence Across Multiple Risk Factors.

    Science.gov (United States)

    Shrier, Ian; Colditz, Graham A; Steele, Russell J

    2018-07-01

    Although meta-analyses provide summary effect estimates that help advise patient care, patients often want to compare their overall health to the general population. The Harvard Cancer Risk Index was published in 2004 and uses risk ratio estimates and prevalence estimates from original studies across many risk factors to provide an answer to this question. However, the published version of the formula only uses dichotomous risk factors and its derivation was not provided. The objective of this brief report was to provide the derivation of a more general form of the equation that allows the incorporation of risk factors with three or more levels.

  14. Generating solutions : summary of the Electricity Sector Council's review of foreign credential recognition

    International Nuclear Information System (INIS)

    2008-03-01

    The Electricity Sector Council has recognized the increasing requirement to recruit and retain internationally trained workers to offset the anticipated retirement of up to 40 per cent of skilled workers in this sector by 2014. This document provided a brief summary of the review of foreign credential recognition in Canada's Electricity Council which was prepared in February 2008. The purpose of the study was to capture a perceptive picture of Canada's electricity labour force and to assist the Electricity Sector Council in the potential development and implementation of strategies to facilitate the integration of internationally trained workers into Canada's electricity sector. This synopsis report presented the analysis of the study including a discussion of immigration trends; foreign credential recognition in Canada's electricity sector; immigration profiles by region; case study profiles; and recommendations. It was recommended that resources be researched, developed and provided in order to help stakeholders attract, recruit, retain and integrate internationally trained workers. 2 refs

  15. 18 CFR 385.2004 - Original and copies of filings (Rule 2004).

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original and copies of... Requirements for Filings in Proceedings Before the Commission § 385.2004 Original and copies of filings (Rule 2004). Any person filing under this chapter must provide an original of the filing and fourteen exact...

  16. End-of-year-closure 2004/2005

    CERN Multimedia

    Human Resources Department

    2004-01-01

    As announced in Weekly Bulletin Nº 3/2004, the Laboratory will be closed from Saturday 18 December 2004 to Sunday 2 January 2005 inclusive. This period consists of 16 days: 4 days' official holiday, i.e. 24, 25 and 31 December 2004 and 1st January 2005; 6 days' special paid leave in accordance with Article R II 4.34 of the Staff Regulations, i.e. 20, 21, 22, 27, 28, and 29 December 2004; 1 Saturday, i.e. 18 December 2004; 2 days, 23 December 2004 to compensate for 25 December 2004 and 30 December 2004 to compensate for 1st January 2005 (Article R II 4.33 of the Staff Regulations); 3 Sundays, i.e. 19 and 26 December 2004 and 2 January 2005. The first working day in the New Year will be Monday 3 January 2005. Further information will be available from Department Secretariats, specifically concerning the conditions applicable to members of the personnel who are required to work during this period. Human Resources Department Tel. 74474

  17. Petro-Canada 2004 strategic overview report : building our portfolio assets for greater profitability today and tomorrow

    International Nuclear Information System (INIS)

    2004-01-01

    Financial information from Petro-Canada was presented and a review of their 2004 operations was made available for the benefit of shareholders. Petro-Canada is focused on 5 core businesses that include: North American gas; east coast oil; oil sands development; international business; and downstream operations. Highlights from 2004 for each of these core business areas were presented. In 2003, record earnings from operations and cash flows were reported at more than $1.9 billion. Upstream production of 451,100 barrels of oil equivalent per day was reported in 2004. This surpassed planned production volumes in 2004 and more than replaced reserves. Refined petroleum product sales were 56,600 cubic metres per day. Highlights for the company for 2004 include the purchase of a coalbed methane and tight bas business in the U.S. Rockies, the acquisition of unconventional land positions in Western Canada and plans to jointly develop a liquefied natural gas re-gasification terminal in Quebec. This report summarized the company's energy resource activities and presented an operations review as well as consolidated financial statements, and common share information including the accounts of Petro-Canada and its subsidiaries and the company's proportionate share of assets, liabilities, revenues, expenses and cash flows of joint ventures. Revenue and expenditure statements were summarized by source. tabs., figs

