WorldWideScience

Sample records for predadores agistemus floridanus

  1. Seletividade de produtos fitossanitários sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae Selectivity ofthe pesticides tothe predaceous mite Agistemus brasiliensis Matioli,, Ueckermann & Oliveira (Acari: Stigmaeidae

    Marcos Zatti da Silva

    2009-06-01

    Full Text Available Os ácaros predadores das famílias Phytoseiidae e Stigmaeidae constituem-se nos principais inimigos naturais de Brevipalpus phoenicis (Geijskes em citros. Este ácaro-praga causa sérios prejuízos na produção, devido à transmissão do vírus da leprose dos citros (CiLV. Apesar do grande volume de informações sobre a sensibilidade de ácaros Phytoseiidae a agrotóxicos, praticamente não existem informações sobre o efeito desses compostos em ácaros Stigmaeidae no Brasil. Sendo assim, o trabalho teve por objetivo avaliar o efeito dos principais agrotóxicos utilizados em citros sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae, em condições de laboratório. Arenas de folhas de citros da variedade Pera, contendo 25 fêmeas adultas de A. brasiliensis, foram pulverizadas em torre de Potter. Avaliaram-se as mortalidades dos ácaros 72 horas após a aplicação. O efeito dos produtos na reprodução do acarino e a viabilidade dos ovos também foram avaliados. Quanto à seletividade, conforme proposta da "Organização Internacional para o Controle Biológico" (IOBC, os produtos foram classificados como: classe 1 - inócuo (E99%, calda sulfocálcica, cyhexatin, flufenoxuron, hexythiazox, óxido de fenbutatin, propargite, pyridaben e spirodiclofen. Estudos conduzidos em condições de campo ainda são necessários para se compreender melhor o efeito desses agrotóxicos sobre o ácaro predador.The predaceous mites of the families Phytoseiidae and Stigmaeidae are the most important natural enemies of Brevipalpus phoenicis (Geijskes on citrus. This mite causes serious damages to the yield due to the transmission of Citrus leprosis virus (CiLV. Despite the considerable amount of information on susceptibility of phytoseiids to pesticides, the effect of these compounds is not very known for stigmaeid mites in Brazil. This work was carried out to evaluate the effect of the main pesticides used in

  2. Biology of three species of Agistemus (Acari: Stigmaeidae): life table parameters using eggs of Panonychus citri or pollen of Malephora crocea as food.

    Goldarazena, Arturo; Aguilar, Hugo; Kutuk, Halil; Childers, Carl C

    2004-01-01

    The biology and life table parameters of Agistemus industani Gonzalez, A. cyprius Gonzalez, and A. floridanus Gonzalez (Acari: Stigmaeidae) were studied under laboratory conditions using two food sources: Panonychus citri (McGregor) eggs or ice plant, Malephora crocea (Jacquin) Schwantes pollen at 25 degrees C. The larval, protonymph, deutonymph, and adult stages of A. industani fed on citrus red mite eggs. All active stages of A. industani, except the larva, fed on all P. citri stages and the larval stage could not feed on P. citri adults. All immature stages of A. industani fed on M. crocea pollen. Agistemus cyprius larvae fed on P. citri eggs and larvae or ice plant pollen. The nymphal stages fed on P. citri eggs, larvae, and protonymphs but not deutonymphs or adults while A. cyprius deutonymphs and adults fed on all P. citri stages. Adult and nymphal stages of A. cyprius fed on ice plant pollen and successfully completed their development while A. floridanus did not. Agistemus floridanus larvae fed only on P. citri eggs, while the other stages fed on P. citri eggs, larvae, and protonymphs. The developmental times from egg to adult for A. industani and A. cyprius when fed M. crocea pollen were 11.3 and 13.4 days, respectively. Agistemus floridanus was unable to complete its life cycle on a diet of only M. crocea pollen. Agistemus industani, A. cyprius, and A. floridanus completed development from egg to adult in 11.7, 13.8, and 10.8 days, respectively, when fed P. citri eggs. The intrinsic rate of increase (r(m)) values for A. cyprius and A. industani were 0.0311 and 0.1201 per day on the pollen diet. The net reproductive rate (Ro) was 3.58 for A. cyprius and 10.07 for A. industani with generation times (T) of 45.2 and 35.1 days, respectively, on the ice plant pollen diet. The r(m) values for A. cyprius, A. floridanus, and A. industani on the P. citri egg only diet were: 0.0562, 0.1001, and 0.1031 per day, respectively. The Ro values for each species fed P

  3. Seletividade de oito inseticidas a predadores de lagartas em citros

    Galvan Tederson Luiz

    2002-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a seletividade dos inseticidas abamectina, acefato, carbaril, deltametrina, fenitrotiom, fenpropatrina, paratiom metílico e triclorfom aos predadores Brachygastra lecheguana (Latreille, Protonectarina sylveirae (Saussure e Protopolybia exigua (Saussure (Hymenoptera: Vespidae em concentrações que corresponderam a 50% e 100% da dose recomendada para o controle de lagartas em citros. Os inseticidas estudados não foram seletivos em favor do predador P. sylveirae. Fenitrotiom, fenpropatrina, paratiom metílico e triclorfom não foram seletivos em favor dos predadores B. lecheguana e P. exigua. Abamectina, acefato e carbaril foram medianamente seletivos em favor de P. exigua, o mesmo foi verificado com abamectina e carbaril em favor de B. lecheguana. Acefato foi seletivo em favor de B. lecheguana e deltametrina em favor de P. exigua. As altas mortalidades causadas por deltametrina a P. sylveirae, triclorfom a B. lecheguana e acefato a P. exigua decresceram quando aplicados em subdose. B. lecheguana foi o predador mais tolerante à dose de acefato, seguido por P. exigua e P. sylveirae. O predador P. exigua foi mais tolerante à dose de deltametrina que B. lecheguana e P. sylveirae. As três espécies de predadores foram altamente suscetíveis às doses e subdoses de fenitrotiom, fenpropatrina e paratiom metílico, e à dose de triclorfom.

  4. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Vicosa, Minas Gerais state, Brazil

    Matioli, Andre L. [Instituto Biologico, Campinas, SP (Brazil). Lab. de Entomologia Economica], e-mail: almatioli@biologico.sp.gov.br; Pallini, Angelo [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal], e-mail: pallini@ufv.br; Tavares, Mara G. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Geral], e-mail: mtavares@ufv.br

    2009-03-15

    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Vicosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifications were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute ({+-} 360 {mu}m long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the fi rst molecular study carried out with stigmaeid mites. (author)

  5. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Vicosa, Minas Gerais state, Brazil

    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Vicosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifications were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute (± 360 μm long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the fi rst molecular study carried out with stigmaeid mites. (author)

  6. Social isolation and brain development in the ant Camponotus floridanus

    Seid, Marc A.; Junge, Erich

    2016-06-01

    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  7. Social isolation and brain development in the ant Camponotus floridanus.

    Seid, Marc A; Junge, Erich

    2016-06-01

    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies. PMID:27126402

  8. Sarcocystis sp. in the eastern cottontail (Sylvilagus floridanus).

    Cosgrove, M; Wiggins, J P; Rothenbacher, H

    1982-01-01

    Sarcocystis sp. was observed in 100 of 185 (54.1%) Eastern cottontails (Sylvilagus floridanus) examined in Pennsylvania over a three year period. Gross and histologic examination commonly revealed cysts in skeletal muscle of the fore and hind legs, flanks and loins. Two rabbits had cysts in esophageal skeletal muscle. Host response to Sarcocystis sp. is described. Adult rabbits had a significantly greater rate of infection (69.3%) than juveniles (20.7%) (P less than 0.01). PMID:6808158

  9. Two renal tumors in cottontail rabbits (Sylvilagus floridanus).

    Carlton, W W; Dietz, J M

    1977-01-01

    Renal tumors were found in two cottontail rabbits (Sylvilagus floridanus) about 1 year old. One tumor was intimately associated with the kidney and consisted of isolated ductular and tubular structures within an abundant connective tissue stroma and was diagnosed as a hamartoma of urogenital origin. The second was composed of epithelial cells arrange as alveolar structures with papillary projections, epithelium that was less differentiated into tubules and ducts, and neoplastic epithelial cells in solid sheets. The diagnosis of renal adenocarcinoma was based on the histologic features as metastasis had not occurred. PMID:850992

  10. Probable herpesvirus infection in an eastern cottontail (Sylvilagus floridanus).

    Schmidt, S P; Bates, G N; Lewandoski, P J

    1992-10-01

    One wild eastern cottontail (Sylvilagus floridanus) from Milwaukee County, Wisconsin was necropsied. The lungs contained numerous multifocal, circumscribed, tan foci; the spleen was markedly enlarged and had a mottled reddish tan color; and the brain had a red to tan friable tract in the left hemisphere. Microscopically, the lung had a severe bronchiolitis and pneumonia. The bronchiolitis was characterized by epithelial cells containing eosinophilic intranuclear inclusion bodies. The encephalomalacia of the left cerebral cortex featured tissue disruption and astrocytes or neurons containing intranuclear inclusion bodies. Herpesvirus particles were found within the bronchiolar epithelial cells. Based on histopathological and ultrastructural findings, a herpesvirus seemed the most likely etiologic agent. PMID:1335521

  11. Apuntes de José Antonio Valverde sobre predadores del hombre

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Apuntes sobre predadores del hombre, que el autor utilizó para elaborar su conferencia "L'Evolution Humaine Apercue Generale", impartida en el Musèe de l'Homme de París, y patrocinada por la Société d’Anthropologie de Paris, el 21 de marzo de 1963.

  12. Eastern cottontail (sylvilagus floridanus) as carrier of dermatophyte fungi.

    Gallo, M G; Tizzani, P; Peano, A; Rambozzi, L; Meneguz, P G

    2005-09-01

    Eastern cottontail (Sylvilagus floridanus, fam. Leporidae), introduced into Piedmont (Italy) in the 1960s, was studied as carrier of dermatophyte fungi. Of 216 hair samples collected from animals culled between September 1999 and July 2000 in the Province of Alessandria (Piedmont, Italy) during a pest control project, 57 (26.4%) yielded dermatophyte colonies. As two different species of dermatophytes grew from two samples, a total of 59 fungal isolates (26.5%) were obtained. Six dermatophyte species both geophilic (M. gypseum, M. cookei, Trichophyton ajelloi, T. terrestre) and zoophilic (M. canis, T. mentagrophytes) were identified. No sex-related differences were found but season-related differences were observed. The highest prevalence of dermatophyte-positive samples was recorded in May-September, due to the geophilic fungi whose prevalence decreased during colder and increased during warmer months (p < 0.001). The presence of zoophilic dermatophytes, T. mentagrophytes, commonly associated with rodents, small mammals and lagomorphs and M. canis, usually correlated with domestic environment, did not change the whole year round. As Eastern cottontail has been showed to be a carrier of dermatophytes transmissible to man (M. canis, T. mentagrophytes and M. gypseum), it may represent a source of infection for gamekeepers, hunters and veterinarians. PMID:16170613

  13. Genetic similarity among Agistemus pallinii Matioli et al (Acari: Stigmaeidae) found in citrus orchards in Viçosa, Minas Gerais State, Brazil.

    Matioli, André L; Pallini, Angelo; Tavares, Mara G

    2009-01-01

    Stigmaeidae are very important predators of mite and insect pests on several crops in Brazil. It is considered the second most important family of predatory mites in citrus orchards in Brazil. However, their identification, especially that of the members of the genus Agistemus, is rather difficult based only on morphology. Hence, this study describes the use of random amplified polymorphic DNA (RAPD-PCR) markers to determine the genetic similarity of an Agistemus pallinii Matioli et al population found in 2004 in a citrus orchard in Viçosa, Minas Gerais State, Brazil, preying on Panonychus citri (McGregor). Amplifi cations were performed with 12 random primers (OPAA8, OPAA19, OPAB1, OPAB5, OPAB18, OPAC9, OPAC17, OPAC19, OPAD10, OPAE9, OPAE12 and OPAE17), which generated 119 bands, with 53.8% polymorphism. The coefficients of genetic similarity among the individuals ranged from 0.68 to 0.99, indicating a high genetic similarity among them. The 3D projection analysis clustered the majority of individuals confirming their high similarity. Though individuals of A. pallinii are minute (+/- 360 microm long), the PCR-RAPD technique can still be used for their identification, complementing morphological analyses or for comparison of populations collected in different geographic regions. This is the first molecular study carried out with stigmaeid mites. PMID:19488517

  14. Serologic evidence for rabbit syncytium virus in eastern cottontail rabbits (Sylvilagus floridanus) in Ohio.

    Theil, K W; McCloskey, C M; Scott, D P

    1993-07-01

    Thirteen of 20 eastern cottontail rabbit (Sylvilagus floridanus) sera collected near Delaware, Ohio (USA) in 1991 were positive by indirect immunofluorescent antibody test (IFAT) for antibody to rabbit syncytium virus (RSV), a Kemerovo serogroup orbivirus. In addition, two of 10 domestic bovine sera and three of 30 sheep sera collected in southeastern Ohio gave weak positive IFAT reactions to RSV. PMID:8394944

  15. Immune response of the ant Camponotus floridanus against pathogens and its obligate mutualistic endosymbiont.

    Ratzka, Carolin; Liang, Chunguang; Dandekar, Thomas; Gross, Roy; Feldhaar, Heike

    2011-08-01

    Numerous insect species harbor mutualistic endosymbionts that play a role in nutrient cycling or confer other fitness benefits to their hosts. Insect hosts face the problem of having to maintain such mutualistic bacteria while staging an immune response towards pathogens upon infection. In addition, hosts may regulate the number of endosymbionts present in their tissues via the innate immune system. Camponotus floridanus ants harbor the obligate endosymbiont Blochmannia floridanus in specialized midgut cells and ovaries. We identified genes transcriptionally induced in response to septic injury by suppression subtractive hybridization (SSH). Among these were genes involved in pathogen recognition (e.g. GNBP), signal transduction (e.g. MAPK-kinase), antimicrobial activity (e.g. defensin and hymenoptaecin), or general stress response (e.g. heat shock protein). A quantitative analysis of immune-gene expression revealed different expression kinetics of individual factors and also characteristic expression profiles after injection of gram-negative and gram-positive bacteria. Likewise, B. floridanus injected into the hemocoel elicited a comparable immune response of its host C. floridanus. Thus, the host immune system may contribute to controlling the endosymbiont population. PMID:21440063

  16. Effects of Hydrogen Peroxide and Metrifonate on Monogenean ligictaluridus floridanus on Catfish ( Ictalurus punctatus , Rafinesque) Gills.

    Benavides-González, Flaviano; Gomez-Flores, Ricardo Alberto; Rábago-Castro, Jaime Luis; Sánchez-Martínez, Jesús Genaro; Montelongo-Alfaro, Isidro Otoniel

    2015-12-01

    Hydrogen peroxide (H2O2) and metrifonate (Mtf) are common products used in ectoparasite infestations on fish cultures. The therapeutic efficacy of H2O2 and Mtf on a common monogenean parasite, Ligictaluridus floridanus, was evaluated in channel catfish ( Ictalurus punctatus ). In vitro trials were conducted using excised fish gills naturally infected with L. floridanus, which were immersed in H2O2 (150, 300, and 570 mg L(-1)) and Mtf (0.25, 0.5, and 0.75 mg L(-1)) solutions. The efficacy of the treatments was based on the survival time of the parasites, observed microscopically. In addition, an in vivo trial using catfish juveniles, naturally infected with L. floridanus, was also performed. One group received immersion baths of 570 mg L(-1) H2O2 (3%) during 4 min; the Mtf (90%) group received 0.5 mg L(-1) Mtf for 10 min. Treatments were done on days 3, 7, and 11 of the experiment. Results indicate that baths with Mtf do not significantly reduce the mean intensity of the parasite per gill arch, nor do they reduce the in vitro survival time of parasites during treatment; H2O2 baths at 570 mg L(-1) during 4 min were effective (P < 0.05) against adult and juvenile stages of L. floridanus. This study supports the use of H2O2 as an effective antiparasitic agent against I. punctatus . PMID:26286108

  17. Toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis

    Bruce Veronez; Mário Eidi Sato; Roberto Lomba Nicastro

    2012-01-01

    O objetivo deste trabalho foi avaliar a toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis. A mortalidade e a taxa de crescimento de T. urticae e seu predador foram avaliadas após a aplicação de: abamectina, clofentezina, fenpropatrina, fenpiroximato, propargito, enxofre e espiromesifeno, nas concentrações recomendadas; óleos de nim (Natuneem e Sempre Verde Killer Neem a 1%); e extratos aquosos a 10% de Dieffenbachia brasiliensis, Anno...

  18. Eimeria azul sp. n. (protozoa: Eimeriidae) from the eastern cottontail, Sylvilagus floridanus, in Pennsylvania.

    Wiggins, J P; Rothenbacher, H

    1979-06-01

    Eimeria azul sp. n. is described from the cottontail rabbit, Sylvilagus floridanus, in central Pennsylvania. The oval oocysts are 19.5--27.0 micrometer by 15.0--19.0 (mean - 22.9 X 16.7 micrometer). The fusiform sporocysts are 7.8--14.0 micrometer by 3.3--6.5 micrometer (mean = 11.8 X 5.8 micrometer). A Stieda Body is present. There is no micropyle, oocyst residuum or polar granule. The sporocyst has a residuum which is variable in appearance. The oocysts are characterized by a blue tint when viewed with an apochromatic objective lens. PMID:480068

  19. Gastrointestinal parasites of the eastern cottontail (Sylvilagus floridanus) in central Pennsylvania.

    Wiggins, J P; Cosgrove, M; Rothenbacher, H

    1980-10-01

    During a 3 year period, 186 eastern cottontails (Sylvilagus floridanus) were trapped from two areas and examined for helminth and protozoan parasites. Fecal samples from 139 were evaluated for coccidia and helminth ova. Nine species of coccictia were identified: Eimera audubonii, E. azul, E. environ, E. honessi, E. maior, E.minima, E. neoirresidua, E. neoleporis, and E. sylvilagi. Ova from 5 helminth species were found: Cittotaenia sp., Hastilesia tricolor, Passalurus sp., a trichostrongyle-type nematode species, and Trichuris sp. Five helminths were recovered from stomachs and small intestines: Cittotaenia sp. H. tricolor, Obeliscoides cuniculi,, Passalurus ambiguus, and Trichostrongylus calcaratus. PMID:7463607

  20. Brugia lepori sp. n. (Filarioidea: Onchocercidae) from rabbits (Sylvilagus aquaticus, S. floridanus) in Louisiana.

    Eberhard, M L

    1984-08-01

    Brugia lepori sp. n., a filarial nematode from the abdominal lymphatics and subcutaneous tissues of rabbits (Sylvilagus aquaticus, S. floridanus), from St. Tammany Parish, Louisiana, is described. Brugia lepori is of moderate size (males 12 to 19 mm, females 39 to 45 mm) and within the genus most closely resembles Brugia beaveri of the raccoon, from which it can be distinguished by its larger size, smaller spicules, and smaller microfilaria which has a shorter cephalic space. Brugia lepori is only the second species of Brugia described from North America and the third species reported from the Western Hemisphere. PMID:6502360

  1. Toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis

    Bruce Veronez

    2012-04-01

    Full Text Available O objetivo deste trabalho foi avaliar a toxicidade de compostos sintéticos e naturais sobre Tetranychus urticae e o predador Phytoseiulus macropilis. A mortalidade e a taxa de crescimento de T. urticae e seu predador foram avaliadas após a aplicação de: abamectina, clofentezina, fenpropatrina, fenpiroximato, propargito, enxofre e espiromesifeno, nas concentrações recomendadas; óleos de nim (Natuneem e Sempre Verde Killer Neem a 1%; e extratos aquosos a 10% de Dieffenbachia brasiliensis, Annona squamosa, Ruta graveolens, Agave angustifolia, Melia azedarach, Sonchus oleraceus, Mentha spicata x M. suaveolens, Allium cepa, Laurus nobilis e Eucalyptus saligna. A toxicidade aguda e a influência dos compostos sobre a taxa de crescimento instantâneo dos ácaros foram avaliadas em laboratório. Extratos de A. cepa, A. angustifolia, produtos à base de óleo de nim, espiromesifeno, propargito, fenpiroximato, abamectina e fenpropatrina causaram mortalidade superior a 83% em T. urticae. Extrato de A. angustifolia, Natuneem e clofentezina não causaram mortalidade significativa em P. macropilis. Agave angustifolia e Natuneem não afetaram significativamente a taxa de crescimento deste predador. Propargito, fenpiroximato, abamectina, fenpropatrina, espiromesifeno e extrato de L. nobilis afetaram severamente a população de P. macropilis.

  2. Seletividade de inseticidas a predadores de pulgões Selectivity of insecticides to predators of aphids

    Marcos Rafael Gusmão

    2000-07-01

    Full Text Available Estudou-se a seletividade dos inseticidas cipermetrina, diclorvós, diazinon, etion, fenitrotion, malation, metamidofós, paration metílico, permetrina, pirimicarbe e vamidation para adultos dos predadores Cycloneda sanguinea (L. e Eriopis connexa (Germ.(Coleoptera: Coccinellidae. Folhas de tomateiro foram imersas em caldas inseticidas nas doses utilizadas para o controle dos pulgões Myzus persicae (Sulzer e Macrosiphum euphorbiae (Thomas em tomateiro e também na metade das doses recomendadas. Os fatores em estudo foram os inseticidas, as doses, as espécies de predadores e o sexo para C. sanguinea. Vamidation e o pirimicarbe foram os inseticidas mais seletivos a C. sanguinea seguidos do etion e diclorvós (3,2; 6,7; 49,7 e 52,5% de mortalidade, respectivamente. Para E. connexa o pirimicarbe foi o mais seletivo seguido pelo etion e cipermetrina (1,96; 71,28 e 81,92% de mortalidade, respectivamente. Os machos de C. sanguinea foram mais tolerantes que as fêmeas ao etion (33 e 66,5% de mortalidade e permetrina (61 e 100% de mortalidade, respectivamente. A toxicidade da permetrina a E. connexa e do etion às fêmeas de C. sanguinea foi menor quando estes inseticidas foram aplicados em subdose (74,4 e 25% de mortalidade, respectivamente do que quando estes foram aplicados na dose recomendada (100 e 66,5% de mortalidade, respectivamente para o controle de pulgões no tomateiro.The selectivity of cypermethrin, dichlorvos, diazinon, ethion, fenitrothion, matathion, methamidophos, methyl parathion, permethrin, pirimicarb, and vamidathion to adults of Cycloneda sanguinea (L. and Eriopis connexa (Germ. (Coleoptera: Coccinellidae was studied. Tomato leaves were submerged in insecticide solution at recommended rate for controlling Myzus persicae (Sulzer and Macrosiphum euphorbiae (Thomas in tomatoes. The effect of insecticides, doses, predator species, and sex of C. Sanguinea in insecticide selectivity was evaluated. Pirimicarb and vamidathion were the

  3. Encephalitozoon cuniculi, Toxoplasma gondii and Neospora caninum infection in invasive Eastern Cottontail Rabbits Sylvilagus floridanus in Northwestern Italy.

    Zanet, S; Palese, V; Trisciuoglio, A; Cantón Alonso, C; Ferroglio, E

    2013-11-01

    Sylvilagus floridanus is a lagomorph introduced for hunting purposes from North America to Europe where, in certain areas like Northern Italy, its population reached high densities. Brain, kidney and skeletal muscle of 144 Eastern Cottontail Rabbits S. floridanus were examined by PCR for Encephalitozoon cuniculi, Toxoplasma gondii and Neospora caninum. DNA of E. cuniculi was found with a prevalence of 9.72% (CI 95% 0.058-0.156). T. gondii and N. caninum DNA was detected in 2.08% (CI 95% 0.0071-0.0595) and 2.78% (CI 95% 0.0109-0.0692) of the samples examined, respectively. This is the first report of E. cuniculi infection in a lagomorph species other than in its natural host Oryctolagus cuniculus, and this is also the first time N. caninum is found to naturally infect S. floridanus. E. cuniculi, T. gondii and N. caninum infect S. floridanus at low but relevant prevalences, considered the important role that these pathogens could play in both animal and human health. PMID:23747104

  4. Survival of vaccinated,feed-trained largemouth bass fry (Micropterus Salmoides Floridanus) during natural exposure to Flavobacterium columnare

    Largemouth bass (Micropterus salmoides floridanus; Centrarchidae) are often reared in government hatchery programs, then stocked to supplement wild fish populations. After the eggs obtained from broodstock are hatched, fry are stocked into ponds to feed on zooplankton and other small invertebrates....

  5. Potencial predador de arañas tejedoras sobre insectos plaga presentes en un cultivo de soja

    Rojas Buffet, Carolina; Ottati, Marcelo; Viera, Carmen

    2015-01-01

    Las arañas presentan características que las hace un buen agente de control biológico. Sin embargo, su papel como reguladores de las poblaciones de insectos plaga ha sido poco estudiado. Nuestro trabajo tuvo como objetivo caracterizar el comportamiento predador de las arañas de tela más representativas de un cultivo de soja ante dos tipos de presas plaga: áfidos y colémbolos. Se realizaron experiencias de alimentación donde a cada araña se le ofreció ambos tipos de presas. Se describieron ...

  6. Endoparasites of selected populations of cottontail rabbits (Sylvilagus floridanus) in the southeastern United States.

    Andrews, C L; Davidson, W R

    1980-07-01

    During the fall of 1966 and spring of 1967, 260 cottontail rabbits (Sylvilagus floridanus) were collected from 13 sites in 8 southeastern states and examined for endoparasites. In order of prevalence, the endoparasites found were: Obeliscoides cuniculi, Trichostrongylus calcaratus, Trichostrongylus affinis, Taenia pisiformis (cysticerci), Raillietina salmoni, Eimeria spp., Longistriata noviberiae, Cittotaenia variabilis, Hasstilesia tricolor, Trichuris leporis, Dermatoxys veligera, Passalurus ambiguus, Dirofilaria scapiceps, Sarcocystis sp., Linguatula serrata, Nematodirus leporis, and Gongylonema pulchrum. Data are presented on prevalance and intensity of infection with each parasite along with information on geographic distribution. Cottontail rabbits in the southeastern United States show a higher level of parasitism than has been reported from other regions, although these higher parasite burdens were not necessarily associated with increased host morbidity. PMID:7411746

  7. Tyzzer's disease in free-living cottontail rabbits (Sylvilagus floridanus) in Maryland.

    Ganaway, J R; McReynolds, R S; Allen, A M

    1976-10-01

    Complement-fixing (CF) antibody to Bacillus piliformis antigen was found in 9 of 14 (64%) serum samples obtained from cottontail rabbits (Sylvilagus floridanus) killed in the wild. CF antibody was not present in the serum of 8 cottontail rabbits trapped as juveniles in the same geographic areas and held in captivity for 4 years. Sero-negative cottontail rabbits died acutely with lesions typical of Tyzzer's disease following the intragastric administration of 10(3.8) ELD50 of B. piliformis spores. The possible influence of Tyzzer's disease upon the cyclic population pattern of cottontail rabbits in the wild is discussed. A hypothesis is presented that B. piliformis spores passed in the feces of diseased wild animals could contaminate pastures, hay and grain, and thereby serve as sources of infection to other animals. PMID:16502694

  8. Experimental infection of eastern cottontail rabbits Sylvilagus floridanus) with infectious bovine rhinotracheitis virus.

    Lupton, H W; Reed, D E

    1979-09-01

    Experimental infection of eastern cottontail rabbits (Sylvilagus floridanus) with infectious bovine rhinotracheitis virus caused acute keratoconjunctivitis and a fatal systemic infection. The clinical syndrome was characterized initially by blepharospasm and ocular discharge. The rabbits were markedly depressed on post-exposure day (PED) 5 and were dead or moribund on PED 6. The virus was readily recovered from liver and adrenal gland tissue on PED 6 and from conjunctival swabs on PED 1 to 6. Histopathologic studies revealed a few necrotic foci in the liver and multiple focal to diffuse necrosis of the adrenal glands. Viral isolation and immunofluorescence tests were used to demonstrate a direct association between infectious bovine rhinotracheitis viral antigens and the lesions. PMID:230773

  9. A new species of Paraheligmonella (Nematoda, Heligmonellidae), parasite of Sylvilagus floridanus (Leporidae) from Costa Rica Una especie nueva de Paraheligmonella (Nematoda, Heligmonellidae), parásita de Sylvilagus floridanus (Leporidae) en Costa Rica

    María Celina Digiani; Ramón A. Carreño; Marie-Claude Durette-Desset

    2008-01-01

    Paraheligmonella lamothei n. sp. (Heligmonellidae: Heligmonellinae) is described from the small intestine of a cottontail, Sylvilagus floridanus (Allen, 1890) (Leporidae), from Costa Rica. New morphological data on the synlophe and caudal bursa of Paraheligmonella romerolagi (Gibbons and Kumar, 1980), the most similar species, are also provided. The new species differs from P. romerolagi, parasitic of Romerolagus diazi (Ferrari-Pérez, 1893) from Mexico, mainly by the characters of the caudal ...

  10. Plantas cultivadas e invasoras como habitat para predadores do gênero Orius(Wolff (Heteroptera: anthocoridae

    Silveira Luís Cláudio Paterno

    2003-01-01

    Full Text Available O objetivo deste trabalho foi registrar as espécies de Orius associadas a plantas cultivadas e invasoras presentes em uma localidade de Minas Gerais e três de São Paulo, nos anos de 1999 e 2000. As coletas foram realizadas através de batidas das plantas no interior de sacos plásticos para desalojar os insetos. Posteriormente, as espécies foram separadas em laboratório. O predador Orius insidiosus (Say foi coletado nas culturas de milho (Zea mays L., milheto (Pennisetum glaucum (L. R.Br., sorgo (Sorghum spp., feijão (Phaseolus vulgaris L., girassol (Helianthus annuus L., alfafa (Medicago sativa L., soja [Glycine max (L. Merr.], crisântemo (Chrysanthemum spp., tango (Solidago canadensis L. e cartamus (Carthamus tinctorius L. e nas plantas invasoras picão-preto (Bidens pilosa L., caruru (Amaranthus sp., losna-branca (Parthenium hysterophorus L. e apaga-fogo (Alternanthera ficoidea L.. Orius thyestes Herring foi encontrado nas plantas invasoras picão-preto, caruru e apaga-fogo. Orius perpunctatus (Reuter e Orius sp. foram coletados principalmente nas plantas invasoras picão-preto, caruru e apaga-fogo e no milho. Constatou-se que muitas dessas plantas são reservatórios naturais para esses predadores, em termos de habitat, abrigo, presas e pólen.

  11. In Vitro Cultivation of a Zoonotic Babesia sp. Isolated from Eastern Cottontail Rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts

    Holman, Patricia J.; Spencer, Angela M.; Droleskey, Robert E.; Goethert, Heidi K; Telford, Samuel R.

    2005-01-01

    A Babesia sp. found in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, is the same organism that caused human babesiosis in Missouri and Kentucky, on the basis of morphology and identical small-subunit rRNA (SSU rRNA) gene sequences. Continuous cultures of the rabbit parasite were established from infected blood samples collected from two cottontail rabbits livetrapped on Nantucket Island. HL-1 medium or minimal essential medium alpha medium supplemented...

  12. Invasive species and their parasites: eastern cottontail rabbit Sylvilagus floridanus and Trichostrongylus affinis (Graybill, 1924) from Northwestern Italy.

    Tizzani, P; Catalano, S; Rossi, L; Duignan, P J; Meneguz, P G

    2014-04-01

    The eastern cottontail Sylvilagus floridanus is a native American lagomorph. Within the genus Sylvilagus, the eastern cottontail is the species with the widest distribution. From 1950s, the species was introduced to several European countries. A rapid territorial expansion of the introduced eastern cottontails has been observed in many areas of Italy. The eastern cottontail has been demonstrated to play a main role as carrier of exotic parasites. To date, three nematode species, exotic in Italian ecosystems, have been reported from introduced S. floridanus. However, its parasite fauna biodiversity is richer in native populations of the American continent. The aim of this work was to further investigate the gastrointestinal parasites of S. floridanus, to evaluate the potential presence of other exotic species. During 2010, 101 hosts were examined, and three nematodes were collected from their digestive tract. Two parasite species (Obeliscoides cuniculi, Trichostrongylus calcaratus) were already reported in Italy; the isolation of Trichostrongylus affinis is instead the first report of this nematode in Italy and in Europe as a whole. This study wants to highlight the great risks related to the introduction of allochthonous species. The impact of the invasion by alien animal species may be particularly severe for public and animal health, due to the potential introduction of new pathogens. The good number of exotic parasites found in introduced eastern cottontails, together with the few sanitary surveys carried out, suggests that an epidemiological survey, with specimens from multiple localities on a wider geographic range, could lead to interesting findings on parasites of native and alien lagomorphs in Europe. PMID:24481904

  13. Eastern cottontail rabbits (Sylvilagus floridanus) develop West Nile virus viremias sufficient for infecting select mosquito species.

    Tiawsirisup, Sonthaya; Platt, Kenneth B; Tucker, Brad J; Rowley, Wayne A

    2005-01-01

    The potential of the eastern cottontail rabbit (CTR; Sylvilagus floridanus) to contribute to an enzootic West Nile virus (WNV) cycle was demonstrated by characterizing the WNV viremia profile of 15 CTRs and demonstrating that mosquitoes could become infected by feeding on these CTRs. Eight CTRs were infected with a titer of 10(5.0) cell-infectious dose 50% endpoints (CID50s) of WNV (NY99-Crow) by needle and seven CTRs by bite of one or more WNV-infected mosquitoes. There were no marked differences between the WNV viremia profiles of CTRs infected by either method. West Nile virus was detected in serums of all CTRs by 24 h p.i. The daily mean titers of all 15 CTRs on days 1-4 p.i. were 10(4.1+/-0.4), 10(4.7+/-0.3), 10(4.1+/-0.6), and 10(3.7+/-0.6) respectively, declining to 10(1.2+/-0.1) CID50s/ml of serum by day 6 p.i. No virus was detected in the blood of any CTR on day 7 p.i. The average duration of WNV titers of >or=10(4.3) and or=10(4.3) and >10(5.0) were 11.5 +/- 5.5 and 21 +/- 6.0%, respectively. These rates increased to 20.5 +/- 6.4% and 25.0 +/- 3.0% when CTR serum titers were >10(5.0) CID50s/mL. Neither Aedes aegypti (L.) nor Aedes albopictus (Skuse) were infected by feeding on CTRs with titers of 10(5.0) CID50s/ml. None of the CTRs infected by mosquito bite or by needle showed any symptoms of WNV disease. PMID:16417430

  14. Evolution of chromosomal variation in cottontails, genus Sylvilagus (Mammalia: Lagomorpha): S. aquaticus, S. floridanus, and S. transitionalis.

    Robinson, T J; Elder, F F; Chapman, J A

    1983-01-01

    The banding patterns of mitotic chromosome from three cottontail species, Sylvilagus aquaticus (2n = 38), S. floridanus (2n = 42), and S. transitionalis (2n = 46), are presented and compared with those of the proposed leporid ancestral karyotype, the latter being reflected in a species of hare, Lepus saxatilis (2n = 48). The differences in the diploid numbers of the cottontail species are primarily due to the fixation of Robertsonian fusions which have occurred during the evolution of their respective genomes. Of the eight fusion products identified, seven were species specific, while one, which is thought to reflect their more recent common ancestory, is shared by both S. aquaticus and S. floridanus. Other karyotypic differences include interspecific variation in the amount and distribution of constitutive heterochromatin, as well as the presence of two autosomal pairs in S. transitionalis which do not have apparent banding homologies either with the chromosomes of other cottontails or with those of the Lepus genome. The tendency for certain chromosomes in the ancestral karyotype to show a predisposition to undergo fusion events within the Leporidae is discussed. PMID:6861527

  15. The niches of Agistemus exsertus and its primary preys in the citrus ecosystem%橘园中重要天敌具瘤神蕊螨与其主要猎物的生态位

    季洁; 张艳璇; 康玉妹; 陈霞; 林坚贞

    2006-01-01

    研究了柑橘园中具瘤神蕊螨(Agistemus exsertus)与其主要猎物柑橘皱叶刺瘿螨(Phyllocoptruta oleivora)、柑橘全爪螨(Panonychus citri)、柑橘粉虱(Dialeurodes citri)、黑刺粉虱(Aleurocanthus spiniferus)的生态位宽度、重叠和比例相似性.具瘤神蕊螨与其主要猎物相比,其时间和空间生态位宽度均最大,而其猎物中则以柑橘皱叶刺瘿螨的时间和空间生态位宽度最大,这表明具瘤神蕊螨和柑橘皱叶刺瘿螨的发生期较长,空间分布较广.具瘤神蕊螨与其猎物的生态位重叠在空间上与柑橘全爪螨的重叠值最大,在时间上与柑橘粉虱的重叠值最大.与其猎物相比,具瘤神蕊螨的时-空二维生态位宽度最大,在时空上占有明显的优势.

  16. Seletividade de agrotóxicos utilizados em pessegueiro sobre ovos e pupas do predador Chrysoperla externa

    Rodolfo Vargas Castilhos

    2014-11-01

    Full Text Available Objetivou-se com este trabalho avaliar a seletividade de dezenove agrotóxicos utilizados na cultura do pessegueiro sobre ovos e pupas do predador Chrysoperla externa em condições laboratoriais (temperatura 25±1ºC, umidade relativa 70±10% e fotofase 14 horas. Os agrotóxicos foram pulverizados diretamente sobre ovos e pupas por meio de uma torre de Potter, utilizando a máxima dosagem recomendada para a cultura do pessegueiro. Foi avaliada a viabilidade de ovos e pupas, além da fecundidade e fertilidade de adultos emergidos de pupas tratadas. Os agrotóxicos foram classificados para ovos em função da redução na eclosão e, para pupas, em função do efeito total, conforme a escala de toxicidade proposta pela IOBC. A maioria dos agrotóxicos avaliados (8 inseticidas, 8 fungicidas e 2 herbicidas se mostrou inócua (classe 1 a ovos e pupas, com redução na eclosão de larvas e efeito total em pupas inferiores a 30%. A exceção se deu para o inseticida óleo mineral, que reduziu a eclosão de larvas em 69,55% quando pulverizado em ovos e proporcionou efeito total em pupas de 36,22%, sendo classificado como levemente nocivo (classe 2 a ovos e pupas de C. externa

  17. SELECTIVITY OF INSECTICIDES TO PREDATORS OF PESTS COTTON PLANT SELETIVIDADE DE INSETICIDAS AOS PREDADORES DAS PRAGAS DO ALGODOEIRO

    Julio Cezar Silveira Nunes

    2007-09-01

    Full Text Available

    The selectivity of insecticides for the complex of predators of the pests of cotton plant was evaluated in field experiment, in Goiânia- Goiás (Brazil, during the crop 1998/99. The experimental design was the randomized blocks with seven treatments and four repetitions (check, clorfluazuron, Bacillus thuringiensis, alanycarb, endosulfan and acephate in two amounts. The samplings were accomplished in beforeapplication, two days, seven and fourteen days after the treatment. For the obtained results (Henderson & Tilton, the products, in the decreasing order of selectivity, were: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    KEY-WORDS: Insecta; insecticides; cotton plant; predators.

    A seletividade de inseticidas para o complexo das pragas do algodoeiro foi avaliada em experimento de campo, em Goiânia (GO, durante a safra 1998/99. O delineamento experimental foi em blocos ao acaso com sete tratamentos testemunha, clorfluazuron, B. thuringiensis, alanycarb, endosulfan e acephate em duas dosagens, em quatro repetições. As amostragens foram realizadas em pré-aplicação; aos dois, sete e quatorze dias após as pulverizações. Pelos resultados obtidos (fórmula de Herderson & Tilton, os produtos, na ordem decrescente de seletividade, foram: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    PALAVRAS-CHAVE: Insecta; inseticidas; algodão; predadores.

  18. Efeito de espécies vegetais em bordadura em cebola sobre a densidade populacional de tripes e sirfídeos predadores.

    Gonçalves Paulo Antonio de Souza; Sousa e Silva Carlos Roberto

    2003-01-01

    Analisou-se a relação entre o efeito do plantio de diferentes espécies vegetais, em bordadura, na cultura da cebola, Allium cepa L, na incidência de Thrips tabaci Lind. e sirfídeos predadores, Toxomerus spp. O experimento foi conduzido na Epagri, EE de Ituporanga, de agosto a dezembro de 1998. Os tratamentos foram cebola em monocultivo; cebola + trigo mourisco (Fagopyrum esculentum Moench); cebola + nabo forrageiro (Raphanus sativus L. var. oleiferus Metzg.); cebola + cenoura (Daucus carota L...

  19. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae) e os predadores Phytoseiulus macropilis (Banks) e Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae)

    Daniele Cristine Hoffmann Schlesener; Adriane Fonseca Duarte; Milton Fernando Cabezas Guerrero; Uemerson Silva da Cunha; Dori Edson Nava

    2013-01-01

    O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L) e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L) sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se...

  20. Local feeding specialization of the red fox (Vulpes vulpes) in response to eastern cottontail (Sylvilagus floridanus) introduction (NW Italy)

    Alessandro Balestrieri; Luigi Remonti; Claudio Prigioni

    2006-01-01

    Abstract To appreciate the influence of the introduction of the Eastern cottontail (Sylvilagus floridanus) on the food habits of the red fox (Vulpes vulpes), between June 1998 and February 2000 fox diet was investigated by means of scat analysis (N=115) in a 250 ha wide Natural Reserve of NW Italy, and compared with data collected in the same area prior to cottontail colonization (1988-1989). Comparison included also the diet of badgers (...

  1. Densità di Lepre (Lepus europaeus) e Silvilago (Sylvilagus floridanus) in ambienti planiziali

    Sandro Bertolino; Perrone, A.; Laura Gola

    2003-01-01

    Il silvilago (Sylvilagus floridanus) è un leporide d?origine nordamericana, introdotto in Italia a partire dal 1966 a scopo venatorio. Attualmente la specie è diffusa soprattutto in Piemonte e nella parte occidentale della Lombardia. Il silvilago potrebbe interferire con l?autoctona lepre comune (Lepus europaeus), anche se i dati al riguardo sono limitati. Nell?autunno-inverno 2002-2003 abbiamo condotto dei censimenti notturni con faro in alcune aree ...

  2. Richness, origin and structure of an Eimeria community in a population of Eastern cottontail (Sylvilagus floridanus) introduced into Italy.

    Bertolino, S; Hofmannová, L; Girardello, M; Modry, D

    2010-07-01

    The composition and structure of a community of Eimeria was investigated in a population of Eastern cottontail (Sylvilagus floridanus) introduced into Italy. Eight Eimeria species were found, of which all but 1 had North American origins and were presumably introduced into Italy together with imported cottontails. The success of cottontails in spreading microparasites is probably related to their massive release for hunting purposes. Nearly all cottontails were infected with at least 1 Eimeria species, with bimonthly prevalence ranging from 0-6.3% (E. leporis) to 42.9-89.3% (E. environ). Bayesian model averaging and multivariate techniques were used to investigate the relationships between the occurrence of each parasite and the structure of the relative community. Among the host parameters, only sex was found to be associated with the prevalence of E. honessi, while the rest of the parameters were only weakly correlated with prevalence and species richness. This indicates that individual phenotypic host characteristics are probably less important than environmental factors in determining levels of parasite prevalence and diversity. The community of Eimeria species was probably structured by competition, with less species co-occurrence than expected under a null hypothesis. This was made evident by the low co-occurrence of E. environ and E. neoirresidua with E. poudrei, E. honessi, and E. maior. PMID:20233489

  3. In vitro cultivation of a zoonotic Babesia sp. isolated from eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts.

    Holman, Patricia J; Spencer, Angela M; Droleskey, Robert E; Goethert, Heidi K; Telford, Samuel R

    2005-08-01

    A Babesia sp. found in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, is the same organism that caused human babesiosis in Missouri and Kentucky, on the basis of morphology and identical small-subunit rRNA (SSU rRNA) gene sequences. Continuous cultures of the rabbit parasite were established from infected blood samples collected from two cottontail rabbits livetrapped on Nantucket Island. HL-1 medium or minimal essential medium alpha medium supplemented with 20% human serum best supported in vitro propagation of the parasite in human or cottontail erythrocytes, respectively. Parasite growth was not sustained in domestic-rabbit erythrocytes or in medium supplemented with domestic-rabbit serum. The cultured parasites were morphologically indistinguishable from the Kentucky human isolate. Transmission electron microscopy revealed similar fine structures of the parasite regardless of the host erythrocyte utilized in the cultures. Two continuous lines of the zoonotic Babesia sp. were established and confirmed to share identical SSU rRNA gene sequences with each other and with the Missouri and Kentucky human Babesia isolates. PMID:16081941

  4. Daytime habitat selection by introduced eastern cottontail Sylvilagus floridanus and native european hare Lepus europaeus in Northern Italy.