  18. Ion and solvent diffusion and ion conduction of PC-DEC and PC-DME binary solvent electrolytes of LiN(SO2CF3)2

    International Nuclear Information System (INIS)

    Hayamizu, Kikuko; Aihara, Yuichi

    2004-01-01

    Two binary mixed solvent systems typically used for lithium batteries were studied by measuring the self-diffusion coefficients of the solvent, lithium ion and anion, independently by using the multi-nuclear pulsed field-gradient spin-echo (PGSE) 1 H, 7 Li and 19 F NMR method. One system was propylene carbonate (PC) and diethyl carbonate (DEC) system and the other binary system was PC and 1,2-dimethoxyethane (DME), and the lithium salt used was LiN(SO 2 CF 3 ) 2 (LiTFSI). The relative ratio of the PC was changed from zero (pure DME and DEC) to 100% (pure PC) in the DME-PC and the DEC-PC systems, respectively. The self-diffusion coefficients of the solvents were measured with and without the lithium salt, and the two solvents had almost the same diffusion coefficient in the DEC-PC system, while DME diffused faster than PC in the DME-PC system. In the electrolytes the solvents diffused the fastest, followed by the anion with the lithium ion diffusing the slowest. The degree of ion dissociation was estimated for each electrolyte by comparing the ionic conductivities estimated from the ion diffusion and those measured directly by the electrochemical method

  19. Snake River Sockeye Salmon Captive Broodstock Program; Hatchery Element, 2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Dan J.; Heindel, Jeff A.; Redding, Jeremy (Idaho Department of Fish and Game, Boise, ID)

    2006-05-01

    On November 20, 1991, the National Marine Fisheries Service listed Snake River sockeye salmon Oncorhynchus nerka as endangered under the Endangered Species Act of 1973. In 1991, the Idaho Department of Fish and Game, the Shoshone-Bannock Tribes, and the National Marine Fisheries Service initiated efforts to conserve and rebuild populations in Idaho. Initial steps to recover sockeye salmon included the establishment of a captive broodstock program at the Idaho Department of Fish and Game Eagle Fish Hatchery. Sockeye salmon broodstock and culture responsibilities are shared with the National Oceanic and Atmospheric Administration at two locations adjacent to Puget Sound in Washington State. Activities conducted by the Shoshone-Bannock Tribes and the National Oceanic and Atmospheric Administration are reported under separate cover. Idaho Department of Fish and Game monitoring and evaluation activities of captive broodstock program fish releases (annual report to the Bonneville Power Administration for the research element of the program) are also reported separately. Captive broodstock program activities conducted between January 1, 2004 and December 31, 2004 for the hatchery element of the program are presented in this report. In 2004, twenty-seven anadromous sockeye salmon returned to the Sawtooth Valley. Traps on Redfish Lake Creek and the upper Salmon River at the Sawtooth Fish Hatchery intercepted one and four adults, respectively. Additionally, one adult sockeye salmon was collected at the East Fork Salmon River weir, 18 were seined from below the Sawtooth Fish Hatchery weir, one adult sockeye salmon was observed below the Sawtooth Fish Hatchery weir but not captured, and two adult sockeye salmon were observed in Little Redfish Lake but not captured. Fish were captured/collected between July 24 and September 14, 2004. The captured/collected adult sockeye salmon (12 females and 12 males) originated from a variety of release strategies and were transferred to

  20. Midwest Forensics Resource Center Project Summary June 2005

    Energy Technology Data Exchange (ETDEWEB)