    Bertolino, Sandro; Montezemolo, Nicola Cordero di; Perrone, Aurelio

    2011-06-01

    We used radiotelemetry to investigate resting sites habitat selection by introduced eastern cottontail (Sylvilagus floridanus) and native European hare (Lepus europaeus) under sympatric conditions. We tracked 24 hares and 34 cottontails in a protected area of northwestern Italy. Hares were found in different sites every week, while cottontails used the same site for two weeks, and occasionally for longer. It is supposed that this periodic nest switching reduces the risk of predation and parasitism. Hares and cottontails forms were located in different habitats and characterized by dense vegetation cover near the ground. This cover increased from winter to summer in both species, while in autumn it continued to increase in cottontails only, and decreased in hares. Cottontails selected shrubby habitats near the river, and avoided crop fields in all seasons. Hares were more adaptive in their search, using high herbs and shrubs all year round, wheat fields in spring, maize in spring and summer, and stubbles in winter. Arguably, partial niche differentiation is necessary to allow the coexistence of similar species. In our study area, hares and cottontails differentiated in the use of resting sites habitats, presumably so as not to compete in this part of their ecological niche. PMID:21627451

  5. Evaluation of the eastern cottontail Sylvilagus floridanus as an amplifying vertebrate host for Cache Valley virus (Bunyaviridae) in Indiana.

    Blackmore, Carina G M; Grimstad, Paul R

    2008-01-01

    To evaluate the importance of eastern cottontails (Sylvilagus floridanus) as amplifying hosts for Cache Valley virus (CVV), we tested hunter-provided blood samples from northern Indiana for specific neutralizing (N) antibodies against this mosquito-borne bunya-virus. Samples were collected during the winter of 1994-95. Two seronegative eastern cottontails, captured in July 1995, were also infected with CVV by subcutaneous inoculation, and two others were infected by allowing CVV-infected mosquitoes to feed on them. The results indicate that eastern cottontails probably are not important amplifying hosts for CVV. The prevalence of N antibodies against CVV was low (6.0%, n=82) among the hunter-killed animals. Low viremia (<1.8 log10 plaque-forming units/ml) of short duration (1-3 days) were seen in three of four experimentally infected eastern cottontails. The viremias were insufficient for infecting Coquillettidia perturbans, a mosquito species commonly found naturally infected with CVV. PMID:18263839

  6. Bot fly myiasis of the cottontail rabbit, Sylvilagus floridanus mallurus in Virginia with some biology of the parasite, Cuterebra buccata.

    Jacobson, H A; McGinnes, B S; Catts, E P

    1978-01-01

    Twenty four percent of 2,643 cottontail rabbits (Sylvilagus floridanus) collected in Virginia from 1949-1975 showed evidence of Cuterebra parasitism. Occurrence was seasonal with greatest prevalence from July to November. Some Oryctolagus cuniculus, S. palustris and one S. transitionalis also showed Cuterebra myiasis. Juvenile rabbits had higher infection rates (28%) than did adult rabbits 14.5%, P less than .001). Juveniles had greater numbers of larvae per host than adults, with means of 2.14 and 1.62, respectively. Larval development sites were in the genital region of most hosts. Twenty flies reared from wild cottontails were identified as C. buccata. Duration of induced infections in Oryctalagus was 30-33 days. Minimal generation time for C. buccata is concluded to be 11 weeks, allowing up to four generations of flies to occur annually in the southern and one generation to occur in the northern distributional limits of this bot fly. Peromyscus hosts were refractory to C. buccata infections. C. buccata fecundity averaged 1316 eggs. Field observations of adult flies are described. PMID:633518

  7. A new species of Paraheligmonella (Nematoda, Heligmonellidae, parasite of Sylvilagus floridanus (Leporidae from Costa Rica Una especie nueva de Paraheligmonella (Nematoda, Heligmonellidae, parásita de Sylvilagus floridanus (Leporidae en Costa Rica

    María Celina Digiani

    2008-08-01

    Full Text Available Paraheligmonella lamothei n. sp. (Heligmonellidae: Heligmonellinae is described from the small intestine of a cottontail, Sylvilagus floridanus (Allen, 1890 (Leporidae, from Costa Rica. New morphological data on the synlophe and caudal bursa of Paraheligmonella romerolagi (Gibbons and Kumar, 1980, the most similar species, are also provided. The new species differs from P. romerolagi, parasitic of Romerolagus diazi (Ferrari-Pérez, 1893 from Mexico, mainly by the characters of the caudal bursa and the synlophe of the female within the posterior region of body. Males of P. lamothei n. sp. possess a caudal bursa not bell-shaped, with a pattern of type 2-2-1 for right lobe and 2-3 with a tendency to type 2-2-1 for left lobe, whereas males of P. romerolagi possess a bell-shaped caudal bursa, with a pattern of type 2-2-1 with a tendency to type 4-1 for both lobes. In P. lamothei n. sp. rays 3 are slightly longer than rays 2 and the genital cone is poorly developed, whereas in P. romerolagi rays 3 are much longer than rays 2 and the genital cone is large and bulbous. Females of P. lamothei n. sp. possess, at ovejector level, ventral and latero-ventral ridges hypertrophied and dorsal ridges reduced, whereas at the same level, females of P. romerolagi possess lateral ridges hypertrophied and dorsal and ventral ridges reduced. Additionally, hypertrophied cuticular ridges posterior to the vulva are present in P. lamothei n. sp., but absent in P. romerolagi.Se describe Paraheligmonella lamothei n. sp., parásita del intestino delgado de Sylvilagus floridanus (Allen, 1890 (Leporidae de Costa Rica. Se aportan además datos nuevos morfológicos sobre el synlophe y la bolsa caudal de Paraheligmonella romerolagi (Gibbons y Kumar, 1980, la especie morfológicamente más parecida. La especie nueva se diferencia de P. romerolagi, parásita de Romerolagus diazi (Ferrari-Pérez, 1893 de México, principalmente por caracteres de la bursa caudal y el synlophe de la

  8. Plantas transgênicas resistentes a insetos e organismos não-alvo: predadores, parasitóides e polinizadores - doi: 10.5102/ucs.v4i1.23

    Marina Regina Frizzas

    2008-04-01

    Full Text Available Plantas geneticamente modificadas resistentes aos insetos oferecem benefícios à agricultura moderna. No entanto, esta tecnologia pode afetar o controle biológico natural e a biodiversidade por meio de efeitos diretos e indiretos das plantas transgênicas sobre o valor adaptativo e comportamental de predadores, parasitóides, polinizadores e outros artrópodes não-alvo. Neste artigo, são discutidos os impactos ou os efeitos potenciais de plantas transgênicas resistentes a insetos sobre organismos não-alvo, com ênfase em artrópodes predadores, parasitóides e polinizadores, e os principais estudos com plantas transgênicas resistentes a insetos, publicados nos últimos dez anos.

  9. Seletividade fisiológica de inseticidas a Vespidae predadores de Ascia monuste orseis Insecticide physiological selectivity to Vespidae predators of Ascia monuste orseis

    André Luiz Barreto Crespo

    2002-03-01

    Full Text Available Este trabalho objetivou estudar a seletividade dos inseticidas carbaril, deltametrina, paratiom metílico, permetrina e triclorfom em relação a Ascia monuste orseis (Godart (Lepidoptera: Pieridae e a seus predadores Brachygastra lecheguana Latreille e Protonectarina sylveirae (Saussure (Hymenoptera: Vespidae. Por meio de curvas de concentração-mortalidade e das concentrações letais para 90% da população (CL90, calcularam-se os índices de seletividade diferencial (ISD90, de toxicidade relativa, e de tolerância relativa (ITRe90. O paratiom metílico e triclorfom apresentaram seletividade em favor de B. lecheguana (ISD90 = 2,83 e 1,75 e P. sylveirae (ISD90 = 2,95 e 3,59 em relação a A. monuste orseis. Deltametrina e permetrina apresentaram seletividade em favor de P. sylveirae (ISD90 = 1,98 e 2,70 em relação a A. monuste orseis, mas não apresentaram seletividade em favor de B. lecheguana (ISD90 = 0,21 e 0,64. B. lecheguana foi menos tolerante a deltametrina, permetrina e triclorfom do que P. sylveirae (ITRe90 = 9,36, 4,23 e 2,05, e mais tolerante ao carbaril (ITRe90 = 0,14. Os predadores apresentaram tolerância semelhante ao paratiom metílico (ITRe90 = 1,04. As curvas de concentração-mortalidade do carbaril, permetrina e triclorfom em ambos os predadores, de deltametrina em B. lecheguana, e de paratiom metílico em P. sylveirae, apresentaram maiores inclinações do que as curvas em A. monuste orseis.This work aimed to study the selectivity of the insecticides carbaryl, deltamethrin, methyl parathion, permethrin and trichlorfon in relation to Ascia monuste orseis (Godart (Lepidoptera: Pieridae and to their predators Brachygastra lecheguana Latreille and Protonectarina sylveirae (Saussure (Hymenoptera: Vespidae. Based on concentration-response curves and lethal concentrations for 90% of the population (LC90, the differential selectivity index (DSI90, relative toxicity index and relative tolerance index (ReTI90 were calculated

  10. Efeito de inseticidas em insetos predadores em culturas de algodão Effect of insecticides on predator insects associated with cotton

    JOSÉ JANDUI SOARES

    2000-09-01

    Full Text Available Com o objetivo de verificar o efeito de inseticidas em insetos predadores em cultura de algodão (Gossypium hirsutum L., instalaram-se, em 1993-1994, dois experimentos, um no campo, e outro, em laboratório. No experimento realizado no campo, os tratamentos foram: Fipronil 200 SC (75 g/ha de i.a.; Fipronil 800 WDG (64, 80 e 100 g/ha de i.a.; Endosulfan 350 CE (700 g/ha de i.a.; e testemunha. Em laboratório, além das formulações à base de Fipronil foi utilizado o Paration metílico 600 CE (480 g/ha de i.a.. Fipronil foi seletivo para os artrópodes predadores (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea e Doru lineare no campo, e a Cycloneda sanguinea (L., em laboratório, e pode ser recomendado em programas de manejo integrado de pragas na cultura do algodoeiro para o controle de Alabama argillacea (Rueb., e Anthonomus grandis Boh. Endosulfan foi seletivo em relação a Scymnus sp., Geocoris ventralis Thomazini e Doru lineare (Eschs no campo, com uma redução dos insetos inferior a 30%, e o Paration metílico não foi seletivo para C. sanguinea em laboratório.To assess the selectivity of insecticides to predator insects in cotton (Gossypium hirsutum L. crops two, trials, 1993-1994, under field and laboratory conditions were conducted. Under field conditions, the following treatments were compared: Fipronil 200 CS (75 g/ha of a.i.; Fipronil 800 WDG (64, 80 and 100 g/ha of a.i.; Endosulfan 350 EC (700 g/ha of a.i.; and control. Under laboratory conditions, in addition to Friponil, Methyl parathion 600 EC 480 g/ha of a.i. was also tested. Fipronil was selective to predators (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea and Doru lineare under field condition and to Cycloneda sanguinea (L. under laboratory conditions. This product can be used in integrated pest management programs in cotton crops to control Alabama argillacea (Rueb., and Anthonomus grandis Boh. Endosulfan was selective to Scymnus sp., Geocoris ventralis

  11. A new heligmonellid (Nematoda) from Sylvilagus floridanus (Leporidae) in Costa Rica, with some comments on species of Paraheligmonella Durette-Desset, 1971.

    Digiani, María Celina; Carreño, Ramón A; Durette-Desset, Marie-Claude

    2009-06-01

    Paraheligmonella kinsellai n. sp. (Nematoda: Heligmonellidae: Heligmonellinae) is described from the small intestine of a cottontail rabbit Sylvilagus floridanus (Allen, 1890) (Leporidae) from Costa Rica. The new species is similar to P. romerolagi (Gibbons and Kumar, 1980), parasitic in Romerolagus diazi from Mexico and to P. lamothei Digiani, Carreño, and Durette-Desset, 2008, parasitic in Sylvilagus floridanus from Costa Rica, by the characters of the synlophe at mid-body, i.e., 14 cuticular ridges and a single axis of orientation inclined at 30 degrees to the sagittal axis in both sexes. The males of the new species are distinguished from those of P. romerolagi by a caudal bursa that is not bell-shaped, a bursal pattern of type 2-3 with a tendency to 2-2-1, and a genital cone that is not hypertrophied. They are also distinguished from the males of P. lamothei by having the same bursal pattern in both lobes (in P. lamothei the pattern is 2-2-1 on the right lobe and 2-3, with a tendency to 2-2-1, on the left lobe), rays 3 are much longer than rays 2, rays 2 and 3 diverging more proximally, and rays 8 are longer than the dorsal ray. The females of the new species also differ from those of P. lamothei by the shape of the posterior extremity (long and strongly curved vs. short and nearly straight) and by the synlophe at the ovejector level (ridge no. 1' hypertrophied and remaining ridges reduced vs. ventral ridges hypertrophied and dorso-lateral ridges reduced). PMID:19071967

  12. Phytophagy on eucalyptus plants increases the development and reproduction of the predator Podisus nigrispinus (Hemiptera: Pentatomidae = Fitofagia em plantas de eucaliptos aumenta o desenvolvimento e a reprodução do predador Podisus nigrispinus (Hemiptera: Pentatomidae.

    Anderson Mathias Holtz

    2011-04-01

    Full Text Available The effect of plant feeding on biological aspects of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae was evaluated. Nymphs and adults of this predator were fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae on Eucalyptus urophylla plants inthe field or only with pupae of this prey in the laboratory. The development and nymphal survival, as well as the pre-oviposition period, number of egg masses, number, fertility and viability of eggs and the longevity of females of this predator were evaluated. The eucalyptus plants improved the development of P. nigrispinus. This demonstrates that this predator can present higher population growth with eucalyptus plants and T. molitor pupae than in the laboratory (controlled conditions only with this prey. These plants can supply nutrients that can the population growth and efficiency of P. nigrispinus for biological control in eucalyptus plantations.O efeito da alimentação em plantas sobre os aspectos biológicos de Podisus nigrispinus (Hemiptera: Pentatomidae foi avaliado. Ninfas e adultos desse predador foram alimentados com pupas de Tenebrio molitor L. (Coleotpera: Tenebrionidae em plantas de Eucalyptus urophylla no campo ou, apenas, em laboratório. O desenvolvimento e a sobrevivência ninfal desse predador, além do período de pré-oviposição, número de posturas, viabilidade dos ovos e afertilidade e longevidade de fêmeas foram avaliados. A planta de eucalipto proporcionou um incremento no desenvolvimento de P. nigrispinus. Isto demonstra que esse predador pode apresentar maior crescimento populacional com plantas de eucalipto e pupas de T. molitor alimentado com apenas a presa (condições controladas. A planta pode fornecer nutrientes que aumentam o crescimento populacional e a eficiência de P. nigrispinus para o controle biológico em plantios de eucalipto.

  13. Toxicidade de natuneem sobre Tetranychus urticae Koch (Acari: Tetranychidae) e ácaros predadores da família Phytoseiidae Toxicity of the natuneem over the Tetranychus urticae Koch (Acari: Tetranychidae) and mites predators from the family Phytoseiidae

    Hilda Maria Brito; Manoel Guedes Corrêa Gondim Junior; José Vargas de Oliveira; Cláudio Augusto Gomes da Câmara

    2006-01-01

    A toxicidade de diferentes concentrações de Natuneem a Tetranychus urticae Koch e a dois ácaros predadores, Euseius alatus De Leon e Phytoseiulus macropilis (Banks), foi estudada. Foi avaliada a toxicidade sobre ovos, e o efeito residual e repelente, sobre adultos. O tratamento dos ovos consistiu na imersão em diluições de Natuneem por cinco segundos, e o efeito residual e repelente sobre adultos consistiu na imersão de discos de folhas de Canavalia ensiformes (L.) DC. também em diluições por...

  14. Ácaros predadores (Acari em plantas nativas e cultivadas do Estado do Rio Grande do Sul, Brasil Predators mites (Acari in native and cultivated plants of the State of Rio Grande do Sul, Brazil

    Noeli Juarez Ferla

    2002-12-01

    Full Text Available This research was carried out in twenty counties of the following regions in the state of Rio Grande do Sul: Plain, Central Depression, Plateau and Coast Plain to find out the diversity of mite predators in these places. Forty-six vegetable species were sampled, thirty species of miles of the families Anystidae, Ascidae, Cheyletidae, Cunaxidae, Phyloseiidae and Stigmaeidae were mel. The Phytoseiidae were the mite that presented the greatest diversity, being present in the majority of the sample plants. Most of the Phytoseiidae that were met belong to five species of the Euseius Wainstein, 1962 genus, the second genus of this family was Iphiseiodes DeLeon, 1966, with just one species. The Stigmaeidae come up as second family in number but fewer than Phytoseiidae. In this family, the most common mite belong to the Agistemus Sumers, 1960 genus. The biggest of the mites species (13 species, was met in Morus spp. (Moraceae and Tabebuia spp. (Bignoniaceae; Phaseolus vulgaris (Papilionaceae; only one species of the mite was met in Campomanesia spp. (Myrtaceae, Phaseolus vulgaris (Papilionaceae and Rosa spp. (Rosaceae. In Alamanda spp.(Apocinaceae, Ficus spp. (Moraceae, Jacaranda mimosifolia (Bignoniaceae and Solanum spp. (Solanaceae were met mites predators. A dichotomic key is presented to separate the families, genus and species of the mites.

  15. Field and experimental data indicate that the eastern cottontail (Sylvilagus floridanus) is susceptible to infection with European brown hare syndrome (EBHS) virus and not with rabbit haemorrhagic disease (RHD) virus

    Lavazza, A.; P. Cavadini; I. Barbieri; P. Tizzani; A.C. Pinheiro; Abrantes, J.; Esteves, P.J.; G. Grilli; E. Gioia; Zanoni, M.; P. Meneguz; Guitton, J.; S. Merchandeau; M. Chiari; Capucci, L

    2015-01-01

    International audience The eastern cottontail (Sylvilagus floridanus) is an American lagomorph. In 1966, it was introduced to Italy, where it is currently widespread. Its ecological niche is similar to those of native rabbits and hares and increasing overlap in distribution brings these species into ever closer contact. Therefore, cottontails are at risk of infection with the two lagoviruses endemically present in Italy: Rabbit Haemorrhagic Disease virus (RHDV) and European Brown Hare Synd...

  16. Local feeding specialization of the red fox (Vulpes vulpes in response to eastern cottontail (Sylvilagus floridanus introduction (NW Italy

    Alessandro Balestrieri

    2006-03-01

    Full Text Available Abstract To appreciate the influence of the introduction of the Eastern cottontail (Sylvilagus floridanus on the food habits of the red fox (Vulpes vulpes, between June 1998 and February 2000 fox diet was investigated by means of scat analysis (N=115 in a 250 ha wide Natural Reserve of NW Italy, and compared with data collected in the same area prior to cottontail colonization (1988-1989. Comparison included also the diet of badgers (Meles meles, considered as potential competitors for food resources. Alien lagomorphs (mean percent volume, Vm% = 68% represented by far the most exploited resource, only three other food items reaching values of mean percent volume barely higher than 5%. Cottontails frequency of occurrence did not vary according either to season or to their reproductive cycle (II-IX vs. X-I, whilst diet niche breadth varied inversely proportional to the use of this key-resource. Overall fox trophic niche breadth varied from 0.64 in 1988-89 to 0.31 in 1998-00 (B, Levin’s index. These findings led us to consider the feeding habits of the fox in the study area as a result of local specialization of a typical generalist carnivore, according to the predictions of optimal foraging theory. No variation occurred in the badger niche breadth since cottontail introduction, whilst niche overlap between foxes and badgers decreased from 0.59 to 0.13 (O, Pianka’s index, possibly reducing competition for food in summer. Riassunto Specializzazione alimentare a livello locale della Volpe Vulpes vulpes in risposta all’introduzione del Silvilago Sylvilagus floridanus (Italia nord occidentale. Per valutare gli effetti dell’introduzione del Silvilago (Sylvilagus floridanus sul comportamento alimentare della volpe (Vulpes vulpes, nel periodo giugno 1998-febbraio 2000, la dieta del carnivoro è stata definita tramite l’analisi di 115

  17. REFERENCE AND BASELINE HEMATOCRIT MEASURES FOR THE THREATENED NEW ENGLAND COTTONTAIL (SYLVILAGUS TRANSITIONALIS) AND COMPARISON WITH SYMPATRIC EASTERN COTTONTAIL (SYLVILAGUS FLORIDANUS) RABBITS.

    Ryan, S J; Gavard, E J; Cheeseman, A E; Cohen, J B; Whipps, C M

    2016-06-01

    From June 2014 to June 2015, capillary tube collections of blood were obtained concurrently with ear clips of trapped free-ranging, globally vulnerable New England cottontails (NEC; Sylvilagus transitionalis) and eastern cottontail rabbits (EC; Sylvilagus floridanus) in the Hudson Valley region of New York, United States. Species identification (NEC, EC) and sex (NEC) were determined genetically using a mitochondrial DNA assay and Y chromosome marker, respectively. Hematocrit values were obtained using a microhematocrit centrifuge. We provide the reference values 35.15-49.55 (2.5 and 97.5 percentiles) and 90% confidence intervals (CI) [lower: 33.00, 36.08; upper: 46.95, 51.00], for hematocrit of NEC. The mean hematocrit for NEC was 42.35% (SE = 0.58, n = 47) and a comparative contemporaneous mean in the same area for EC [39.96 (SE = 0.81, n = 26)], which was significantly different from NEC (P = 0.02). There was a significant sex difference for NEC [male: 43.99 (SE = 1.02, n = 28); female: 39.92 (SE = 0.78, n = 19), P < 0.0001], though not for EC. PMID:27468046

  18. In vitro host erythrocyte specificity and differential morphology of Babesia divergens and a zoonotic Babesia sp. from eastern cottontail rabbits (Sylvilagus floridanus).

    Spencer, Angela M; Goethert, Heidi K; Telford, Samuel R; Holman, Patricia J

    2006-04-01

    A Babesia sp. isolated from eastern cottontail rabbits (Sylvilagus floridanus) is morphologically similar and genetically identical, based on SSU rRNA gene comparisons, to 2 agents responsible for human babesiosis in the United States. This zoonotic agent is closely related to the European parasite, Babesia divergens. The 2 organisms were characterized by in vitro comparisons. In vitro growth of the rabbit Babesia sp. was supported in human and cottontail rabbit erythrocytes, but not in bovine cells. Babesia divergens was supported in vitro in bovine and human erythrocytes, but not in cottontail rabbit cells. Morphometric analysis classifies B. divergens as a small babesia in bovine erythrocytes, but the parasite exceeds this size in human erythrocytes. The rabbit Babesia sp. is large, the same size in both human or rabbit erythrocytes, and is significantly larger than B. divergens. Eight or more rabbit Babesia sp. parasites may occur within a single erythrocyte, sometimes in a floret array, unlike B. divergens. The erythrocyte specificity and morphological differences reported in this study agree with previous in vivo results and validate the use of in vitro methods for characterization of Babesia species. PMID:16729690

  19. Toxoplasmosis Silvestre: relación presa-predador y papel funcional de pequeños felinos silvestres neotropicales en la transmisión -resumen-

    William A Cañón-Franco

    2014-12-01

    Full Text Available Pequeños felinos neotropicales se ubican en el tope de la cadena alimenticia y‚ aunque críticamente amenazados‚ ocho especies de felinos son relativamente abundantes en el continente americano‚ sin embargo‚ pocos estudios biológicos sobre la circulación de agentes infecciosos han sido realizados. Para determinar el papel epidemiológico que cumplen las poblaciones de felinos silvestres en la transmisión de la Toxoplasmosis en la región sur de Brasil (estado de Rio Grande do Sul‚ fue determinada la frecuencia molecular de Toxoplasma gondii. La amplificación del marcador ITS1 fue posible en 31 de los 90 felinos analizados (34‚4%‚ de las especies Puma yagouaroundi (9/22‚ Leopardus geoffroyi (6/22‚ Leopardus tigrinus (8/28‚ Leopardus wiedii (6/10‚ Leopardus pardalis (1/1 y Leopardus colocolo (1/7. Dos nuevos genotipos de T. gondii fueron caracterizados por PCR-RFLP (Lw#31Tn - Py#21Sm y el genotipo Py#56Br previamente descrito en gatos domésticos‚ perros y chigüiros del Brasil. Adicionalmente‚ fue parcialmente caracterizado el genotipo I (Py#36Sm‚ evidenciando la circulación ambiental y su posible relación en la presentación de toxoplasmosis ocular en humanos. Los resultados demuestran que pequeños felinos silvestres tienen un papel importante en la transmisión de la toxoplasmosis en la interfase animales domésticos-silvestres‚ por lo que no se descarta la posible hibridación con genotipos urbanos. La carnivoría y las relaciones presa-predador son fundamentales en la transmisión horizontal de Toxoplasma. Aunque existan variaciones biogeográficas y estacionales en la dieta de los felinos silvestres‚ aproximadamente 40% a 80%‚ corresponde a pequeños mamíferos no voladores (marsupiales y roedores. El estudio de la dinámica de transmisión en diferentes niveles tróficos es de gran interés para la comprensión ecológica del ciclo silvestre de este parásito. Esta propuesta se fundamenta en evaluar

  20. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Rafael Braga da Silva

    2012-06-01

    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae? O percevejo Supputius cincticeps (Stål (Hemiptera, Pentatomidae é um predador encontrado em várias regiões brasileiras, que possui atributos desejáveis como agente de controle natural ou em

  1. Killer whales attack on South American sea lion associated with a fishing vessel: predator and prey tactics Ataque de orcas a un lobo marino sudamericano asociado a un barco pesquero: tácticas del predador y la presa

    M. Florencia Grandi

    2012-11-01

    Full Text Available Interactions between killer whales and sea lions are widely known. This work describes the predator-prey behaviour of killer whales and South American sea lion associated with a trawling fishery. In Argentina the predatory behaviours of killer whales and anti-predatory behaviours of South American sea lions have been described from costal based observations, but predator-prey behaviour of these species is poorly known at open waters. Here we describe a killer whale group attack on an individual sea lion, using a video recorded from a trawling vessel and an interview of the ship captain. This predator-prey behaviour represents an example of the complexity of interactions between marine mammals and fisheries along the Patagonian coast.Las interacciones entre orcas y lobos marinos son ampliamente conocidas. Este trabajo describe el comportamiento predador-presa entre orcas y un lobo marino sudamericano asociados a un barco pesquero de arrastre. Particularmente en Argentina el comportamiento predatorio de las orcas y el anti-predatorio de los lobos marinos comunes fueron descriptos mediante observaciones costeras, pero se sabe poco sobre el comportamiento de estas especies en aguas abiertas. En este trabajo, a partir de un video grabado desde un barco de pesca arrastrero, junto con la entrevista del capitán del barco, se describe cómo un grupo de orcas ataca a un lobo marino Sudamericano. Este comportamiento predador-presa representa un ejemplo sobre la complejidad de las interacciones entre mamíferos marinos y las pesquerías a lo largo de la costa patagónica.

  2. Pathology and epizootiology of Dirofilaria scapiceps (Leidy, 1886) (Nematoda: Filarioidea) in Sylvilagus floridanus (J.A. Allen) and Lepus americanus erxleben.

    Bartlett, C M

    1984-07-01

    Dirofilaria scapiceps was found between the synovial sheath and tendons, i.e., within the tendon sheath, in the ankle region of eastern cottontail rabbits (Sylvilagus floridanus) and snowshoe hares (Lepus americanus). In cottontail rabbits, tendons and sheaths appeared normal and all worms were adults. Only one (4%) of 24 infected rabbits contained dead worms. All female worms were gravid in rabbits killed in late winter or early spring. Microfilaremias in rabbits were high (approximately 30-100 microfilariae/60 microliter blood) and of long duration (at least 8-28 mo), and rabbits were considered normal hosts of D. scapiceps. In some snowshoe hares, tendons and sheaths also appeared normal; however, in other hares a chronic proliferative tenosynovitis, characterized by fibrinous exudate, hyperplasia and hypertrophy of the intima and inflammatory cell (predominantly lymphocytes and plasma cells) infiltration of the intimal and fibrous layers of the synovial sheath led to encapsulation of worms. Dead subadult, dead adult, and live adult worms were found in the ankles of hares; 86 (46%) of 186 infected hares contained some or only dead worms. Fibrosis commonly occurred around dead worms. Dead subadults were also found in subcutaneous connective tissues over the trunk of the body. Degenerate embryos and amorphous material were observed in uteri of some female worms in hares killed in late winter or early spring. Few (1-5 microfilariae/60 microliter blood) or no microfilariae were observed in the peripheral blood of hares and microfilaremias were of short duration (less than 8 mo). Microfilariae in hares are probably trapped and destroyed in the chronic inflammatory lesions in the tendon sheaths since normal, degenerate, and calcified microfilariae were observed in the capsules around adult worms. Some microfilariae might also be destroyed in lymph nodes. Although D. scapiceps can be maintained within snowshoe hare populations, hares are considered abnormal hosts of D

  3. DIVERSITY AND ABUNDANCE OF PREDACEOUS ARTHROPODS ASSOCIATED WITH DIFFERENT COTTON CULTIVARS DIVERSIDADE E ABUNDÂNCIA DE ARTRÓPODES PREDADORES ASSOCIADOS A DIFERENTES CULTIVARES DE ALGODOEIRO

    Francisco Jorge Cividanes

    2010-10-01

    -style: normal; font-weight: normal; line-height: 120%; text-decoration: none;" lang="pt-BR" align="JUSTIFY">Com o objetivo de estudar a abundância e a diversidade de artrópodes predadores associados à cultura do algodoeiro e analisar a influência de fatores meteorológicos, interações entre inimigos naturais e a dinâmica populacional de coccinelídeos associados à sua principal presa, o pulgão Aphis gossypii, um experimento foi realizado na região de Ipameri (GO, no Campus da Universidade Estadual de Goiás. O delineamento experimental utilizado foi o de blocos ao acaso, com cinco tratamentos, constituídos pelas cultivares DeltaOPAL, FMX 966, FMX 993, FMX 910 e NuOPAL, em quatro repetições. Dentre os artrópodes observados na cultura do algodoeiro, os coccinelídeos e as aranhas foram os mais abundantes, nas cultivares avaliadas. As aranhas ocorreram em todo o ciclo do algodoeiro. Já os coccinelídeos aumentaram sua população, gradativamente, até 55 DAE, apresentando pico populacional aos 34 DAE, coincidindo com o pico populacional dos pulgões A. gossypii. Dentre os coccinelídeos observados nas cultivares em estudo, verificou-se que Scymnus spp. foi o gênero mais abundante no algodoeiro. Os pentatomídeos e forficulídeos predominaram dos 99 aos 128 dias após a emergência do algodão, período que corresponde à maior densidade de pragas-alvo destes insetos. Verificou-se que não houve influência dos fatores meteorológicos e nem interaçã

  4. Densità di Lepre (Lepus europaeus e Silvilago (Sylvilagus floridanus in ambienti planiziali

    Sandro Bertolino

    2003-10-01

    Full Text Available Il silvilago (Sylvilagus floridanus è un leporide d?origine nordamericana, introdotto in Italia a partire dal 1966 a scopo venatorio. Attualmente la specie è diffusa soprattutto in Piemonte e nella parte occidentale della Lombardia. Il silvilago potrebbe interferire con l?autoctona lepre comune (Lepus europaeus, anche se i dati al riguardo sono limitati. Nell?autunno-inverno 2002-2003 abbiamo condotto dei censimenti notturni con faro in alcune aree protette lungo il fiume Po (Breme, Fontanetto Po, Pobietto e il torrente Orba (Predosa, Monferrino. I censimenti erano effettuati percorrendo con automezzo itinerari prefissati. Il territorio ai lati del percorso era illuminato con faro alogeno (100 W, segnando periodicamente l?ampiezza della fascia illuminata. L?area effettivamente censita è stata in seguito verificata mediante GIS ArcView, usando una cartografia informatizzata d?uso del suolo (1:10.000. L?uso reale del suolo al momento del censimento (esempio: arato, grano o stoppie è stato verificato durante sopralluoghi diurni. Per ogni area sono state condotte tre repliche del censimento. Di seguito sono riportate per ogni località le densità rilevate (individui/Km² rispettivamente di lepre comune e silvilago. Breme (1,7; 32,8, Fontanetto Po (0; 4,4, Pobietto (0,3; 13,9, Predosa (1,1; 19,5, Monferrino (29,6; 110,4. Solo l?area di Monferrino è risultata ospitare una popolazione di lepri con densità corrispondente a territori ad alta vocazionalità. La zona censita si trova a cavallo tra una riserva regionale e una ZRC della Provincia di Alessandria. Nella stessa area il silvilago presenta una densità elevata, ma comunque inferiore ai valori massimi riportati negli Stati Uniti. Nelle altre aree sono state osservate pochissime lepri. Tale scarsità è probabilmente legata alla presenza di popolazioni relitte e habitat non sempre idonei. Il silvilago, per quanto non abbondante come a Monferrino, è presente con popolazioni

  5. Toxicidade letal e subletal do nim sobre o pulgão-verde e seu predador Eriopis connexa Lethal and sublethal toxicity of neem on green peach aphid and on its predator Eriopis connexa

    Madelaine Venzon

    2007-05-01

    Full Text Available O objetivo deste trabalho foi avaliar, em laboratório, os efeitos do extrato de semente de nim sobre uma praga da pimenteira, o pulgão-verde Myzus persicae (Sulzer, e seu predador Eriopis connexa (Germar. Folhas de pimenteira foram imersas em solução aquosa de extrato de semente de nim (1% de azadiractina a 0,5%, 1%, em acefato (0,75 g L-1 e em água. Fêmeas do pulgão foram transferidas para essas folhas e, após seis dias, avaliou-se a população final. Larvas de quarto ínstar do predador foram colocadas em plantas de pimenteira infestadas com pulgões e pulverizadas com solução aquosa de nim a 0,25 e, 0,5%, em acefato (0,75 g L-1 e em água. Após 48 horas, as larvas foram transferidas para tubos de plástico e alimentadas com pulgões. A mortalidade larval, a viabilidade pupal e a emergência de adultos foram avaliadas. A população de pulgões foi significativamente menor em folhas tratadas com nim e com acefato do que nas tratadas com água. A mortalidade de larvas do predador foi maior em plantas tratadas com acefato do que com nim. No entanto, somente 9,1 e 10% das larvas em plantas tratadas com nim a 0,25% e a 0,5%, respectivamente, formaram pupas e não houve emergência de adultos. Apesar do potencial do nim em reduzir a população de M. persicae, o produto apresenta efeitos nocivos a E. connexa.The aim of this work was to assess, in laboratory, the effects of neem seed extract on chilli pepper pest, the green peach aphid Myzus persicae (Sulzer and on its predator Eriopis connexa (Germar. Chilli pepper leaves were treated with an aqueous solution of neem seed extract (1% of azadiractin at concentrations of 0.5 and 1.0%, using acephate (0.75 g L-1 and water. Aphid females were transferred to treated leaves and after six days the aphid population was checked. Fourth-instar larvae of E. connexa were placed on pepper seedlings infested with aphids and sprayed with an aqueous solution of neem at 0.25 and 0.5%, using acephate (0

  6. Artrópodes fitófagos e predadores associados em 20 acessos Luffa sp. em sistema orgânico Phytophagous and predators arthropods associated in 20 accesses of Luffa sp in organic system

    Germano Leão Demolin Leite

    2011-12-01

    Full Text Available Os objetivos desta pesquisa foram verificar os artrópodes fitófagos e seus predadores em 20 acessos de bucha vegetal Luffa sp. (Cucurbitaceae, a distribuição destes no dossel das plantas em cultivo orgânico e a produção de frutos dos acessos. O experimento foi em blocos casualizados com 20 tratamentos e quatro repetições. Os tratamentos foram os acessos P159, P304, P466, P03, P570, P569, P467, P30, P446, P495, P125, P263, P644 e P32, provenientes da Embrapa (CENARGEN, DF, e P01, P02, P04, P05, P06 e P07, obtidos em Porteirinha-MG. As parcelas foram compostas por quatro plantas de Luffa sp. A maior abundância de Diabrotica speciosa (Germar (Coleoptera: Chrysomelidae foi observada nas folhas do acesso P467 em referência aos demais acessos de Luffa sp. Trigona spinipes (Fabricius (Hymenoptera: Apidae foi mais observada nas flores dos acessos P01, P03, P30, P32, P263 e P569 e menos abundantes nos acessos P05, P125, P159, P304, P446 e P570. Os acessos de Luffa sp. com maior número de frutos/planta foram P01, P03, P05, P06, P07, P30, P32, P125, P263, P446 e P570. Os predadores aranhas e Coccinellidae (Coleoptera bem como o fitófago Cicadellidae (Hemiptera preferiram atacar a face adaxial, sendo que não se detectou diferença estatística entre as faces para os demais artrópodes. T. spinipes esteve mais presente na parte apical do dossel das plantas. Com esses resultados, o acesso P06 é o mais indicado para o cultivo, pois foi um dos que apresentou maiores produtividades e menores taxas de ataque de insetos.The objectives of this research were to verify the phytophagous arthropods and their predators in 20 accesses of vegetable loofah Luffa sp. (Cucurbitaceae, the distribution of the canopy of the plants in organic system and the production of fruits of the accesses. The experiment was in randomized blocks designed with 20 treatments and four replicates. The treatments were the accesses P159, P304, P466, P03, P570, P569, P467, P30, P446

  7. Reproductive characteristics of the predator Podisus nigrispinus fed with an insect resistant soybean variety Características reprodutivas do predador Podisus nigrispinus alimentado com variedade de soja resistente a insetos

    Fausto da Costa Matos Neto

    2002-07-01

    17, e lagartas de A. gemmatalis, criadas em folhas desta cultivar. Avaliou-se a longevidade das fêmeas, períodos de pré-oviposição, oviposição e pós-oviposição, número de ovos e de posturas/fêmea, peso dos ovos, intervalo entre posturas, número de ovos/postura, porcentagem de ovos eclodidos, número de ninfas/fêmea e número total de presas mortas/fêmea de P. nigrispinus. A maioria das características avaliadas mostrou resultados semelhantes entre tratamentos, exceto o período de oviposição, que foi mais longo para fêmeas criadas no genótipo resistente que no susceptível, e a porcentagem de fêmeas que ovipositaram antes de morrer, que foi menor na IAC 17. Além disso, o genótipo IAC 17 causou maior mortalidade de fêmeas de P. nigrispinus no início de sua fase adulta e distribuição mais uniforme da produção de ovos ao longo do período adulto desse predador. Por outro lado, os resultados não sugerem efeito desse genótipo na prole do predador.

  8. Does predator benefits prey? Commensalism between Corynoneura Winnertz (Diptera, Chironomidae and Corydalus Latreille (Megaloptera, Corydalidae in Southeastern Brazil O predador beneficia sua presa? Comensalismo entre Corynoneura Winnertz (Diptera, Chironomidae e Corydalus Latreille (Megaloptera, Corydalidae no Sudeste do Brasil

    Marcos Callisto

    2006-06-01

    retiradas do material regurgitado por Corydalus. É importante observar que fixados aos predadores de grande tamanho corporal as presas se tornam livres de outros predadores além de serem transportados por eles.

  9. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae) e os predadores Phytoseiulus macropilis (Banks) e Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae) Effects of neem on tetranychus urticae Koch (Acari: Tetranychidae) and the predators Phytoseiulus macropilis (Banks) and Neoseiulus Californicus (Mcgregor) (Acari: phytoseiidae)

    Daniele Cristine Hoffmann Schlesener; Adriane Fonseca Duarte; Milton Fernando Cabezas Guerrero; Uemerson Silva da Cunha; Dori Edson Nava

    2013-01-01

    O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L) e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L) sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se...

  10. Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) within citrus orchards in Florida: species distribution, relative and seasonal abundance within trees, associated vines, and ground cover plants.

    Childers, Carl C; Ueckermann, Eduard A

    2014-10-01

    Seven citrus orchards on reduced- to no-pesticide spray programs were sampled for predacious mites in the families Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) in central and south central Florida. Inner and outer canopy leaves, fruit, twigs, and trunk scrapings were sampled monthly between August 1994 and January 1996. Open flowers were sampled in March from five of the sites. Two species of eupalopsellid mites (Exothorhis caudata Summers and Saniosulus harteni (van-Dis and Ueckermann)) were identified from 252 specimens collected within citrus tree canopies within the seven citrus orchards of which 249 were E. caudata. Only two E. caudata were collected from ground cover plants within five of the seven orchards. Eight species of Stigmaeidae were identified from 5,637 specimens: Agistemus floridanus Gonzalez, A. terminalis Gonzalez, Eustigmaeus arcuata (Chandhri), E. sp. near arcuata, E. segnis (Koch), Mediostigmaeus citri (Rakha and McCoy), Stigmaeus seminudus Wood, and Zetzellia languida Gonzalez were collected from within citrus tree canopies from seven orchard sites. Agistemus floridanus was the only species in either family that was abundant with 5,483 collected from within citrus tree canopies compared with only 39 from vine or ground cover plants. A total of 431 samples from one or more of 82 vines and ground cover plants were sampled monthly between September 1994 and January 1996 in five of these orchards and one or more eupalopsellids or stigmaeids were collected from 19 of these plants. Richardia brasiliensis (Meg.) Gomez had nine A. floridanus from 5 of 25 samples collected from this plant. Solanum sp. had five A. floridanus from three samples taken. Both eupalopsellid and stigmaeid species numbers represented orchards were on full herbicide programs and ground cover plants were absent. Agistemus floridanus was more abundant in the citrus orchards with on-going or recent herbicide programs compared with orchards having well-developed ground

  11. NOTA PRÉVIA SOBRE ALGUNS DADOS BIONÔMICOS DO PREDADOR DE ABELHAS Apiomerus nigrilobus Stal, 1872 OBTIDOS EM CONDIÇÕES DE LABORATÓRIO PRELIMINARY NOTE ON BIONOMIC DATA OF THE HONEYBEE PREDATOR Apiomerus nigrilobus STAL, 1872 GOTTEN IN LABORATORY CONDITIONS

    Érico Amaral

    2007-09-01

    Full Text Available

    Esta nota prévia apresenta alguns dados bionômicos do predador de abelhas Apiomerus nigrilobus Stal, 1872 obtidos sob condições de laboratório. O estudo foi realizado no Departamento de Entomologia da Escola Superior de Agricultura “Luiz de Queiroz” da Universidade do Estado de São Paulo, no período de março de 1972 a dezembro de 1973. O ciclo biológico médico constatado para este predador foi de 246 dias. Os autores apresentam três quadros que resumem os dados obtidos.

    This preliminary note presents some bionomics data of the honeybee predator Apiomerus nigrilobus Stal, 1872 obtained in laboratory. The study was conducted at the Agricultural College ";Luiz de Queiroz” U.S.P. — São Pau1o, Brazil, from March 1972 to December 1973. The evolutionary cycle of this predator, on an average, is 246 days. A table is presented showing the results.

  12. Controle biológico do ácaro rajado com ácaros predadores fitoseídeos (Acari: Tetranychidae, Phytoseiidae em culturas de pepino e morango Biological control of the two-spotted spider mite (Acari: Tetranychidae, Phytoseiidae in cucumber and strawberry crops

    M.A. Watanabe

    1994-04-01

    Full Text Available O ácaro rajado, Tetranychus urticae Koch, é considerado uma das principais pragas de hortaliças e várias outras culturas no Brasil, em áreas onde um considerável volume de acaricidas é anualmente empregado no seu controle. O objetivo deste trabalho foi testar a viabilidade técnica do emprego dos fitoseídeos Amblyseius idaeus (Denmark & Muma e Phytoseudus macropilis (Banks, comum ente encontrados no Brasil, no controle de T. urticae em pepino e morangueiro em Jaguaríúna,SP. Utilizou-se o delineamento experimental em blocos casualizados, com 4 repetições e 4 tratamentos (T1-T4 para o pepino e 5 tratamentos para o morangueiro (T1-T5: T1, testemunha; T2, pulverizações semanais de Malation para a exclusão de predadores nativos; T3, liberações periódicas de A.idaeus; T4, liberações periódicas de P.macropilis; T5, pulverizações semanais de avermectina para a exclusão de ácaros fitófagos e predadores nativos. Apenas A.idaeus se estabeleceu na cultura de pepino, reduzindo significativamente a população de T. urticae. Ambas espécies de predadores se estabeleceram na cultura do morango e reduziram significativamente a população de T.urticae.The two-spotted spider mite, Tetranychus urticae Koch, is considered one of the main pests of horticultural and other crops in Brazil, in areas where a considerable volume of acaricides is annually used for its control. The objective of this work was to test the technical viability of using phytoseiids Amblyseius idaeus (Denmark & Muma and Phytoseudus macropilis (Banks, commonly found in Brazil, to control T .urticae in cucumber and strawberry crops in Jaguaríúna,SP. A randomized complete block design was used, with 4 replicates and 4 treatments for cucumber (T1-T4 and 5 treatments for strawberry crops (T1-T5: T1, control; T2, weekly sprays of malathion for exclusion of native predators; T3, periodical releases of A.idaeus; T4, periodical releases of P. macropilis; T5, weekly sprays of

  13. Field and experimental data indicate that the eastern cottontail (Sylvilagus floridanus) is susceptible to infection with European brown hare syndrome (EBHS) virus and not with rabbit haemorrhagic disease (RHD) virus.