    David Baldwin

    2005-06-01

    The mission of the MFRC Research and Development Program, is to provide technological advances in forensic science for the benefit of our regional partners as well as the forensic community at large. Key areas of forensic science need are identified through our interactions with our Midwest partners and our R&D advisory group, as well as through our participation in national meetings in forensic science. Under the sponsorship of the National Institute of Justice, the MFRC solicits proposals for the development of practical and useful technology, instrumentation, and methodology that address needs in areas related to forensic science and its application to operational crime laboratories. The MFRC facilitates proposal development by working to establish partnerships between researchers and our regional partners. The MFRC administers a peer-review of the proposals and then funds the selected projects at a cost of approximately $55,000 each, with a 12-month period of performance. The process for selection of these projects includes the following steps: (1) drafting of a call for proposals by MFRC staff, (2) review of the draft call by members of the R&D advisory committee, (3) review and approval of the call by NIJ, (4) issuance of the call to ISU, Ames Laboratory, regional partners, and research organizations, (5) receipt of proposals, (6) review of proposals by R&D advisory committee, (7) ranking and selection by MFRC staff using advisory committee reviews, with concurrence by NIJ, (8) notification of proposers, (9) receipt and review of progress reports by MFRC, (10) receipt and review of final reports by MFRC, R&D advisory committee, and NIJ. The decision to fund any specific project is based upon a peer-reviewed call-for-proposal system administered by the MFRC. The reviewers are crime laboratory specialists and scientists who are asked to rate the proposals on four criteria areas including: (1) relevance to the mission of the MFRC, (2) technical approach and

  1. 15 CFR 2004.3 - Organization.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Organization. 2004.3 Section 2004.3 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE FREEDOM OF INFORMATION POLICIES AND PROCEDURES Organization § 2004.3 Organization...

  2. 2004 NZ-INTIMATE Meeting, GNS Rafter Laboratory, Wellington, 23-24 August 2004

    International Nuclear Information System (INIS)

    Alloway, B.V.

    2004-01-01

    Programme and abstracts of the 2004 NZ-INTIMATE (Integration of ice-cores, marine and terrestrial records) Meeting, held at the GNS-Rafter Laboratory, Wellington, 23-24 August, 2004. Co-organised through the Geological Society of New Zealand and the Australasian Quaternary Association

  3. Michigan's forests 2004

    Science.gov (United States)

    Scott A. Pugh; Mark H. Hansen; Lawrence D. Pedersen; Douglas C. Heym; Brett J. Butler; Susan J. Crocker; Dacia Meneguzzo; Charles H. Perry; David E. Haugen; Christopher Woodall; Ed Jepsen

    2009-01-01

    The first annual inventory of Michigan's forests, completed in 2004, covers more than 19.3 million acres of forest land. The data in this report are based on visits to 10,355 forested plots from 2000 to 2004. In addition to detailed information on forest attributes, this report includes data on forest health, biomass, land-use change, and timber-product outputs....

  4. Annual Report 2004

    International Nuclear Information System (INIS)

    Swiboda, G.

    2005-01-01

    The Annual Report of the Institute of Atomic Energy describes the results of the research activities carried out in 2004. The document consist of seven parts: General Information; Operation and safety of MARIA reactor; Radiological protection and monitoring of environment; Nuclear techniques in health and environment protection and in last section the list of published in 2004 papers is presented

  5. The comparison of deliveries in the center of Kahramanmaras in 2004 and 2006

    Directory of Open Access Journals (Sweden)