    Lavazza, Antonio; Cavadini, Patrizia; Barbieri, Ilaria; Tizzani, Paolo; Pinheiro, Ana; Abrantes, Joana; Esteves, Pedro J; Grilli, Guido; Gioia, Emanuela; Zanoni, Mariagrazia; Meneguz, Pier; Guitton, Jean-Sébastien; Marchandeau, Stéphane; Chiari, Mario; Capucci, Lorenzo

    2015-01-01

    The eastern cottontail (Sylvilagus floridanus) is an American lagomorph. In 1966, it was introduced to Italy, where it is currently widespread. Its ecological niche is similar to those of native rabbits and hares and increasing overlap in distribution brings these species into ever closer contact. Therefore, cottontails are at risk of infection with the two lagoviruses endemically present in Italy: Rabbit Haemorrhagic Disease virus (RHDV) and European Brown Hare Syndrome Virus (EBHSV). To verify the susceptibility of Sylvilagus to these viruses, we analyzed 471 sera and 108 individuals from cottontail populations in 9 provinces of north-central Italy from 1999 to 2012. In total, 15-20% of the cottontails tested seropositive for EBHSV; most titres were low, but some were as high as 1/1280. All the cottontails virologically tested for RHDV and EBHSV were negative with the exception of one individual found dead with hares during a natural EBHS outbreak in December 2009. The cottontail and the hares showed typical EBHS lesions, and the EBHSV strain identified was the same in both species (99.9% identity). To experimentally confirm the diagnosis, we performed two trials in which we infected cottontails with both EBHSV and RHDV. One out of four cottontails infected with EBHSV died of an EBHS-like disease, and the three surviving animals developed high EBHSV antibody titres. In contrast, neither mortality nor seroconversion was detected after infection with RHDV. Taken together, these results suggest that Sylvilagus is susceptible to EBHSV infection, which occasionally evolves to EBHS-like disease; the eastern cottontail could therefore be considered a "spill over" or "dead end" host for EBHSV unless further evidence is found to confirm that it plays an active role in the epidemiology of EBHSV. PMID:25828691

  14. Effect of plant diversification on abundance of South American tomato pinworm and predators in two cropping systems Efeito da diversificação de plantas na abundância da traça-do-tomateiro e predadores em dois sistemas de cultivo

    Maria A Medeiros

    2009-09-01

    do tomate e de predadores. O experimento foi conduzido em condições de campo, no Distrito Federal, de julho a outubro de 2004. O desenho experimental foi em blocos ao acaso, com três repetições e no arranjo fatorial 3 x 2 [três níveis de diversificação cultural: tomate em monocultivo, tomate consorciado com coentro, e consórcio tomate com coentro e botão-de-ouro e dois sistemas de cultivo: orgânico e convencional]. Cada parcela experimental tinha 80 plantas de tomateiro, sendo os insetos-praga e artrópodes predadores semanalmente coletados em cinco plantas/parcela. Tuta absoluta (Meyr. foi a espécie-praga mais comum em ambos os sistemas de cultivo. O tomate consorciado como coentro e botão-de-ouro, no sistema de cultivo orgânico, apresentou menor abundância e maior diversidade de pragas, e maior abundância e diversidade de artrópodes predadores, principalmente aos 80 dias após o transplantio do tomate, coincidindo com o pico populacional da T. absoluta (ovos e adultos. Os predadores mais abundantes foram aranhas, joaninhas e formigas. As aranhas foram abundantes e uniformemente distribuídas em ambos os sistemas. As joaninhas apareceram tardiamente no sistema orgânico, no período de florescimento do coentro. As formigas foram mais abundantes no sistema convencional.

  15. Efeito de espécies vegetais em bordadura em cebola sobre a densidade populacional de tripes e sirfídeos predadores Effect of different species of border plants on the population density of thrips and syrphids predators in onion crop

    Paulo Antonio de Souza Gonçalves

    2003-12-01

    Full Text Available Analisou-se a relação entre o efeito do plantio de diferentes espécies vegetais, em bordadura, na cultura da cebola, Allium cepa L, na incidência de Thrips tabaci Lind. e sirfídeos predadores, Toxomerus spp. O experimento foi conduzido na Epagri, EE de Ituporanga, de agosto a dezembro de 1998. Os tratamentos foram cebola em monocultivo; cebola + trigo mourisco (Fagopyrum esculentum Moench; cebola + nabo forrageiro (Raphanus sativus L. var. oleiferus Metzg.; cebola + cenoura (Daucus carota L., cv. Nantes e cv. Brasília; cebola + milho (Zea mays L.; cebola + rúcula (Eruca sativa L. + vegetação espontânea. O plantio de diferentes espécies vegetais em bordadura não provocou diferenças significativas na incidência de tripes e sirfídeos predadores. A produtividade comercial de bulbos de cebola foi similar em sistema de monocultivo e diversificado, sugerindo ser possível adotar tais sistemas sem perdas em rendimento.The effect of planting different species of border plants on the population density of thrips (Thrips tabaci Lind, and syrphid predators (Toxomerus spp., population density were evaluated at EPAGRI, Santa Catarina State, Brazil. The research was carried out from August to December 1998. The treatments were onion monoculture; onion intercropped with buck wheat (Fagopyrum esculentum Moench (Poligonaceae; onion intercropped with fodder radish (Raphanus sativus L. var. oleiferus Metzg.; onion intercropped with carrots (Daucus carota L. Nantes and Brasília cultivars; onion intercropped with maize (Zea mays L.; onion intercropped with Eruca sativa and weed. The onion thrips and syrphid predators population density were similar in onion monoculture and policulture. The yields were similar in onion monoculture and policulture, suggesting the possibility to intercrop onion without losses.

  16. Mortalidade do ácaro predador Neoseiulus californicus (Acari: Phytoseiidae em testes de toxicidade residual de inseticidas e acaricidas usuais em pomáceas Mortality of predatory mite Neoseiulus californicus (Acari: Phytoseiidae in residual toxicity persistence tests

    Marcelo Gustavo Ruiz

    2008-12-01

    . Azimphos-methyl foi o produto que menos afetou a sobrevivência do ácaro predador. Os inseticidas testados, usados na região do "Alto Valle del Río Negro y Neuquén" para o controle de Cydia pomonella, praga-chave das culturas de pomáceas, apresentaram baixa toxicidade sobre N. californicus.Phytoseiid mites, mainly Neoseiulus californicus (McGregor, are important biological control agents of Tetranychidae pest mites in pip fruit crops in the region known as "Alto Valle del Río Negro y Neuquén", Argentina. We assessed the mortality of N. californicus when exposed to residues of the insecticides azimphos-methyl, carbaryl and cyfluthrin, as well as the acaricides cyhexatin and propargite. Pear plants were sprayed up to dip-point with pesticides in their recommended label concentrations. One, 3, 6 and 10 days after application (DAA, leaves were collected from treated plants and used to establish experimental arenas. Five adult laboratory-reared N. californicus specimens were transferred into each arena which contained Southern cattail pollen as food source. Experimental arenas were kept at 25 ± 2 ºC, 60 ± 10% RH and a photoperiod of 14 hours. Mite mortality was assessed 24 hours after the confinement. The completely randomized design was adopted for data statistical analysis, mortality means were compared by Dunnett's test (p < 0.05. Progression of pesticide's effect decline was submitted to regression analysis. On 1 and 3 DAA mean mortality in all of the treatments was significantly different from that of the water-treated control. On the sixth DAA, propargite, cyhexatin and cyfluthrin treatments caused about 30% mortality, while mortality levels in treatments with azimphos-methyl and carbaryl were statistically similar to that of control treatment. On the tenth DAA, mortality in none of the pesticide treatments differed from that of control. All of the pesticide treatments presented progressive decline throughout the experimental period, being significant (p < 0

  17. Efeito de doses e de refúgio sobre a seletividade de inseticidas a predadores e parasitóides de pragas de soja Effect of doses and of refuge on the insecticide selectivity to predators and parasitoids of soybean insect pests

    Ivan Carlos Corso

    1999-09-01

    Full Text Available Com o objetivo de avaliar o impacto sazonal de alguns inseticidas sobre predadores e parasitóides de pragas da cultura da soja, instalou-se um experimento com delineamento de blocos ao acaso, constando de oito tratamentos e três repetições, no campo experimental da Embrapa-Centro Nacional de Pesquisa de Soja, em Londrina, PR. Os tratamentos consistiram de aplicações de inseticidas para o controle da lagarta-da-soja (pulverizados em 21/1/93 e percevejos (4/3/93. A técnica empregada para levantamento da população de insetos foi a do método do choque, que consiste na aplicação de um inseticida de alto impacto sobre a comunidade de insetos presente nas plantas, sua coleta sobre panos estendidos no solo, e sua posterior identificação e contagem em laboratório. A análise da variância revelou não haver diferenças significativas entre as populações de predadores, himenópteros e dípteros encontrados, nos diferentes tratamentos estudados. Também n��o foram verificados os fenômenos de ressurgência de pragas ou o aparecimento de elevadas populações de pragas secundárias.A field experiment was conducted to evaluate seasonal effect of insecticides on predators and parasitoids of soybean insect pests. A randomized block design was used, with three replications, and the experiment was set up in the experimental station of the Embrapa-Centro Nacional de Pesquisa de Soja, located at Londrina, PR, Brazil. Treatments consisted of insecticide application to control the velvetbean caterpillar (1/21/1993 or the stink bug complex (3/4/1993. Insect population was sampled through the shock technique, consisting of an application of a broad spectrum insecticide over the plants to be sampled, being the insects collected on cloths placed on the ground, and transferred to the laboratory to be identified and counted. Statistical analysis revealed no differences on the populations of species of predators, diptera or himenoptera as a group. No

  18. Funktionelle Analyse von Blochmannia floridanus, dem primären Endosymbionten der Rossameise Camponotus floridanus

    Stoll, Sascha

    2009-01-01

    Ameisen der Gattung Camponotus beherbergen bakterielle Symbionten der Gattung Blochmannia in spezialisierten Zellen des Mitteldarms (Blochmann, 1882; Buchner, 1965; Sauer, 2000; Schröder et al., 1996). Die Genomsequenzierung dieser Symbionten zeigte, dass Blochmannia, ähnlich den Symbionten von Blattläusen, hauptsächlich Gene der Aminosäurebiosynthese beibehalten hat (Degnan et al., 2005; Gil et al., 2003). Die Relevanz dieser nahrungsaufwertenden Funktion konnte experimentell bestätigt werde...

  19. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae e os predadores Phytoseiulus macropilis (Banks e Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae Effects of neem on tetranychus urticae Koch (Acari: Tetranychidae and the predators Phytoseiulus macropilis (Banks and Neoseiulus Californicus (Mcgregor (Acari: phytoseiidae

    Daniele Cristine Hoffmann Schlesener

    2013-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.The aim of the present study was to evaluate the efficiency of control and adverse effects of two neem based products: Azamax TM (Azadirachtin A/B 12g/L and Neemseto TM (Azadirachtin A/B, Nimbin and Salanin 2,389 g/L over two-spotted spider mite Tetranychus urticae and the predators Phytoseiulus macropilis and Neoseiulus californicus in laboratory. Effects over the mortality, fecundity, eggs and biological persistence of the two-spotted spider mite when treated with neem based products were evaluated. For the phytoseiids the effects on mortality and fecundity were evaluated. The maximum mortality of two-spotted spider mites rates observed were 89.7% and 91.5% for Azamax TM and Neemseto TM respectively, on the 0.5% concentration after reapplying the product on the seventh day. Adverse effects were also observed over the fecundity and viability of the eggs when treated with

  20. Seletividade de acaricidas e inseticidas a ácaros predadores (Acari: Phytoseiidae encontrados em seringueira no centro-oeste do Brasil Side-effect of acaricides and insecticides to predatory mites (Acari: Phytoseiidae found in rubber-trees in mid-west Brazil

    Noeli Juarez Ferla

    2006-04-01

    Full Text Available Euseius concordis (Chant e Neoseiulus anonymus (Chant & Baker são ácaros predadores da família Phytoseiidae comumente encontrados em seringueira (Hevea brasiliensis Muell. Arg. em Mato Grosso, região centro-oeste do Brasil. Este trabalho foi realizado para verificar o efeito de acaricidas e inseticidas-acaricidas empregados em plantações de seringueira, e outros que teriam potencial para serem empregados contra insetos e ácaros considerados pragas dessa cultura, sobre E. concordis e N. anonymus. Utilizou-se o método residual de pulverização em superfície, recomendado como padrão pelo Grupo de Trabalho "Pesticidas e Artrópodes Benéficos", da Organização Internacional de Controle Biológico e Integrado de Plantas e Animais Nocivos/Seção Regional do Paleártico Oeste. Duas concentrações de cada um dos seguintes ingredientes ativos foram utilizadas: acefato, dicofol, endosulfan, formetanate, metomil, monocrotofós, óxido de fenbutatin e propargite. Uma das concentrações utilizadas foi uma média daquelas sugeridas pelos fabricantes para o controle de ácaros e insetos fitófagos presentes em outras culturas, uma vez que nenhum dos produtos testados tem registro para o uso em seringueira e a outra correspondeu à cerca de um terço da primeira. Endosulfan a 320ppm, dicofol a 100ppm e óxido de fenbutatin a 100 e 320ppm foram inócuos a E. concordis, enquanto que endosulfan a 320ppm e dicofol a 100ppm foram inócuos a N. anonymus. Acefato, formetanate e monocrotofós, nas concentrações testadas, foram nocivos às duas espécies.Euseius concordis (Chant and Neoseiulus anonymus (Chant & Baker are predatory mites of the family Phytoseiidae commonly found on rubber trees (Hevea brasiliensis Muell. Arg. in the State of Mato Grosso, in the mid-west Brazil. This work was conducted to verify the effect of acaricides and insecticides-acaricides occasionally used in rubber tree plantations, and other products that could be used against

  1. Composição faunística de insetos predadores em fragmento florestal e em área de hortaliças na região de Jaboticabal, Estado de São Paulo - DOI: 10.4025/actascibiolsci.v25i2.2015 Faunal composition of predator insects in forest fragment and area of vegetables in Jaboticabal region, state of São Paulo, Brazil - DOI: 10.4025/actascibiolsci.v25i2.2015

    Luciano Kenji Sakemi

    2003-04-01

    Full Text Available Efetuou-se um levantamento populacional em área de fragmento florestal e em área de hortaliças, entre novembro de 1996 a fevereiro/1998, visando determinar as espécies de insetos predadores e a influência de fatores abióticos. A amostragem foi efetuada semanalmente por meio de armadilha luminosa, aplicando-se aos resultados análise faunística e correlação simples com temperatura, umidade relativa e precipitação. No fragmento florestal foi observado maior semelhança na abundância de espécies do que na área de hortaliças, mas neste hábitat capturou-se maior número de indivíduos (95%. As espécies Metius sp., Polpochila impressifrons (Dej., Eulissus sp. e Doru sp. foram predominantes nas duas áreas, evidenciando a importância dessas espécies como predadoras de pragas de hortaliças. Arthrostictus speciosus (Dej. e Leptotrachelus sp. predominaram no fragmento florestal, o mesmo ocorrendo com Paederus sp. na área de hortaliças. Esta espécie deve preferir locais abertos e quentes, enquanto A. speciosus e Leptotrachelus sp. podem estar melhor adaptadas para locais escuros e úmidos de florestasA population survey was carried out in a forest fragment and in an area of vegetables, from November/1996 to February/1998, aiming to determine the predator insect species and the influence of abiotic factors. The samples were taken weekly by light traps. The results were evaluated using faunistic analysis and simple correlation with temperature, relative humidity and rainfall. In the forest fragment higher similarity in the abundance of species was observed comparing to the area of vegetables, but the largest number of captured individuals (95% occurred in this last habitat. Metius sp., Polpochila impressifrons (Dej., Eulissus sp. and Doru sp. were predominant species in both areas, evidencing they may play an important role as pest predators in areas of vegetables. Arthrostictus speciosus (Dej. and Leptotrachelus sp. predominated in

  2. O olhar predador: A arte e a violência do olhar

    Angélica Lima Cruz

    2012-10-01

    Full Text Available Na primeira parte deste ensaio é abordada a forma como a teoria feminista tem reflectido a prática artística, constituindo‑se como um contributo para o conhecimento sobre as relações entre artes visuais, sexualidades e poder. Depois de uma breve apresentação do tratamento do nu feminino e do corpo da mulher nos diversos movimentos artísticos ao longo da história da arte ocidental, é abordado o lugar, ou não lugar, que coube às mulheres na arte, nomeadamente na pintura.

  3. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria

    Fabrizio Silvano; Camilla Acquarone; Marco Cucco

    2000-01-01

    Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spr...

  4. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria

    Fabrizio Silvano

    2000-09-01

    Full Text Available Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spring and in autumn along 51 transects which were 10 km long on average. Road deaths were extracted from our 6715 records regarding 85 species of mammals, birds and reptiles found dead along the roads. The distribution area expanded markedly from the 1980s, and the expansion persisted between 1996 and 1997, while in 1998 the area failed to increase further, settling at around 620-660 km². The species is not present, at the moment, in the entire Apennine sector nor in the eastern and southern plains. The densities reach maximum values of 2.5-2.75 individuals/10 ha. From the road-death data we found a progressive increase of the Eastern cottontail, its proportion of the total mammals rising from 2.2% in 1995 to 3.7% in 1996 and 6.0% in 1997.

  5. Observações sobre a ocorrência de Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae na costa do Rio de Janeiro, Brasil Remarks about the Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae occurrence in Rio de Janeiro coast, Brazil

    Lydia M. S. Oliveira

    2006-12-01

    Full Text Available Os espécimes foram coletados na Baía de Sepetiba, Rio de Janeiro no inverno. Sua distribuição era conhecida para Off Cape Lookout, Carolina do Norte até a Flórida, Golfo do México, Canal de Yucatan, Honduras, Antilhas, Venezuela e Brasil (Alagoas, Sergipe e Bahia.The specimens were collected in Sepetiba Bay during the winter. Their distribution was formerly known from Off Cape Lookout, North Carolina until Florida, Gulf of Mexico, Yucatan Channel, Honduras, Antilles, Venezuela and Brazil (Alagoas, Sergipe and Bahia.

  6. Tick infestations of the eastern cottontail rabbit (Sylvilagus floridanus) and small rodentia in northwest Alabama and implications for disease transmission.

    Cooney, Joseph C; Burgdorfer, Willy; Painter, Martin K; Russell, Cynthia L

    2005-12-01

    Studies were conducted over a four-county area of northwest Alabama to determine the association of eastern cottontail rabbits with Dermacentor variabilis, the eastern United States vector of Rocky Mountain spotted fever. A secondary objective was to compare infestations of this tick on rabbits with infestations on commonly encountered rodent species as a means of determining the relative importance of each in the disease transmission cycle. These epidemiologic surveys were conducted in response to reported fatal cases of Rocky Mountain Spotted Fever in two counties of the study area. From 202 eastern cottontail rabbits, 3,956 ticks were collected. Of this total, 79.87% were Haemphysalis leporispalustris, 9.15% Amblyomma americanum, 8.22% Ixodes dentatus, and 2.76% D. variabilis. Only immature stages of D. variabilis were collected from cottontail rabbits. Ticks were collected on rabbits in all months except November, and only one specimen was taken in January. Based on the average number of ticks per host collected in each month, April was the peak month for D. variabilis and I. dentatus. High values for H. leporispalustris also occurred at this time, but even higher values occurred in October and December. The heaviest infestation of A. americanum occurred during the month ofAugust and coincides with the activity period for the larvae of this species. Two hundred sixty-nine of the smaller Rodentia, comprising 13 species, yielded 264 ticks, all D. variabilis, and all but two were immature stages. Five rodent species, Microtus ochragaster Orozomys palustris, Peromyscus gossypinus, Peromyscus leucopus, and Sigmodon hispidus accounted for 95.83% of the ticks collected, and appeared to be preferred hosts for D. variabilis; all five had higher infestation levels per host than did the eastern cottontail rabbit. Data on host relationships in association with seasonal activity are presented. PMID:16599149

  7. 77 FR 71759 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition To List the Prairie...

    2012-12-04

    ... cottontail (Sylvilagus floridanus mearnsi) in Illinois and western Indiana as endangered or threatened... (Sylvilagus floridanus mearnsi) in Illinois and western Indiana be listed as endangered or threatened species..., small mammals, including eastern cottontail (Sylvilagus floridanus), voles (Microtus pennsylvanicus...

  8. Seletividade de inseticidas a três Vespidae predadores de Dione juno juno (Lepidoptera: Heliconidae) Selectivity of insecticides to three Vespidae predators of Dione juno juno (Lepidoptera: Heliconidae)

    MARCELO FIALHO DE MOURA; MARCELO PICANÇO; ALFREDO HENRIQUE ROCHA GONRING; CLÁUDIO HORST BRUCKNER

    2000-01-01

    Dentre os insetos que atacam o maracujazeiro, Dione juno juno (Lepidoptera: Heliconidae) é considerada a praga-chave. Estudou-se a seletividade dos inseticidas fentiom, cartape, malatiom e deltametrina a Dione juno juno, em relação às vespas predadoras Polybia fastidiosuscula, Polybia scutellaris e Protonectarina sylveirae (Hymenoptera: Vespidae). Estimaram-se as curvas concentração-mortalidade e mediante o uso da concentração letal do inseticida em 90% dos indivíduos (CL90) calcularam-se os ...

  9. Seletividade de inseticidas a três Vespidae predadores de Dione juno juno (Lepidoptera: Heliconidae Selectivity of insecticides to three Vespidae predators of Dione juno juno (Lepidoptera: Heliconidae

    MARCELO FIALHO DE MOURA

    2000-02-01

    Full Text Available Dentre os insetos que atacam o maracujazeiro, Dione juno juno (Lepidoptera: Heliconidae é considerada a praga-chave. Estudou-se a seletividade dos inseticidas fentiom, cartape, malatiom e deltametrina a Dione juno juno, em relação às vespas predadoras Polybia fastidiosuscula, Polybia scutellaris e Protonectarina sylveirae (Hymenoptera: Vespidae. Estimaram-se as curvas concentração-mortalidade e mediante o uso da concentração letal do inseticida em 90% dos indivíduos (CL90 calcularam-se os índices de seletividade diferencial e índices de tolerância. A deltametrina foi seletiva à P. scutellaris e P. fastidiosuscula e medianamente seletiva à P. sylveirae e o cartape foi medianamente seletivo às três espécies de vespas predadoras. O malatiom foi seletivo a P. sylveirae e medianamente seletivo a P. fastidiosuscula. As vespas predadoras P. fastidiosuscula eP. scutellaris foram mais tolerantes a deltametrina e ao fentiom do que P. sylveirae, enquanto o P. fastidiosuscula e P. sylveirae toleraram mais o cartape do que P. scutellaris. O malatiom foi mais tolerado pela espécie P. sylveirae do que por P. fastidiosuscula e P. scutellaris.Among insects that attack passion fruit, Dione juno juno (Lepidoptera: Heliconidae is considered the most dangerous plague. The selectivity of the insecticides fenthion, cartap, malathion and deltamethrin to the predatory wasps Polybia fastidiosuscula, Polybia scutellaris and Protonectarina sylveirae (Hymenoptera: Vespidae was studied based on these insecticide toxicities to their prey Dione juno juno. Concentration-mortality regression lines were obtained and the estimated lethal concentration of insecticide to 90% (LC90 of the individuals were used for the calculation of the differential selectivity index and tolerance index. Deltamethrin was selective in favor of P. scutellaris and P. fastidiosuscula and showed intermediate selectivity to P. sylveirae, while cartap showed intermediate selectivity to all three species of predatory wasps. Malathion was selectivite to P. sylveirae and showed intermediate selectivity to P. fastidiosuscula. The predatory wasps P. sylveirae and P. fastidiosuscula were more tolerant to cartap than P. scutellaris and P. sylveirae was more tolerant to malathion than P. fastidiosuscula and P. scutellaris.

  10. Seletividade de agrotóxicos utilizados em pomares de pêssego a adultos do predador Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Rodolfo Vargas Castilhos

    2011-03-01

    Full Text Available A seletividade de dezesseis agrotóxicos utilizados na produção integrada e convencional de pêssego foi avaliada sobre a fase adulta de Chrysoperla externa através de bioensaios de exposição residual conduzidos em laboratório (temperatura de 25±1ºC, umidade relativa 70±10% e fotofase 14 horas, utilizando-se de metodologia prescrita pela "International Organization for Biological Control" (IOBC. Os agrotóxicos (% de ingrediente ativo na calda azoxystrobina (0,016, captana (0,192, dodina (0,126, folpete (0,200, mancozebe (0,256, mancozebe + oxicloreto de cobre (0,140 + 0,096, tebuconazole (0,320, abamectina (0,002, óleo mineral 1 (2,420, óleo mineral 2 (1,920, dicloreto de paraquate (0,300 e glifosato (1,440 foram inócuos; deltametrina (0,002 foi levemente nocivo e dimetoato (0,160, fosmete (0,160 e malationa (0,240 foram nocivos a adultos de C. externa.

  11. Estudio comparado de la alimentación entre algunos predadores de alto nivel trófico de la comunidad marina del norte y centro de patagonia

    Koen Alonso, M.

    1999-01-01

    The comparative analysis of the food habits between top predator allows the evaluation of how these species use the trophic resources. They also make possible the study of potentially competitive relationships and the role of these predators in the regulation and structure of the community. The marine community of northern and central Patagonia is structured on the tri-trophic system composed by the Argentine anchovy (Engraulis anchoita), the Argentine shortfin squid (Illex argent...

  12. Modernidade seletiva e estado predador: primeira aproximação às revoltas populares em maputo de 2008 e 2010

    Héctor Guerra Hernández

    2014-06-01

    Full Text Available Nos dias 5 de fevereiro de 2008 e 1 e 2 de setembro de 2010 Maputo foi o cenário de duas revoltas populares de grandes proporções, cada uma delas motivadas pelo descontentamento generalizado da população frente a reajustes econômicos, impostos pelo governo, que aumentariam significativamente o custo da vida dos maputenses. Essa situação mobilizou tanto a elite política como intelectual a desenvolver apressadamente algumas hipóteses que pudessem explicar esses eventos. Neste texto pretende-se contrastar essas hipóteses para, em seguida, propor uma análise que possibilite um entendimento mais abrangente a respeito das causas que teriam levado à população a sair às ruas. Parte-se da constatação que o estado seria o produto histórico de violentos conflitos, cujas sequelas podem ser percebidas no receio e desconfiança que a população teria desenvolvido, e a partir da qual o estado seria percebido menos como um facilitador e mais como um concorrente invasivo e predatório.

  13. Biología y comportamiento de polistes erythrocephalus ltr. (hyrnenoptera: vespidae), predador del "gusano cachón" de la yuca erinnyis ello l. (lepidoptera: sphingidae)

    Martin P., Carlos A.; Bellotti, Anthony C.

    2010-01-01

    El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7°) tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m) depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar). No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con e...

  14. Biología y comportamiento de Polistes erythrocephalus Ltr. (Hyrnenoptera: vespidae), predador del "Gusano cachón" de la yuca Erinnyis ello L. (Lepidoptera: Sphingidae)

    Bellotti Anthony C.; Martin P. Carlos A.

    1986-01-01

    El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7°) tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m) depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar). No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con el ...

  15. Biología y comportamiento de Polistes erythrocephalus Ltr. (Hyrnenoptera: vespidae, predador del "Gusano cachón" de la yuca Erinnyis ello L. (Lepidoptera: Sphingidae

    Bellotti Anthony C.

    1986-03-01

    Full Text Available El ciclo de vida de Polistes erythrocephalus (latitud 3° 3D' N, longitud 76° 22' 21" W; 965 m.s.n.m.; 23.7° tiene una duración de 110 días, oscilando entre 91 y 131 días. La capacidad de predación en jaulas de malla (2.5 x 2.5 x 2.5 m depende del número de larvas. El consumo diario máximo fue de 1.3, el mínimo de 0.08 y el promedio de O.5larvasde E. ello (11 y 111 instar. No se encontraron machos en nidos menores de 50 celdas y en mayores de 50 celdas el número de machos incrementa con el crecimiento del nido llegando a ser casi igual al de las hembras. De 412 nidos el17 % estaban parasitados por Oxysarcodexia sp., (Diptera: Sacophagidae siendo el enemigo natural más frecuente de larvas y pupas de Polistes. Este insecto es a su vez parasitado por los himenópteros Pachyneuron sp. (Pteromalidae y Brachymeria conica Ashmead (Chalcididae.The duration average of the cycle life of P. erythrocephalus (Iatitude 3°30'N, longitude 76°22'21"W; 965 altitude; 23.7°C was 110 days and ranged between91 and 131 days. Predatory capacity depends on the number of larva. The maximum number of larva consumed by one Polistes larva per day was 1.3 and the minimum was 0.08 with a mean of 0.5 hornworm larva (11 y III instar. Males were not found in nests with less than 50 cells. In nests with more than 50 cells the number of males increase with increasing number of cells until they equal the number of female. Of the 412 nests examined, 17 % were attached by Oxysarcodexia sp [(Diptera: sarcophaqidae. This insect is in turn parasitized by several hymenoptera such as Pachyneuron sp (Pteromalidae y Brachymeria conica (Chalcididea.

  16. Toxoplasmosis Silvestre: relación presa-predador y papel funcional de pequeños felinos silvestres neotropicales en la transmisión -resumen-

    William A Cañón-Franco; N López-Orozco; A F Malheiros; M Santos-Filho; Gennari, S.M.

    2014-01-01

    Pequeños felinos neotropicales se ubican en el tope de la cadena alimenticia y‚ aunque críticamente amenazados‚ ocho especies de felinos son relativamente abundantes en el continente americano‚ sin embargo‚ pocos estudios biológicos sobre la circulación de agentes infecciosos han sido realizados. Para determinar el papel epidemiológico que cumplen las poblaciones de felinos silvestres en la transmisión de la Toxoplasmosis en la región sur de Brasil (estado de Rio Grande do Sul)‚ fue determina...

  17. Field study of the relationship between skin-sensitizing antibody production in the cottontail rabbit, Sylvilagus floridanus, and infestation by the rabbit tick, Haemaphysalis leporispalustris (Acri: Ixodidae).

    McGowan, M J; Camin, J H; McNew, R W

    1979-10-01

    The resistance of cottontail rabbits to tick feeding appears correlated with the rabbits' development of skin-sensitizing antibodies. Resistance appeared to be greatest in adult rabbits which had been repeatedly infested with ticks. Rabbits with little exposure to ticks, usually the young cottontails, showed little or no skin-sensitizing antibody present in their blood and usually had relatively high tick loads when compared with adult rabbits. Models used to interpret the data show promise as tools for predicting tick population fluctuations and, perhaps, incidence of vector borne disease outbreaks. The existence of resistance to tick attachment has important implications for the host-parasite relationship. The research lends support to the hypothesis that the resistance may function as a homeostatic regulatory mechanism capable of maintaining the size of the tick population in equilibrium with the size of the rabbit population. In this way, host resistance may be advantageous to the parasite as well as to the host. PMID:512764

  18. Effect of doses and of refuge on the insecticide selectivity to predators and parasitoids of soybean insect pests; Efeito de doses e de refugio sobre a seletividade de inseticidas a predadores e parasitoides de pragas de soja

    Corso, Ivan Carlos; Gazzoni, Decio Luiz; Nery, Manoel Eugenio [EMBRAPA, Londrina, PR (Brazil). Centro Nacional de Pesquisa de Soja]. E-mail: gazzoni@cnpso.embrapa.br

    1999-09-15

    A field experiment was conducted to evaluate seasonal effect of insecticides on predators and parasitoids of soybean insect pests. A randomized block design was used, with three replications, and the experiment was set up in the experimental station of the EMBRAPA-Centro Nacional de Pesquisa de Soja, located at Londrina, PR, Brazil. Treatments consisted of insecticide application to control the velvet bean caterpillar (1/21/1993) or the stink bug complex (3/4/1993). Insect population was sampled through the shock technique, consisting of an application of a broad spectrum insecticide over the plants to be sampled, being the insects collected on cloths placed on the ground, and transferred to the laboratory to be identified and counted. Statistical analysis revealed no differences on the populations of species of predators, diptera or himenoptera as a group. No effects of pest resurgence or secondary pest outbreaks were also observed. (author)

  19. Aplicação de formulação do fungo predador de nematóides Monacrosporium thaumasium (Drechsler, 1937 no controle de nematóides de bovinos

    Alves P.H.

    2003-01-01

    Full Text Available A viabilidade de uma formulação do fungo Monacrosporium thaumasium (Drechsler, 1937 foi avaliada no controle biológico de nematóides parasitos gastrintestinais de bovinos. Dois grupos de sete bezerras cada, mestiças Holandês ´ Zebu, de quatro a seis meses de idade, foram colocados em pastagens de Cynodon dactilon. No grupo A, cada animal recebeu 20g de pellets (formulação granulada de M. thaumasium via oral, duas vezes por semana, durante quatro meses, com início na estação chuvosa (outubro, 2001. No grupo B (controle, as bezerras não receberam nenhum tratamento. As contagens de ovos por grama de fezes (OPG e das larvas infectantes encontradas na pastagem do grupo B foram significativamente maiores (P<0,05 do que as do grupo A e a diferença entre o OPG dos animais dos grupos A e B, no final do experimento, foi de 88,8%. O gênero Cooperia foi o mais prevalente em ambas as pastagens. Conclui-se que a aplicação de pellets de M. thaumasium na dosagem e periodicidade de aplicação usadas foi eficiente no controle de nematóides parasitos gastrintestinais de bovinos.

  20. Control of bovine gastrointestinal nematode parasites using pellets of the nematode-trapping fungus Monacrosporium thaumasium Controle de nematóides parasitos gastrintestinais de bovinos com pellets do fungo predador de nematóides Monacrosporium thaumasium

    Jackson Victor de Araújo

    2004-04-01

    Full Text Available The viability of a formulation of the fungus Monacrosporium thaumasium associated with ivermectin was evaluated for the biological control of bovine gastrointestinal nematode parasites. Four groups of five calves each were placed in pastures with a stocking rate of 1.6 animal/hectare. In group 1 (control, the calves did not receive any treatment. In group 2, each animal received 20g of pellets of M. thaumasium orally twice a week during a six-month period that began with the onset of the rainy season (October 23, 2000. In group 3, each animal received 20g of pellets of M. thaumasium orally twice a week during the same period as 2, as well as two strategic treatments with ivermectin (200 mcg/kg on May 10, 2001 and July 5, 2001. In group 4, the animals were treated with ivermectin alone as described for group 3. EPG counts for group 1 were significantly greater (PA viabilidade de uma formulação do fungo Monacrosporium thaumasium associada com ivermectina foi avaliada no controle biológico de nematóides parasitos gastrintestinais de bovinos. Quatro grupos de cinco bezerros foram colocados em pastagens com uma taxa de lotação de 1,6 animal/hectare. No grupo 1 (controle, os bezerros não receberam nenhum tratamento. No grupo 2, cada animal recebeu 20 g de pellets de M. thaumasium, via oral, duas vezes por semana e durante um período de seis meses que começou na estação chuvosa (23 de outubro, 2000. No grupo 3, cada animal recebeu 20g de pellets de M. thaumasium, via oral, duas vezes por semana e durante o mesmo período do grupo 2, assim como dois tratamentos estratégicos com ivermectina (200 mcg/kg em 10 de maio de 2001 e em 5 de julho de 2001. No grupo 4, os animais foram tratados somente com ivermectina como descrito no grupo 3. As contagens de OPG dos animais do grupo 1 foram significativamente maiores (P< 0,01 do que os animais dos grupos 2 e 3 e a diferença no final do experimento foi próxima de 100%. Os OPGs dos animais do grupo 4 permaneceram altos até o primeiro tratamento estratégico com ivermectina. Os resultados do grupo 1 e 4 diferiram significativamente (P< 0,05 daqueles dos grupos 2 e 3 a partir de dezembro de 2000. Concluiu-se que a aplicação de pellets de M. thaumasium nesta dosagem e periodicidade de aplicação tornaram os tratamentos anti-helmínticos desnecessários.

  1. Seletividade de agrotóxicos utilizados em pomares de pêssego a adultos do predador Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae Selectivity of pesticides used in peach orchard on adults of Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae

    Rodolfo Vargas Castilhos

    2011-03-01

    Full Text Available A seletividade de dezesseis agrotóxicos utilizados na produção integrada e convencional de pêssego foi avaliada sobre a fase adulta de Chrysoperla externa através de bioensaios de exposição residual conduzidos em laboratório (temperatura de 25±1ºC, umidade relativa 70±10% e fotofase 14 horas, utilizando-se de metodologia prescrita pela "International Organization for Biological Control" (IOBC. Os agrotóxicos (% de ingrediente ativo na calda azoxystrobina (0,016, captana (0,192, dodina (0,126, folpete (0,200, mancozebe (0,256, mancozebe + oxicloreto de cobre (0,140 + 0,096, tebuconazole (0,320, abamectina (0,002, óleo mineral 1 (2,420, óleo mineral 2 (1,920, dicloreto de paraquate (0,300 e glifosato (1,440 foram inócuos; deltametrina (0,002 foi levemente nocivo e dimetoato (0,160, fosmete (0,160 e malationa (0,240 foram nocivos a adultos de C. externa.The selectivity of sixteen pesticides used in integrated and conventional peach production was evaluated on adults of Chrysoperla externa (Hagen,1861 (Neuroptera: Chrysopidae under bioassays in laboratory conditions (temperature of 25±1ºC, relative humidity 70±10% and 14 hours photophase, using the "International Organization for Biological Control" (IOBC methodology. The pesticides (% active ingredient azoxystrobin (0.016, captan (0.192, dodine (0.126, pholpet (0.200, mancozeb (0.256, mancozeb + cooper oxichloride (0.140 + 0.096, tebuconazole (0.320, abamectin (0.002, mineral oil 1 (2.420, mineral oil 2 (1.920, paraquat dichloride (0.300 and gliphosate (1.440 were harmless; deltametrin (0.002 was slightly harmful and dimetoate (0.160, phosmet (0.160 and malathion (0.240, were harmful to C. externa adults.

  2. Does predator benefits prey? Commensalism between Corynoneura Winnertz (Diptera, Chironomidae) and Corydalus Latreille (Megaloptera, Corydalidae) in Southeastern Brazil O predador beneficia sua presa? Comensalismo entre Corynoneura Winnertz (Diptera, Chironomidae) e Corydalus Latreille (Megaloptera, Corydalidae) no Sudeste do Brasil

    Marcos Callisto; Michael D.C. Goulart; Pablo Moreno; Martins, Rogério P.

    2006-01-01

    Commensalism between Corydalus Latreille, 1802 (Megaloptera, Corydalidae) and Corynoneura Winnertz, 1846 (Diptera, Chironomidae, Orthocladiinae) larvae was recorded in Indaiá stream, at 1,380 m a.s.l. (Parque Nacional da Serra do Cipó, 19º-20ºS, 43º-44ºW) and in the headwaters of São Francisco river, at 1,300-1,700 m a.s.l. (Parque Nacional da Serra da Canastra, 20º00'-20º30'S, 46º15'-47º00'W), in Minas Gerais state, Brazil. Seventy eight Corydalus larvae (range 22-88 mm) were sampled: 61 in ...

  3. Influence of the webbing produced by Oligonychus ilicis (McGregor) (Acari: Tetranychidae) on associated predatory phytoseiids; Influencia da teia de Oligonychus ilicis (McGregor) (Acari: Tetranychidae) sobre os fitoseideos predadores associados

    Franco, Renato A. [Bioagri Laboratorios Ltda., Piracicaba, SP (Brazil)], e-mail: r.franco@bioagri.com.br; Reis, Paulo R. [Empresa de Pesquisa Agropecuaria de Minas Gerais (EPAMIG), Belo Horizonte, MG (Brazil). Ecocentro], e-mail: paulo.rebelles@epamig.ufla.br; Zacarias, Mauricio S. [EMBRAPA Cafe, Lavras, MG (Brazil)], e-mail: zacarias@epamig.ufla.br; Oliveira, Daniel C. [Universidade Federal de Lavras (UFLA), MG (Brazil)

    2010-01-15

    Oligonychus ilicis (McGregor) is among those mite species that can cause damage to coffee plants (Coffea spp.). Species of Phytoseiidae acari are considered the most important and studied predatory mites. The objective of this study was to evaluate the effects of the webbing produced by O. ilicis on its predation by females of the phytoseiids Iphiseiodes zuluagai Denmark and Muma, Euseius citrifolius Denmark and Muma and Amblyseius herbicolus (Chant). Four bioassays were conducted, with three treatments and ten replicates. Each replicate consisted of 25 O. ilicis per experimental unit (a leaf disc of Coffea arabica) according to the tested developmental stage, in independent experiments. To spin the web, 15 adult females were put on each experimental unit for 24h; females were then removed, leaving only the web, and predators and prey to be tested were introduced. Predation was assessed after 24h. In the presence of webbing, the consumption of eggs, larvae and nymphs by I. zuluagai and eggs and larvae by E. citrifolius was lower. For A. herbicolus, egg predation was lower, but larval predation did not vary significantly and predation of nymphs and adults was higher in the presence of webbing. Predators as a whole were more efficient consuming larvae regardless of the presence of webbing. Considering the stages of O. ilicis altogether, webbing reduced the predation potential of I. zuluagai and E. citrifolius, but not of A. herbicolus. (author)

  4. In vitro evaluation of nematophagous fungi patogenicity against nematode of domestic animals/
    Avaliação in vitro da patogenicidade de fungos predadores de nematóides parasitos de animais domésticos

    Alvimar José da Costa; Giane Serafim da Silva; Regina Célia Cândido; Jaime Maia dos Santos; Arlete Silveira Maia; Érika Barbosa Neves Graminha

    2001-01-01

    Biological control is a promising alternative for the control of pre-parasitic stages through the action of nematophagous fungi’s. The present study evaluated in vitro the patogenicity of both Arthrobotrys musiformis and A. conoides fungi on “infective larvae (or L3 state larvae)” of Haemonchus contortus, L3 larvae of Ancylostoma spp. And larvated eggs of the nematode Ascaridia galli. Nine groups were formed: six treated groups (G1A and G2A: L3 of H. contortus; G1B and G2B: L3 of Ancylostoma ...

  5. In vitro evaluation of nematophagous fungi patogenicity against nematode of domestic animals/ Avaliação in vitro da patogenicidade de fungos predadores de nematóides parasitos de animais domésticos

    Alvimar José da Costa

    2001-08-01

    Full Text Available Biological control is a promising alternative for the control of pre-parasitic stages through the action of nematophagous fungi’s. The present study evaluated in vitro the patogenicity of both Arthrobotrys musiformis and A. conoides fungi on “infective larvae (or L3 state larvae” of Haemonchus contortus, L3 larvae of Ancylostoma spp. And larvated eggs of the nematode Ascaridia galli. Nine groups were formed: six treated groups (G1A and G2A: L3 of H. contortus; G1B and G2B: L3 of Ancylostoma spp.; G1C and G2C: larvated eggs of A. galli, being that G1 with A. musiformis and G2 with A. conoides and three untreated groups (G3A, G3B and G3C: larvae of H. contortus, Ancylostoma spp. And eggs of A. galli, respectively, without fungi. Each treatment had ten repetitions (ten Petri dishes with an average of 120 larvae of H. contortus and 200 larvae of Ancylostoma spp. and, approximately, 100 larvated A. galli eggs. The results showed A. musiformis plundered 66% and 94% of Ancylostoma spp. L3 larvae and H. contortus L3 larvae, respectively. While that A. conoides plundered 51,7% and 89,4% at the same larvae. The nematophagous fungi evaluated have not presented any predation type on A. galli larvated eggs. Afterwards, both are promising fungi as to their use for biological control of parasitic helminths of animal hosts.O controle biológico é uma alternativa promissora no controle dos estágios pré-parasitários de helmintos, por meio da ação de fungos nematófagos. Com este propósito, o presente estudo avaliou in vitro a patogenicidade dos fungos Arthrobotrys musiformis e A. conoides sobre larvas infectantes de Haemonchus contortus, Ancylostoma spp. e ovos larvados de Ascaridia galli. Foram utilizados nove grupos: seis tratamentos (G1A e G2A: L3 de H. contortus; G1B e G2B: L3 de Ancylostoma spp.; G1C e G2C: ovos larvados de A. galli, com A. musiformis (G1 e A. conoides (G2, respectivamente e três testemunhos (G3A, G3B e G3C: larvas de H. contortus, Ancylostoma spp. e ovos de A. galli, respectivamente, na ausência do fungo. Cada tratamento constou de dez repetições (placas de Petri, de 90mm de diâmetro, com média de 120 larvas de H. contortus, 200 larvas de Ancylostoma spp. e média de 100 ovos de A. galli. Os resultados demostraram que A. musiformis predou 66,33% e 94,44% das larvas infectantes de Ancylostoma spp. e H. contortus, respectivamente. Enquanto que A. conoides predou 51,76% e 89,39% das mesmas larvas. Os fungos nematófagos avaliados não apresentaram predação sobre ovos larvados de A. galli. Portanto, ambos os fungos mostraram-se promissores quanto a sua utilização no biocontrole desses helmintos parasitos de animais domésticos.