    Ayhan Coskun

    2007-09-01

    Full Text Available OBJECTIVE: To compare total delivery numbers and cesarean rates in Kahramanmaras city center during 2004 and 2006.\tDesign: Delivery records have been reviewed retrospectively.\tSetting: All hospitals in Kahramanmaras city center.\tPatients: Delivered pregnants. Interventions: None.\tMain Outcome Measures: Demographic characteritics, delivery routes of the pregnants and newborn birthweights. RESULTS: Cesarean section was performed in 3994 out of the 11611 deliveries (34.4 % in 2004 and 5573 out of the 13684 deliveries (40.2 % in 2006. There was an increase in both delivery number and cesarean rates in 2006 when compared with 2004. Delivery rates were increased from 10.3 % and 8.8 % in 2004 to 17.7 % and 12.9 % in 2006 for high risk groups like under 20 and above 35 year-old pregnants, respectively. Also, premature neonates below 2500 and macrosomic babies above 4000 g were increased in 2006 when compared with 2004. It may be thought that, an increase in delivery numbers, high risk pregnancies and cesarean rates could be inevitably cause a higher delivery complication ratios as years run.\tCONCLUSIONS: Obstetrician should be careful before a cesarean decision because previous cesarean is leading cesarean indication.

  6. The aesthetic discourse space of popular music: 1985-86 and 2004-05

    NARCIS (Netherlands)

    van Venrooij, A.

    2009-01-01

    This article presents a comparison of the aesthetic classification system of popular music, as employed by newspaper critics in the Los Angeles Times during 1985-86 and 2004-05. Through a relational discourse analysis of popular music album reviews, which applies the ecological technique of

  7. Executive Summary, Hydraulic Fracturing Study - Draft Assessment 2015

    Science.gov (United States)

    In this Executive Summary of the HF Draft report, EPA highlights the reviews of scientific literature to assess the potential for hydraulic fracturing for oil and gas to change the quality or quantity of drinking water resources.

  8. Mergeable summaries

    DEFF Research Database (Denmark)

    Agarwal, Pankaj K.; Graham, Graham; Huang, Zengfeng

    2013-01-01

    We study the mergeability of data summaries. Informally speaking, mergeability requires that, given two summaries on two datasets, there is a way to merge the two summaries into a single summary on the two datasets combined together, while preserving the error and size guarantees. This property m...

  9. NASA ARCH- A FILE ARCHIVAL SYSTEM FOR THE DEC VAX

    Science.gov (United States)

    Scott, P. J.

    1994-01-01

    The function of the NASA ARCH system is to provide a permanent storage area for files that are infrequently accessed. The NASA ARCH routines were designed to provide a simple mechanism by which users can easily store and retrieve files. The user treats NASA ARCH as the interface to a black box where files are stored. There are only five NASA ARCH user commands, even though NASA ARCH employs standard VMS directives and the VAX BACKUP utility. Special care is taken to provide the security needed to insure file integrity over a period of years. The archived files may exist in any of three storage areas: a temporary buffer, the main buffer, and a magnetic tape library. When the main buffer fills up, it is transferred to permanent magnetic tape storage and deleted from disk. Files may be restored from any of the three storage areas. A single file, multiple files, or entire directories can be stored and retrieved. archived entities hold the same name, extension, version number, and VMS file protection scheme as they had in the user's account prior to archival. NASA ARCH is capable of handling up to 7 directory levels. Wildcards are supported. User commands include TEMPCOPY, DISKCOPY, DELETE, RESTORE, and DIRECTORY. The DIRECTORY command searches a directory of savesets covering all three archival areas, listing matches according to area, date, filename, or other criteria supplied by the user. The system manager commands include 1) ARCHIVE- to transfer the main buffer to duplicate magnetic tapes, 2) REPORTto determine when the main buffer is full enough to archive, 3) INCREMENT- to back up the partially filled main buffer, and 4) FULLBACKUP- to back up the entire main buffer. On-line help files are provided for all NASA ARCH commands. NASA ARCH is written in DEC VAX DCL for interactive execution and has been implemented on a DEC VAX computer operating under VMS 4.X. This program was developed in 1985.

  10. Copper Recycling in the United States in 2004

    Science.gov (United States)

    Goonan, Thomas G.