  6. Seletividade de alguns agrotóxicos em uso na citricultura ao ácaro predador Neoseiulus californicus (McGregor (Acari: Phytoseiidae Residual toxicity of the main pesticides recommended in citrus orchards on predaceous mite Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae

    Marcos Zatti da Silva

    2006-08-01

    Full Text Available Objetivou-se avaliar o efeito dos principais agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor, em condições de laboratório, por tratar-se de um fitoseídeo com grande potencialidade para ser utilizado no controle dos ácaros fitófagos na cultura. O método de bioensaio adotado foi o de contato direto e residual. Folhas de citros da variedade Pêra, contendo 25 fêmeas adultas de N. californicus procedentes de uma criação-estoque, foram pulverizadas em torre de Potter. Avaliaram-se a mortalidade do ácaro 72 horas após a aplicação e o efeito dos produtos na viabilidade dos ovos. Quanto à seletividade, conforme proposta da "Organização Internacional para o Controle Biológico e Integrado de Plantas e Animais Nocivos" (IOBC, os produtos foram classificados como: classe 1 inócuo (E99%, clorfenapyr, dicofol e pyridaben. N. californicus mostrou-se tolerante a diversos agrotóxicos, o que viabiliza sua utilização, juntamente com produtos químicos pertencentes a grupamentos distintos e de diferentes mecanismos de ação, o que atende a um manejo adequado de controle dos principais ácaros fitófagos da cultura dos citros.This work was carried out to determine the residual toxicity of the main pesticides used in citrus, on Neoseiulus californicus (McGregor under laboratory conditions. For this, it was used the residual contact bioassay. Citrus leaves of the variety "Pêra" were sprayed in a Potter tower. The residual action was evaluated at 2 hours and 1; 3; 5; 7; 10; 14 e 21 days after treatment. Ten adult females of N. californicus were transferred to each ring, together with an enough amount of Tetranychus urticae nymphs and adults to feed the predator. Mortality evaluations were performed at 72 hours after treatment. Bioassays indicate that the pesticides: acrinathrin, deltamethrin, dinocap, sulphur, fenpropathrin, fenbutatin oxide and propargite were innocuous to N. californicus. On the other hand, abamectin, azocyclotin e cyhexatin caused mortalities of 29.8; 32.0 e 34.1%, respectively, two hours after transference. Dicofol, pyridaben and chlorfenapyr were extremely toxic to the predator mite, causing 100% of mortality two hours after the application. This way, to this population of N. californicus, the releases can be performed safely 3 days after the application, except for cyhexatin (5 days, dicofol and pyridaben (14 days and chlorfenapyr (21 days, without risk of significant adult mortality rates due to the application of pesticides.

  7. Seletividade de alguns agrotóxicos em uso na citricultura ao ácaro predador Neoseiulus californicus (McGregor) (Acari: Phytoseiidae) Residual toxicity of the main pesticides recommended in citrus orchards on predaceous mite Neoseiulus californicus (Mcgregor) (Acari: Phytoseiidae)

    Marcos Zatti da Silva; Carlos Amadeu Leite de Oliveira

    2006-01-01

    Objetivou-se avaliar o efeito dos principais agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor), em condições de laboratório, por tratar-se de um fitoseídeo com grande potencialidade para ser utilizado no controle dos ácaros fitófagos na cultura. O método de bioensaio adotado foi o de contato direto e residual. Folhas de citros da variedade Pêra, contendo 25 fêmeas adultas de N. californicus procedentes de uma criação-estoque, foram pulverizadas em torre de Potter. Aval...

  8. Controle biológico do ácaro rajado com ácaros predadores fitoseídeos (Acari: Tetranychidae, Phytoseiidae) em culturas de pepino e morango Biological control of the two-spotted spider mite (Acari: Tetranychidae, Phytoseiidae) in cucumber and strawberry crops

    Watanabe, M. A.; G.J. de Moraes; I. Gastaldo Jr.; Nicolella, G

    1994-01-01

    O ácaro rajado, Tetranychus urticae Koch, é considerado uma das principais pragas de hortaliças e várias outras culturas no Brasil, em áreas onde um considerável volume de acaricidas é anualmente empregado no seu controle. O objetivo deste trabalho foi testar a viabilidade técnica do emprego dos fitoseídeos Amblyseius idaeus (Denmark & Muma) e Phytoseudus macropilis (Banks), comum ente encontrados no Brasil, no controle de T. urticae em pepino e morangueiro em Jaguaríúna,SP. Utilizou-se o del...

  9. Redescription, synonymy, and new records of Vexillata noviberiae (Dikmans, 1935) (Nematoda: Trichostrongylina), a parasite of rabbits Sylvilagus spp. (Leporidae) in the United States.

    Digiani, María Celina; Kinsella, John M; Kass, Thomas B; Durette-Desset, Marie-Claude

    2007-08-01

    Vexillata noviberiae (Dikmans, 1935) (Trichostrongylina: Heligmosomoidea), originally described as a parasite of Sylvilagus floridanus from Louisiana, is redescribed from material collected from Sylvilagus palustris in Florida and from S. floridanus in Kansas. New morphometric and morphological data are provided. Stunkardionema halla Arnold, 1941, described from S. floridanus from Kansas and New York, is proposed as a junior synonym of V. noviberiae. These findings confirm the occurrence of V. noviberiae as a parasite of rabbits and its wide distribution range in North America. PMID:17918368

  10. ClEST cluster :Cl_singleton0472 [ClEST

    Full Text Available Cl_singleton0472 oxidative stress -induced growth inhibitor 1 Cimex lectularius nuclear gene 476 ... CCGATTACCACAAGATATGGCAGATGATGA fb22084 1 Oxidative stress -induced growth inhibitor 1 [Camponotus floridanus] ...

  11. Attack behavior of Podisus rostralis (Heteroptera: Pentatomidade adults on caterpillars of Bombyx mori (Lepidoptera: Bombycidae

    Walkymário Paulo Lemos

    2005-11-01

    Full Text Available Attack behavior of the predator Podisus rostralis (Stäl (Heteroptera: Pentatomidae adults on fourth instar Bombyx mori L. (Lepidoptera: Bombycidae caterpillars was studied in laboratory conditions. Ten 24 hours old adults of this predator were observed during two hours with the following attack behavior: (1 Predator: prey finding; prey observation; touching prey with antenna; attack behavior; prey paralysis; predator retreat after attack; attack cessation; successive attacks; and (2 Prey: defense. The predator P. rostralis found its prey before attacking and it approached it with slow circular movements. The attack was usually made in the posterior part of the prey to reduce defense reaction. Larger size of prey in relation to the predator resulted difficult prey paralysis but it occurred in less than two hours.Estudou-se, em laboratório, o comportamento de ataque de adultos do predador Podisus rostralis (Stäl (Heteroptera: Pentatomidae tendo como presa lagartas de quarto estádio de Bombyx mori L. (Lepidoptera: Bombycidae. Dez adultos do predador, com 24 horas de idade, foram observados durante duas horas acompanhando-se os seguintes comportamentos de ataque: (1 Predador: localização da presa; observação da presa; toque das presas com as antenas; comportamento de ataque; paralisação da presa; fuga do predador após ataque; finalização do ataque; ataques sucessivos; e (2 Presa: defesa. O predador P. rostralis localizou sua presa antes do ataque, aproximando-se dela através de lentos movimentos circulares. O ataque é, usualmente, realizado na parte posterior da presa para reduzir reação de defesa. O maior tamanho da presa em relação ao predador pode dificultar a paralisação, porém o predador consegue paralisá-la em menos de duas horas.

  12. Varroose

    Pires, Sância

    2006-01-01

    A abelha melífera ocidental, como todos os seres vivos, em todas as fases do seu desenvolvimento, está sujeita ao ataque de vários inimigos (predadores, parasitas e agentes patogénicos vários) que agem, directa ou indirectamente, perturbando a vida da colónia de várias formas.

  13. Selección del lugar de nidificación por el Alimoche (Neophron percnopterus en Navarra.

    CEBALLOS, O., DONAZAR, J.A.

    1988-01-01

    los rigores climáticos y a los mamíferos predadores. Se seleccionan activamente roquedos y emplazamientos de nidos orientados hacia el sur, evitando la incidencia de los vientos húmedos y fríos que provienen del norte y noroeste.

  14. Sarcocystis leporum in cottontail rabbits and its transmission to carnivores.

    Fayer, R; Kradel, D

    1977-04-01

    Muscle from Sarcocystis-infected cottontail rabbits (Sylvilagus floridanus) was fed to coccidia-free cats (Felis domestica) and dogs (Canis familiaris). Only cats became infected and shed sporocysts in their feces. The prepatent period ranged from 10 to 25 days and the patent period from 3 to 46 days. Sporocysts were fully sporulated when shed. They contained 4 sporozoites and a coarse granular residuum and averaged 9.4 by 13.6 micron (N=55). Doses of 200-75,000 sporocysts were orally administered to 5 domestic rabbits (Oryctolagus cuniculus). Domestic rabbits did not become infected, suggesting a strict host specificity for the intermediate host S. floridanus. PMID:405509

  15. A Century of Shope Papillomavirus in Museum Rabbit Specimens

    Clara Escudero Duch; Williams, Richard A. J.; Timm, Robert M.; Javier Perez-Tris; Laura Benitez

    2015-01-01

    Sylvilagus floridanus Papillomavirus (SfPV) causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus) from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, an...

  16. ClEST cluster :Cl_contig0419 [ClEST

    Full Text Available Cl_contig0419 vacuolar atp synthase ... subunit e ... Cime x le ctularius nucle ar ge ne ... 450 GGGCACTCGCAGTTA ... ACC fs20066 fw20016 2 Vacuolar proton pump subunit E ... [Camponotus floridanus] E FN63114 2.4E -37 GO:004277 ...

  17. Transmission of Sarcocystis leporum from a cottontail rabbit to domestic cats.

    Crum, J M; Prestwood, A K

    1977-04-01

    Muscle tissue containing grossly visible cysts of Sarcocystis leporum from a cottontail rabbit (Sylvilagus floridanus) was fed to laboratory cats. Sporocysts averaging 13.2 x 9.7 micron were detected in the feces 14 days post-infection and were found until 69 days post-infection. PMID:405510

  18. Zoophytophagy in predatory Hemiptera

    Jorge Braz Torres

    2009-10-01

    Full Text Available Predaceous hemipteran feeding on different trophic levels have raised questions about their ecology and role in biological control. Therefore, specific adaptations allowing them to simultaneously use plants and animals as sources for their nutritional requirements are important. Enzymatic variability in predatory hemipterans has been suggested as the basic adaptation for convergent or divergent to omnivory. Thus, the salivary enzymatic complexes of predatory hemipterans have been furnished a partial understanding of the mechanisms permitting switching between plant and animal food sources. In this study, a discriminatory analysis was performed to attribute trophic habits to each insect investigated based on the presence and absence of salivary enzyme combinations. Although peptidase is found in all tested predatory hemipterans' salivary glands, it is not a distinguishing enzyme because it has been found in phytophagous species as well. However, the presence of peptidase and amylase activity in hemipteran salivary glands is considered to be an explanation for these insects' ability to switch their diet, predators feeding on plants (amylase and herbivores taking prey (peptidase.Percevejos predadores alimentando em diferentes níveis tróficos tem despertado o interesse para o entendimento da ecologia e papéis exercido no controle biológico por esses predadores. Os parâmetros que governam o comportamento alimentar onívoro desses predadores tem sido auxiliado pelos estudos sobre enzimas de glândula salivares. A variabilidade de enzimas em percevejos predadores tem sido sugerido como adaptação básica para a convergência ou divergência para a onivoria. Assim, enzimas salivares de percevejos predadores tem fornecido entendimento, ao menos parcial, da alternância de alimentação entre plantas e animais. Neste estudo, foi utilizado a presença de enzimas como variáveis canônicas para atribuir a cada espécie estudada predominância do

  19. Predation risk versus pesticide exposure: effects of fear and loathing on aquatic invertebrates

    Pestana, João Luís Teixeira

    2007-01-01

    Os organismos aquáticos apresentam respostas plásticas à presença de predadores que são induzidas por pistas químicas presentes na água. Estas respostas além de minimizar os efeitos de predação, têm também custos associados que podem incluir alterações na tolerância às variações ambientais tais como contaminação por pesticidas. Os efeitos dos pesticidas em sistemas naturais resultam assim da toxicidade mas também do efeito nas interacções predador-presa. Apesar de extremamente relevante...

  20. Seletividade fisiológica de inseticidas aos inimigos naturais de Plutella xylostella (L.) (Lepidoptera: Plutellidae) em brássicas Insecticide physiological selectivity to natural enemies of Plutella xylostella (L.) (Lepidoptera: Plutellidae) in Brassicae

    Leandro Bacci; Marcelo Coutinho Picanço; Ézio Marques da Silva; Júlio Cláudio Martins; Mateus Chediak; Maria Elisa Sena

    2009-01-01

    A conservação de inimigos naturais é um componente fundamental no manejo integrado de pragas. Neste trabalho, estudou-se a seletividade de sete inseticidas usados no manejo de Plutella xylostella (L.) (Lepidoptera: Plutellidae) ao parasitóide Oomyzus sokolowskii (Kurdjumov) (Hymenoptera: Eulophidae) e aos predadores Discodon sp. (Coleoptera: Cantharidae) e Lasiochilus sp. (Hemiptera: Anthocoridae). Os organofosforados metamidofós e paratiom metílico e o carbamato carbaril foram altamente tóxi...

  1. Fatores que afetam artrópodes associados a cinco acessos de ginseng-brasileiro (Pfaffia glomerata) em Montes Claros, Estado de Minas Gerais = Factors affecting arthropods associated with five accessions of Brazilian ginseng (Pfaffia glomerata) in Montes Claros, Brazil

    Germano Leão Demolin Leite; Mayra Pimenta; Péricles Leonardo Fernandes; Ronnie Von Santos Veloso; Ernane Ronnie Martins

    2008-01-01

    O objetivo deste trabalho foi identificar artrópodes associados a cinco acessos ('NDS', 'COVB', 'NAT', 'ROST' e 'GSD1') de Pfaffia glomerata, bem como o efeito de clima, dossel, face foliar, tricomas e inimigos naturais sobre a entomofauna. Dos artrópodes observados, Aphis gossypii (Hemiptera: Aphididae), Diabrotica speciosa (Coleoptera: Chrysomelidae) e Tetranychus ludeni (Acari: Tetranychidae) apresentaram maior densidade populacional. Dos inimigos naturais observados, ácaros predadores est...

  2. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species.

    Ferreira, Ana M; Marques, Andreia T; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Araújo, Susana S; Almeida, André M

    2016-01-01

    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of O. cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in R. diazi and S. floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification. PMID:27092177

  3. Identification of a bitter-taste receptor gene repertoire in different Lagomorphs species

    Ana M. Ferreira

    2016-04-01

    Full Text Available The repertoires of bitter taste receptor (T2R gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, Lepus europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi and Sylvilagus floridanus, using Oryctolagus cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of Oryctolagus cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in Romerolagus diazi and Sylvilagus floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification.

  4. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species

    Ferreira, Ana M.; Marques, Andreia T.; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Araújo, Susana S.; Almeida, André M.

    2016-01-01

    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequencing. We studied the identities of the DNA sequences and built the corresponding phylogenetic tree. Sequencing was successful for both subspecies of O. cuniculus for all T2R genes studied, for five genes in Lepus, and for three genes in R. diazi and S. floridanus. We describe for the first time the partial repertoires of T2R genes for Lagomorphs species, other than the common rabbit. Our phylogenetic analyses indicate that sequence proximity levels follow the established taxonomic classification. PMID:27092177

  5. Discovery of Defense- and Neuropeptides in Social Ants by Genome-Mining

    Gruber, Christian W.; Markus Muttenthaler

    2012-01-01

    Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant), Camponotus floridanus (carpenter ant) and Harpegnathos saltator (basal genus). Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulato...

  6. Unprecedented loss of ammonia assimilation capability in a urease-encoding bacterial mutualist

    Wernegreen Jennifer J

    2010-12-01

    Full Text Available Abstract Background Blochmannia are obligately intracellular bacterial mutualists of ants of the tribe Camponotini. Blochmannia perform key nutritional functions for the host, including synthesis of several essential amino acids. We used Illumina technology to sequence the genome of Blochmannia associated with Camponotus vafer. Results Although Blochmannia vafer retains many nutritional functions, it is missing glutamine synthetase (glnA, a component of the nitrogen recycling pathway encoded by the previously sequenced B. floridanus and B. pennsylvanicus. With the exception of Ureaplasma, B. vafer is the only sequenced bacterium to date that encodes urease but lacks the ability to assimilate ammonia into glutamine or glutamate. Loss of glnA occurred in a deletion hotspot near the putative replication origin. Overall, compared to the likely gene set of their common ancestor, 31 genes are missing or eroded in B. vafer, compared to 28 in B. floridanus and four in B. pennsylvanicus. Three genes (queA, visC and yggS show convergent loss or erosion, suggesting relaxed selection for their functions. Eight B. vafer genes contain frameshifts in homopolymeric tracts that may be corrected by transcriptional slippage. Two of these encode DNA replication proteins: dnaX, which we infer is also frameshifted in B. floridanus, and dnaG. Conclusions Comparing the B. vafer genome with B. pennsylvanicus and B. floridanus refines the core genes shared within the mutualist group, thereby clarifying functions required across ant host species. This third genome also allows us to track gene loss and erosion in a phylogenetic context to more fully understand processes of genome reduction.

  7. Hematologic comparisons of shot and live trapped cottontail rabbits.

    Jacobson, H A; Kirkpatrick, R L; Burkhart, H E; Davis, J W

    1978-01-01

    Comparisons were made between hematologic measurements of shot and box-trapped cottontail rabbits (Sylvilagus floridanus). Trapped rabbits had significantly (P less than 0.001) higher serum corticoid levels and segmented neutrophil percentages and significantly (P less than 0.001) lower lymphocyte percentages than did shot rabbits. Trapped rabbits also had significantly (P less than 0.05) higher packed cell volumes and blood urea nitrogen values than did shot rabbits. PMID:633520

  8. Density and habitat requirements of sympatric hares and cottontails in northern Italy

    Anna Vidus Rosin; Alessandro Montagna; Alberto Meriggi; Sara Serrano Perez

    2010-01-01

    Abstract From 2005 to 2009, densities and habitat selection by the European hare (Lepus europaeus) and Eastern cottontail (Sylvilagus floridanus) were assessed during feeding activity in an intensively cultivated area in northern Italy. Hare average density (74 ind./km2) was comparable to the highest values reported for European farming areas. Preand post-breeding density fluctuated widely across the...

  9. [Presence in France of a selvatic Xenopsylla: X. cunicularis Smit, 1957 (Siphonaptera, Pulicidae), a parasite of wild rabbits].

    Beaucournu, J C; Launay, H

    1977-01-01

    The authors point out, for the first time in France, a selvatic Xenopsylla: X. cunicularis Smit, 1957, parasite on the European rabbit, well-known in Morocco and Spain until today. The paleogeographical, ecological, and epidemiological interest of this parasite is laid stress on. The other fleas linked to the European rabbit are evoked, and the acclimatization of Euphoplopsyllus glacialis affinis (Baker, 1904), in France and Italy, introduced with its host Sylvilagus? floridanus is related. PMID:580913

  10. Genome structure of cottontail rabbit herpesvirus.

    Cebrian, J; Berthelot, N; Laithier, M

    1989-01-01

    The genome structure of a herpesvirus isolated from primary cultures of kidney cells from the cottontail rabbit Sylvilagus floridanus was elucidated by using electron microscopy and restriction enzyme analysis. The genome, which was about 150 kilobase pairs long and which had an average G + C composition of 45%, consisted of two regions with unique base sequences (54 and 47 kilobase pairs) enclosed by reiterations of a 925-base-pair sequence with a variable copy number. The internal repeats w...

  11. Cortisol and aldosterone comparisons of cottontail rabbits collected by shooting, trapping, and falconry.

    Hamilton, G D; Weeks, H P

    1985-01-01

    Cortisol and aldosterone levels were measured in plasma of eastern cottontail rabbits (Sylvilagus floridanus) collected by three different methods, i.e., shooting, live-trapping and falconry. Cortisol levels ranged from near 0 to 27.5 micrograms/100 ml and aldosterone from near 0 to 220 ng/100 ml. Shot animals had significantly lower cortisol concentrations than those taken by either of the other methods. Trapped cottontails also had significantly lower aldosterone levels. PMID:3981742

  12. Circular Herpesvirus sylvilagus DNA in spleen cells of experimentally infected cottontail rabbits.

    Medveczky, P; Kramp, W J; Sullivan, J L

    1984-01-01

    Cottontail rabbits (Sylvilagus floridanus) were infected with Herpesvirus sylvilagus, and spleen cells were analyzed for the presence of virus-specific, covalently closed circular, and linear DNA molecules by a simple electrophoretic technique, followed by transfer to nitrocellulose filters and hybridization with cloned viral DNA (Gardella et al., J. Virol. 50:248-254, 1984). Approximately 0.2 copies per cell of circular DNA and 0.2 copies per cell of linear DNA were detected by hybridization...

  13. Identification of a bitter-taste receptor gene repertoire in different Lagomorphs species

    Ana M Ferreira; Marques, Andreia T.; Luca eFontanesi; Carl-Gustaf eThulin; Elvira eSales-Baptista; Susana S. Araújo; Almeida, André M.

    2016-01-01

    The repertoires of bitter taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, Lepus europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi and Sylvilagus floridanus, using Oryctolagus cuniculus cuniculus as control species for PCR and D...

  14. Modelling the habitat requirements of invasive Eastern Cottontail () introduced to Italy

    Bertolino, Sandro; Ingegno, Barbara; Girardello, Marco

    2010-01-01

    Abstract We analysed the spatial distribution of Eastern Cottontail (Sylvilagus floridanus) and its relationship with the habitat attributes of the agro-ecosystems in north-western Italy. We used generalised linear models to analyse the relationship between the occurrence of the cottontail and a series of landscape-level variables. Hierarchical partitioning was used to estimate the independent contribution of these variables. Our analysis showed that cottontail is typically a lowla...

  15. SERUM ANTIBODIES TO WHOLE-CELL AND RECOMBINANT ANTIGENS OF BORRELIA BURGDORFERI IN COTTONTAIL RABBITS

    Magnarelli, Louis A.; Norris, Steven J; Fikrig, Erol

    2012-01-01

    Archived serum samples, from 95 eastern cottontail rabbits (Sylvilagus floridanus) captured in New York, New York, USA and Millbrook, New York, USA, during 1985–86, were analyzed in solid-phase enzyme-linked immunosorbent assays (ELISA) for total and class-specific immunoglobulin (Ig) M antibodies to whole-cell or recombinant antigens of Borrelia burgdorferi sensu stricto. Using a polyvalent conjugate, rabbit sera contained antibodies to whole-cell and recombinant antigens (protein [p]35, p37...