    2009-01-01

    As one of a series of reports that describe the recycling of metal commodities in the United States, this report discusses the flow of copper from production through distribution and use, with particular emphasis on the recycling of industrial scrap (new scrap1) and used products (old scrap) in the year 2004. This materials flow study includes a description of copper supply and demand for the United States to illustrate the extent of copper recycling and to identify recycling trends. Understanding how materials flow from a source through disposition can aid in improving the management of natural resource delivery systems. In 2004, the U.S. refined copper supply was 2.53 million metric tons (Mt) of refined unalloyed copper. With adjustment for refined copper exports of 127,000 metric tons (t) of copper, the net U.S. refined copper supply was 2.14 Mt of copper. With this net supply and a consumer inventory decrease of 9,000 t of refined copper, 2.42 Mt of refined copper was consumed by U.S. semifabricators (brass mills, wire rod mills, ingot makers, and foundries and others) in 2004. In addition to the 2.42 Mt of refined copper consumed in 2004, U.S. copper semifabricators consumed 853,000 t of copper contained in recycled scrap. Furthermore, 61,000 t of copper contained in scrap was consumed by noncopper alloy makers, for example, steelmakers and aluminum alloy makers. Old scrap recycling efficiency for copper was estimated to be 43 percent of theoretical old scrap supply, the recycling rate for copper was 30 percent of apparent supply, and the new-scrap-to-old-scrap ratio for U.S. copper product production was 3.2 (76:24).

  11. Edirne merkez ilçede prematür ölümler, 2004 ve 2008/Premature mortality in provincial center of Edirne, 2004 and 2008

    Directory of Open Access Journals (Sweden)

    Muzaffer Eskiocak

    2014-04-01

    Full Text Available ÖzetAmaç: Bu çalışmada; Edirne Merkez ilçe ve bağlı köylerde 2004 ve 2008 yıllarında olan prematür ölüm nedenlerini ve bu ölümlere bağlı oluşan potansiyel yaşam yılı kayıplarını belirlemek amaçlanmıştır. Yöntem: Çalışma kesitsel bir araştırmadır. Edirne Merkez ilçe ve bağlı köylerde 2004 ve 2008 yılında meydana gelen ölümler mezarlık, hastane, belediye ve adli tabiplik kayıtlarından derlenmiştir. Ölümler zaman, yer, cinsiyet ve nedenlerine yönelik olarak incelenmiştir. Prematür ölümlere bağlı oluşan Potansiyel Yaşam Yılı Kayıpları (PYYK, Years Potential Life Lost hesaplanmıştır. Bulgular: Edirne Merkez ilçede kaba ölüm hızı 2004 ve 2008 yıllarında sırasıyla binde 5.17 ve binde 5.48 olarak bulunmuştur. 65 yaş altında gerçekleşen ölümler prematür ölüm olarak değerlendirilmiştir. Prematür ölüm oranları 2004 yılında %34.9, 2008 yılında %35.5 olarak tespit edilmiştir. Prematür ölümlerin 2004 yılında %69.9’u, 2008 yılında %65.8’i erkek ölümleridir ve 2004 yılında %14.3’ü, 2008 yılında %8.1’i kırsalda gerçekleşmiştir. Prematür ölümlere bağlı PYYK 2004 yılında 4809 yıl, 2008 yılında 4929 yıldır. Her iki yılda prematür ölüme neden olan ilk beş ölüm nedeni; dolaşım sistemi hastalıkları, kanserler, iyi tanımlayan durumlar, kazalar, solunum sistemi hastalıklarıdır. Sonuç: Edirne Merkez ilçede prematür ölümler tüm ölümlerin yaklaşık üçte birini oluşturmaktadır ve en sık görülen prematür ölüm nedenleri dolaşım sistemi hastalıkları ve kanserlerdir.Anahtar Kelimeler: Prematür mortalite, potansiyel yaşam yılı kaybıAbstractObjective: This study determined the causes of premature mortalities, the potential years of life lost (PYLL and the economic losses due to premature mortality in the provincial centre of Edirne. Methods:This is a cross-sectional study. Mortality data in Edirne for the

  12. Scientific papers presented at the European Congress of Radiology 2000: publication rates and characteristics during the period 2000-2004

    Energy Technology Data Exchange (ETDEWEB)

    Miguel-Dasit, Alberto [La Plana de Vila-Real Hospital, Resonancia Magnetica Section, Castellon (Spain); Marti-Bonmati, Luis [Hospital Universitario Doctor Peset, Resonancia Magnetica, Servicio de Radiologia, Valencia (Spain); Sanfeliu, Pilar [Cardenal Herrera-CEU University, Valencia (Spain); Aleixandre, Rafael [University of Valencia-CSIC, Institute of History of Science and Documentation Lopez Pinero, Valencia (Spain)

    2006-02-01

    To determine the rate at which abstracts orally presented at the ECR 2000 were published between 2000-2004, and to identify predictive factors of publication and differences between abstracts and subsequently published papers. Specific search profiles were devised to retrieve items from the Medline database. From 1020 abstracts originating from 39 countries, 479 articles (publication rate 47%) were subsequently published in 139 Medline-indexed journals, most frequently in European Radiology (14%). Country of origin statistically (P<0.0001) influences the subsequent publication of the abstract, Germany having the highest number of presentations (n=343) and derived articles (publication rate 54%). Abstracts presented by authors from the USA (n=21) had the highest publication rate (76%). Most papers were published within the first 3 years after the meeting, as original articles and in English-language journals. Both the study sample size and the first author frequently changed. Chest and cardiac studies had the highest publication rates (56%, both). In summary, abstracts presented at the ECR 2000 had a high publication rate in Medline-indexed journals. Country of origin and subspecialty of presentation appeared to influence subsequent full publication. More articles were published in European Radiology than in other journal. (orig.)

  13. Scientific papers presented at the European Congress of Radiology 2000: publication rates and characteristics during the period 2000-2004

    International Nuclear Information System (INIS)

    Miguel-Dasit, Alberto; Marti-Bonmati, Luis; Sanfeliu, Pilar; Aleixandre, Rafael

    2006-01-01

    To determine the rate at which abstracts orally presented at the ECR 2000 were published between 2000-2004, and to identify predictive factors of publication and differences between abstracts and subsequently published papers. Specific search profiles were devised to retrieve items from the Medline database. From 1020 abstracts originating from 39 countries, 479 articles (publication rate 47%) were subsequently published in 139 Medline-indexed journals, most frequently in European Radiology (14%). Country of origin statistically (P<0.0001) influences the subsequent publication of the abstract, Germany having the highest number of presentations (n=343) and derived articles (publication rate 54%). Abstracts presented by authors from the USA (n=21) had the highest publication rate (76%). Most papers were published within the first 3 years after the meeting, as original articles and in English-language journals. Both the study sample size and the first author frequently changed. Chest and cardiac studies had the highest publication rates (56%, both). In summary, abstracts presented at the ECR 2000 had a high publication rate in Medline-indexed journals. Country of origin and subspecialty of presentation appeared to influence subsequent full publication. More articles were published in European Radiology than in other journal. (orig.)

  14. Arhitektuurikonkursid 2004

    Index Scriptorium Estoniae

    2004-01-01

    Tulemused: Pärnu kergejõustikumaneezh: I preemia - Ralf Lõoke ja Karli Luik; Tartus Raatuse, Pika, Fortuuna ja Põigu tänava vahelise ala hoonestuskava: I - Kai Kuusik ja Taavi Kuri; Aasta betoonehitis 2003: peapreemia - Emil Urbel; Veneetsia IX rahvusvahelise arhitektuuribiennaali "Metamorfoosid" raames eksponeeritava eesti kaasaegse arhitektuuri näituse ideekonkurss: I - Kristjan Holm; äri- ja elumaja Pärnus Aida t. 5: I - Andres Lember; Eesti parim puitehitis 2003-2004: I - Aivo Schults; Eesti parim tellishoone 2003-2004: I- Tiit Trummal; Sõmeru keskusehoone: I - Ralf Lõoke ja Maarja Kask; Eesti Maanteemuuseumi välialade maastikuarhitektuurne ideekonkurss: I - Margit Kärner

  15. 14 CFR 135.422 - Aging airplane inspections and records reviews for multiengine airplanes certificated with nine...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aging airplane inspections and records reviews for multiengine airplanes certificated with nine or fewer passenger seats. 135.422 Section 135.422... Maintenance, and Alterations § 135.422 Aging airplane inspections and records reviews for multiengine...

  16. Research and Technology Objectives and Plans Summary (RTOPS)

    Science.gov (United States)

    1993-01-01

    This publication represents the NASA research and technology program for FY-93. It is a compilation of the Summary portions of each of the RTOP's (Research and Technology Objectives and Plans) used for management review and control of research currently in progress throughout NASA. The RTOP Summary is designed to facilitate communication and coordination among concerned technical personnel in government, in industry, and in universities. The first section containing citations and abstracts of the RTOP's is followed by four indexes: Subject, Technical Monitor, Responsible NASA Organization, and RTOP Number.

  17. Trends in underweight and overweight/obesity prevalence in Chinese youth, 2004-2009.

    Science.gov (United States)

    Seo, Dong-Chul; Niu, Jingjing

    2014-08-01

    There is a paucity of recent data on Chinese childhood overweight and underweight prevalence especially since 2004. The purpose of this study was to examine trends in underweight and overweight/obesity ("overweight" hereafter) prevalence and energy balance-related behaviors of Chinese youth from 2004 to 2009. Data from the China Health and Nutrition Survey, 2004-2009 (N = 4,061 students aged 6-18 years), were analyzed. Trained health workers took anthropometric measures at the participant's house or at a local clinic following a reference protocol recommended by the World Health Organization. The international age- and sex-specific body mass index reference standard proposed by the International Obesity Task Force was used to define underweight and overweight children in this study. Among 6- to 11-year-old boys, underweight prevalence increased from 14.5% (2004) to 20.1% (2009, p = 0.068). Among 12- to 18-year-old boys, however, overweight prevalence increased from 7.5 to 12.6% (p = 0.034). From 2004 to 2009, after-school sedentary behavior increased from 2.3 to 3.4 h/day for 6- to 11-year-olds (p Chinese students are increasing, with underweight increases more pronounced in 6- to 11-year-olds and overweight increases more pronounced in 12- to 18-year-olds. Nationwide efficacious interventions are needed that improve the diet, decrease sedentary behavior, and encourage a healthy and realistic body image in Chinese youth.

  18. High-pressure fluid-phase equilibria: Experimental methods and systems investigated (2000-2004)

    DEFF Research Database (Denmark)

    Dohrn, Ralf; Peper, Stephanie; Fonseca, José

    2010-01-01

    As a part of a series of reviews, a compilation of systems for which high-pressure phase-equilibrium data were published between 2000 and 2004 is given. Vapor-liquid equilibria, liquid-liquid equilibria, vapor-liquid-liquid equilibria,solid-liquid equilibria, solid-vapor equilibria, solid-vapor-l...

  19. Occupational therapy for elderly : evidence mapping of randomised controlled trials from 2004-2012

    NARCIS (Netherlands)

    Voigt-Radloff, S; Ruf, G.; Vogel, A.; van Nes, F.; Hüll, M.

    OBJECTIVE: Previous systematic reviews on occupational therapy for elderly included studies until 2003. The present evidence mapping summarizes recent evidence for the efficacy of occupational therapy with older persons based on randomised controlled trials from 2004-2012. METHOD: An electronic

  20. Project W-030 safety class upgrade summary report

    International Nuclear Information System (INIS)

    Kriskovich, J.R.

    1998-01-01

    This document presents a summary of safety class criteria for the 241-AY/AZ Tank Farm primary ventilation system upgrade under Project W-030, and recommends acceptance of the system as constructed, based on a review of supporting documentation