  16. Herpesvirus sylvilagus infects both B and T lymphocytes in vivo.

    Kramp, W J; Medveczky, P; Mulder, C; Hinze, H C; Sullivan, J L

    1985-01-01

    Herpesvirus sylvilagus infection of cottontail rabbits (Sylvilagus floridanus) was studied as a model of herpesvirus-induced lymphoproliferative disorders. Leukocytosis, splenomegaly, proliferation of T cells and virus production by lymphocytes characterized this infectious mononucleosis-like disease. Approximately two copies of circular herpesvirus sylvilagus genomes per cell were detected in spleen cells at 2 weeks postinfection, and circular genomes could still be observed after 4 months. ...

  17. Occurrence of Escherichia coli in Wild Cottontail Rabbits.

    Kozlowski, R; Glantz, P J; Anthony, R G

    1977-03-01

    Free-ranging cottontail rabbits (Sylvilagus floridanus) from two areas in central Pennsylvania were sampled over a 4-year period. Large numbers of coliforms were isolated from the intestinal tracts of these animals; in 136 of the 141 rabbits sampled, Escherichia coli was found to be a major component of the alimentary flora. Four serogroups (O7, O77, O73, and O103) were predominant among the isolates and were considered resistant coliflora of this species of cottontail rabbit. PMID:16345208

  18. Identification of a Bitter-Taste Receptor Gene Repertoire in Different Lagomorphs Species

    Ana M Ferreira; Marques, Andreia T.; Fontanesi, Luca; Thulin, Carl-Gustaf; Sales-Baptista, Elvira; Susana S. Araújo; Almeida, André M.

    2016-01-01

    The repertoires of bitter-taste receptor (T2R) gene have been described for several animal species, but these data are still scarce for Lagomorphs. The aim of the present work is to identify potential repertoires of T2R in several Lagomorph species, covering a wide geographical distribution. We studied these genes in Lepus timidus, L. europaeus, Oryctolagus cuniculus algirus, Romerolagus diazi, and Sylvilagus floridanus, using O. cuniculus cuniculus as control species for PCR and DNA sequenci...

  19. Pathogenesis of Herpesvirus sylvilagus infection in cottontail rabbits.

    Hesselton, R. M.; Yang, W.C.; Medveczky, P; Sullivan, J L

    1988-01-01

    Experimental infection with Herpesvirus sylvilagus produces clinical and histopathologic changes in its natural host, the cottontail rabbit (Sylvilagus floridanus), similar to those observed in humans acutely infected with Epstein-Barr virus (EBV). Twenty-seven seronegative cottontail rabbits were infected with Herpesvirus sylvilagus and all developed antibodies within 10 days. Neutralizing antibody was detected as early as 7 days after infection. Virus was isolated from blood mononuclear cel...

  20. First Isolation and Cultivation of Borrelia burgdorferi Sensu Lato from Missouri

    Oliver, J H; Kollars, T. M.; Chandler, F W; James, A. M.; Masters, E. J.; Lane, R S; Huey, L. O.

    1998-01-01

    Five Borrelia burgdorferi sensu lato isolates from Missouri are described. This represents the first report and characterization of such isolates from that state. The isolates were obtained from either Ixodes dentatus or Amblyomma americanum ticks that had been feeding on cottontail rabbits (Sylvilagus floridanus) from a farm in Bollinger County, Mo., where a human case of Lyme disease had been reported. All isolates were screened immunologically by indirect immunofluorescence by using monocl...

  1. Serological prevalence of tularemia in cottontail rabbits of southern Illinois.

    Lepitzki, D A; Woolf, A; Cooper, M

    1990-04-01

    Sera of cottontail rabbits (Sylvilagus floridanus) collected in southern Illinois in 1983 and 1984 were screened for the presence of antibodies against Francisella tularensis by rapid slide agglutination and enzyme linked immunosorbent assay techniques; 6% of 118 and 16% of 119 samples were positive by these methods, respectively. Rabbits gained, lost and maintained titers over at least an 8 mo period. Francisella tularensis tularensis was isolated from one serologically negative, clinically healthy rabbit. PMID:2338733

  2. Associations of passerine birds, rabbits, and ticks with Borrelia miyamotoi and Borrelia andersonii in Michigan, U.S.A.

    Hamer Sarah A; Hickling Graham J; Keith Rich; Sidge Jennifer L; Walker Edward D; Tsao Jean I

    2012-01-01

    Abstract Background Wild birds contribute to maintenance and dissemination of vectors and microbes, including those that impact human, domestic animal, and wildlife health. Here we elucidate roles of wild passerine birds, eastern cottontail rabbits (Sylvilagus floridanus), and Ixodes dentatus ticks in enzootic cycles of two spirochetes, Borrelia miyamotoi and B. andersonii in a region of Michigan where the zoonotic pathogen B. burgdorferi co-circulates. Methods Over a four-year period, wild b...

  3. Arrangement of repetitive sequences in the genome of herpesvirus Sylvilagus.

    Medveczky, M M; Geck, P; Clarke, C; Byrnes, J; Sullivan, J L; Medveczky, P G

    1989-01-01

    Herpesvirus sylvilagus is a lymphotropic (type gamma) herpesvirus of cottontail rabbits (Sylvilagus floridanus). Analysis of virion DNA of herpesvirus sylvilagus has revealed that the genome consists of one stretch of about 120 kilobase pairs of internal, unique DNA flanked by a variable number of 553-base-pair tandem repeats. The G + C content of the repetitive DNA is extremely high (83%), as determined by sequencing. The organization of the herpesvirus sylvilagus genome is, therefore, simil...

  4. Neuronal representation and processing of chemosensory communication signals in the ant brain

    Zube, Christina

    2008-01-01

    Ants heavily rely on olfaction for communication and orientation and ant societies are characterized by caste- and sex-specific division of labor. Olfaction plays a key role in mediating caste-specific behaviours. I investigated whether caste- and sex-specific differences in odor driven behavior are reflected in specific differences and/or adaptations in the ant olfactory system. In particular, I asked the question whether in the carpenter ant, Camponotus floridanus, the olfactory pathway exh...

  5. Dicty_cDB: Contig-U09392-1 [Dicty_cDB

    Full Text Available nititkpirpietrvpiklttq pqstnpktvpptttttteatttatkpipnktpqpintfkpsdkgasledscinaanqmsn isgneqlgtigkeleayanaikigdkkqi...iv*miiimikrreny*riyklklnhqfmkf*in*i qlilysnlkmqlnnikql*ln*miqlmfqq*pmiiqnklmnifqnyqiynqii*yhy*nn kv*mkkn...ame B: vkn**lvnh*kklkl*hln*llhqiiv*miiimikrreny*riyklklnhqfmkf*in*i qlilysnlkmqlnnikql*ln*miqlmfqq*pmiiqnklmnifqnyqiynqi...00_FPR375... 36 8e-05 22 ( AP009351 ) Staphylococcus aureus subsp. aureus str. Newman....008 12 ( BX248583 ) Blochmannia floridanus complete genome. 38 0.009 20 ( AE014841 ) Plasmodium falciparum

  6. Dicty_cDB: CHN406 [Dicty_cDB

    Full Text Available pealtninsekniklfsesnilspvelesrqeilfeiynks ikieanslydlvstlvlpacfahqkniaesvnsimpfiqsqksfsqpnhqyshlsevves vnllieanq...hsikslkih*fnmfvlfsmvmvi vvigknspnlev*qiyhrlqrl*qiltlkrilnsflkvifshqlnwnhvkrfslkfiinq lkskqtlymi*fqlwyfqlvllikrillnl*tl*chsfkvknlsvnqi..., *** SEQUENCING IN PROGRESS ***, 10 unordered pieces. 40 0.29 7 BX248584 |BX248584.1 Blochmannia floridanus...kllalikqtkdfnsehslatflnqsvipqmnevrkfsdhlexivedkflas sk Frame C: xnpnrfs**thcffsifllltylfffkkkkkkkkkkcqiexenllnilivenqlkqi...NA Score E Sequences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 ma

  7. Clinal variation of some mammals during the Holocene in Missouri

    Purdue, James R.

    1980-03-01

    Eastern cottontail ( Sylvilagus floridanus), fox squirrel ( Sciurus niger), and gray squirrel ( Sciurus carolinensis) were examined for clinal variation during the Holocene. Modern samples of all three species displayed strong east-west patterns along the western edge of the eastern deciduous forest: S. floridanus and S. niger decrease and S. carolinensis increases in size. Archeological samples of S. carolinensis from Rodgers Shelter (23BE125), Benton County, Missouri, and Graham Cave (23MT2), Montgomery County, Missouri, indicated an increase in size from early to middle Holocene. Sylvilagus floridanus from Rodgers Shelter decreased in size from early to middle Holocene and then increased during the late Holocene to modern proportions. A literature survey reveals that clinal variation is a common phenomenon among modern homeotherms. In introduced species, clinal variation has developed after relatively few generations, indicating rapid adaptations to environmental conditions; often winter climatic variables are implicated. Morphological variation in the study species during the Holocene is interpreted as a response to changing climates. Studies of morphological clines may lead to another valuable data source for reconstructing past ecologies.

  8. Behavioural responses of captive-born greater rheas Rhea americana Linnaeus (Rheiformes, Rheidae submitted to antipredator training Respostas comportamentais de emas cativas Rhea americana Linnaeus (Rheiformes, Rheidae submetidas a treinamentoanti-predação

    Cristiano S. de Azevedo

    2006-03-01

    Full Text Available Human activities have been diminishing greater rhea Rhea americana (Linnaeus, 1758 populations throughout their natural distribution. The reintroductions of captive-born greater rheas have been tried but without success; since the individuals reintroduced were killed by predators. Captive-born animals that have been isolated from predators for many generations can lose their predator recognition abilities. To enhance the survival rates of the reintroduced animals, researchers are now using antipredator training techniques. We studied the response of 15 zoo-borne greater rheas to antipredator training. The animals were divided into three groups: two test groups and one control group. We ran 15 antipredator tests and four control testes with each group. Antipredator tests consisted of pairing a taxidermized predator model or a real predator (domestic dog with a simulation of a capture procedure. Control tests consisted of presenting the predator model (jaguar to the birds, after training but not associating it with an aversive event and recording behavioural responses. All tests were video-recorded and analysed a posteriori. Results showed that the trained rheas responded appropriately to the predators, becoming more vigilant and that there was considerable individual differences in response to antipredator training. The results demonstrated that antipredator training is effective and therefore an invaluable tool for reintroduction projects involving greater rheas. Furthermore, the methods employed in this research project should be applicable to other species of flightless birds.As atividades humanas têm diminuído as populações de emas Rhea americana (Linnaeus, 1758 por toda sua área de distribuição. Reintroduções de emas nascidas em cativeiro têm sido tentadas, mas sem sucesso, uma vez que os indivíduos reintroduzidos são mortos por predadores. Animais nascidos em cativeiro que foram isolados de seus predadores por várias gera

  9. CURVA DOSE-RESPOSTA DE COMPOSTOS QUÍMICOS EM ENSAIOS ECOTOXICOLÓGICOS COM NEMATOIDES

    COUTINHO, H.S.; BATISTA, J.R.; IMBELONI, T.G.P; SILVA, V.M.; FREIRE, M.G.M.; V Mussi-Dias

    2015-01-01

    Os nematoides são organismos amplamente distribuídos nos ecossistemas terrestres e aquáticos, possuindo abundante diversidade de espécies parasitas de animais, de plantas, ou simplesmente compondo a biota com consumidores de bactérias e nutrientes no meio onde se encontram. Algumas espécies de nematoides de “vida livre” que não são predadores nem parasitas podem ser facilmente mantidos ou cultivados em laboratório, possibilitando seu uso e manipulação em pesquisa. Comumente, os en...

  10. Fatores de mortalidade na fase de ovo de Tuta absoluta em sistemas de produção orgânica e convencional de tomate

    Maria Alice de Medeiros

    2011-01-01

    Full Text Available A traça-do-tomateiro Tuta absoluta (Meyrick (Lep.: Gelechiidae está sujeita a fatores de mortalidade bióticos como predadores e parasitoides e fatores abióticos como água da irrigação e da chuva que influenciam sua dinâmica populacional. O objetivo deste trabalho foi quantificar a importância desses fatores na sobrevivência de ovos da traça-do-tomateiro. Os experimentos foram desenvolvidos na Embrapa Hortaliças, de 1/8/2004 a 7/11/2005, em plantio de tomate e tomate consorciado em sistema orgânico e tomate em sistema convencional. As avaliações consistiram em: 1 coleta de ovos no campo em diferentes épocas do ciclo da cultura e sua incubação em laboratório até a emergência do parasitoide ou eclosão da lagarta; 2 exposição de ovos sentinelas no campo por 72 horas; 3 ovos marcados e acompanhados a cada 24 horas até eclosão das lagartas em campo. Ovos coletados no campo e incubados em laboratório mostraram que a mortalidade por Trichogramma sp. foi de 32%. A mortalidade dos ovos que permaneceram no campo (metodologia 2 e 3, evidenciaram que o parasitismo por Trichogramma sp. foi de 12% e que os predadores e o efeito mecânico da água produziram 36% de mortalidade dos ovos. Essa diferença revela que a permanência dos ovos no campo os expõe à competição com predadores e a mortalidade causada pelo efeito mecânico da água reduzindo o recrutamento de Trichogramma sp. Parasitoides de ovos, predadores generalistas associados à ação da água acarretaram maior mortalidade de T. absoluta em sistemas de produção orgânica de tomate.

  11. Victimización y nuevas tecnologías : un análisis transcultural de los riesgos de vivir en la era digital

    Ferreira, Fátima Abreu; Martins, Paula Cristina; Gonçalves, Rui Abrunhosa

    2011-01-01

    Introducción: En los últimos años las nuevas tecnologías se convirtieron en parte de la vida cuotidiana de los jóvenes y constituyen un valioso recurso para su desarrollo. El actual uso intensivo de las nuevas tecnologías y el anonimato que ellos ofrecen han creado un tema nuevo de interés para la protección de los niños, ya que los expone a una multitud de riesgos: violencia, bullying, predadores sexuales, entre otros. La falta de supervisión de estas actividades, la escasa legislación exist...

  12. Condições atuais da esquistossomose no "Dique do Tororó" em Salvador, Bahia

    Ruth B. Amorim

    1976-06-01

    Full Text Available Os Autores apresentam os resultados de observações realizadas entre os anos de 1971 a 1974 sobre a incidência humana da esquistosomose no Dique do Tororó, em Salvador, Bahia, após alí terem sido realizadas melhorias pela engenhària sanitária e medidas de combate biológico ao caramujo vetor pelo uso de peixes predadores. Comparando com os resultados obtidos por outros Autores em 1960, concluem que o Dique do Tororó não mais representa uma importante fonte de propagação da esquistosomose.

  13. Parasitofauna del zorro rojo (Vulpes vulpes) en la Comunidad Valenciana

    Sanchis Monsonís, Gloria

    2016-01-01

    El presente estudio sobre la parasitofauna del zorro rojo (Vulpes vulpes) se ha realizado en la Comunidad Valenciana, dentro del Programa de Vigilancia Epidemiológica sobre especies cinegéticas y salvajes. Entre mayo de 2006 y noviembre de 2013 se realizaron las necropsias de 286 zorros obtenidos de capturas autorizadas para el control de predadores, de atropellos o recogidos enfermos. Tras el análisis de las vísceras torácicas y abdominales, así como el examen de muestras de musculatura esqu...

  14. Lesiones post mortales por fauna cadavérica: La acción de las hormigas sobre el cadáver Post-mortal injuries by cadaveric fauna: The action of the ants on human corpses

    P.M. Garamendi; M. López-Alcaraz; A. Mazón; Rodríguez, J.

    2008-01-01

    Los animales pueden actuar como predadores de los restos humanos y las lesiones postmortales que infligen en los cadáveres pueden dar lugar a errores de interpretación de los hallazgos en las autopsias forenses. Entre la fauna cadavérica, las hormigas constituyen un caso excepcional al ser los únicos insectos que pueden iniciar su actividad predadora antes de instaurarse la putrefacción. Las hormigas suelen producir lesiones que por su asiento y morfología resultan típicas. Se presenta un cas...

  15. Las arañas en agroecosistemas: bioindicadores terrestres de calidad ambiental

    Miguel Simó; Álvaro Laborda; Carolina Jorge; Manuel Castro

    2011-01-01

    Las arañas son predadores generalistas en ecosistemas terrestres, ampliamente utilizadas en estudios de biodiversidad. En el último siglo, el paisaje de Uruguay se transformó en un mosaico de áreas formadas por ambientes naturales y agroecosistemas. ¿Qué nivel de cambio se espera hallar en la comunidad de arañas si las áreas de estudio están próximas? ¿Qué porcentaje de especies nativas serán reemplazadas con la plantación? ¿Cómo afecta esto a la biodiversidad local? Se realizó un estudio en ...

  16. Fatores de mortalidade na fase de ovo de Tuta absoluta em sistemas de produção orgânica e convencional de tomate.

    Maria Alice de Medeiros; Edison Ryoiti Sujii; Helena Castanheira de Morais

    2011-01-01

    A traça-do-tomateiro Tuta absoluta (Meyrick) (Lep.: Gelechiidae) está sujeita a fatores de mortalidade bióticos como predadores e parasitoides e fatores abióticos como água da irrigação e da chuva que influenciam sua dinâmica populacional. O objetivo deste trabalho foi quantificar a importância desses fatores na sobrevivência de ovos da traça-do-tomateiro. Os experimentos foram desenvolvidos na Embrapa Hortaliças, de 1/8/2004 a 7/11/2005, em plantio de tomate e tomate consorciado em sistema o...

  17. Papel de la codorniz en la agroecología de malas hierbas (II). Influencia de la digestión en la viabilidad de las semillas

    Guerrero Herrero, Lucía; López Navarro, Pablo; González Redondo, Pedro; Urbano Fuentes-Guerra, José María

    2015-01-01

    El papel de las aves granívoras en la agroecología de las malas hierbas es poco conocido. La codorniz es un ave granívora migratoria frecuente en la campiña española. El objetivo de este trabajo ha sido conocer el potencial predador y dispersor de la codorniz sobre una serie de malas hierbas frecuentes y problemáticas en la agricultura mediterránea. Los resultados obtenidos han permitido demostrar que la codorniz es fundamentalmente predadora de semillas de malas hierbas, eliminando cerca del...

  18. Atividade de fungos sobre ovos, larvas e oocistos de parasitas de ungulados silvestres e do cão

    Cruz, Rita Magalhães da

    2015-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária Nas últimas décadas, surgiram novos problemas tais como o agravamento de resistências a anti-helmínticos e os consequentes efeitos adversos que o seu uso abusivo pode trazer para o ambiente e para os produtos alimentares. Recorrer a um método de controlo biológico dos parasitas com a utilização de fungos telúricos nematófagos surge como uma alternativa muito promissora. Neste trabalho, foi investigada a eficácia do fungo predador...

  19. Fitofagia de Podisus nigrispinus em algodoeiro e plantas daninhas Phytophagy by Podisus nigrispinus on cotton plants and weeds

    Walter Santos Evangelista Júnior; Manoel Guedes Correa Gondim Junior; Jorge Braz Torres; Edmilson Jacinto Marques

    2004-01-01

    O objetivo deste trabalho foi avaliar o efeito de seis plantas daninhas e do algodoeiro no desenvolvimento, reprodução e sobrevivência do percevejo predador Podisus nigrispinus (Dallas) (Heteroptera: Pentatomidae) sob escassez parcial de presas, alimentação em intervalos de três dias, e ausência total de presas. Com escassez parcial de presas, o desenvolvimento ninfal foi maior em Ricinus communis e menor em Bidens pilosa. Viabilidade dos ínstares, peso de fêmeas, período de pré-oviposição e ...

  20. Seletividade de atrazine e nicosulfuron a Podisus nigrispinus (Heteroptera: Pentatomidae) Selectivity of atrazin and nicosulfurom to Podisus nigrispinus (Heteroptera: Pentatomidae)

    C.W.G. Menezes; J.B. Santos; S.L. Assis Júnior; A.J. Fonseca; A.C. França; M. A. Soares; A.F Fernandes

    2012-01-01

    O milho tem sido cultivado em duas safras anuais no Brasil e consumido por humanos e animais. O uso de herbicidas no controle de plantas daninhas nessa cultura pode comprometer o ambiente em função dos efeitos sobre organismos não alvos. O objetivo deste trabalho foi avaliar a seletividade de atrazine e nicosulfuron sobre o predador Podisus nigrispinus. Os tratamentos constaram da aplicação de atrazine, nicosulfuron e da mistura destes, em doses equivalentes à comercial, mais um tratamento co...

  1. Respuestas fenotípicas en larvas de anuros a situaciones cambiantes en los factores bióticos y abióticos

    Gómez, Valeria Isabel

    2012-01-01

    Las respuestas fenotípicas son, comúnmente, respuestas adaptativas de los organismos que por lo general se mantienen por selección natural. Por lo tanto, el conocimiento de la estructura de una población exige saber cómo influyen los diferentes factores bióticos y abióticos -grado de cambio ambiental, presencia de predadores y competidores- sobre los organismos, teniendo en cuenta sus ciclos de vida y las estrategias evolutivas involucradas. Las larvas de anfibios son organismos muy intere...

  2. Efeito do manejo de plantas daninhas sobre Neoseiulus californicus (Acari:Phytoseiidae) em pomar de macieira Effect of weed management on Neoseiulus californicus (Acari:Phytoseiidae) in apple orchard

    Lino Bittencourt Monteiro; Luiz Belli; Alexander Souza; André Luiz Werner

    2002-01-01

    Avaliou-se a influência do manejo de plantas daninhas sobre o deslocamento de ácaros tetraniquídeos (Panonychus ulmi e Tetranychus urticae) e do ácaro predador Neoseiulus californicus em um pomar de macieira 'Gala', onde foi implantado o controle biológico do ácaro vermelho, P. ulmi, por meio de liberações massais de N. californicus. As parcelas tiveram as plantas daninhas manejadas de três formas: sem manejo, com roçadas manuais e com herbicidas. As populações de ácaros foram avaliadas sobre...

  3. Evaluación de la actividad entomopatogénica de hongos obtenidos del Páramo de Guerrero (Finca Puente de Tierra) Zipaquirá, Colombia

    Sánchez Nieves Jimena; Ascencio Ramírez Andrea Marcela

    2006-01-01

    El estudio y conservación de enemigos naturales en agroecosistemas conlleva a largo plazo a la regulación de
    insectos plaga, proporcionando un ambiente apropiado para incrementar la abundancia y eficacia de predadores
    y parásitos. El control biológico constituye una estrategia efectiva dentro de programas de manejo integrado de plagas y enfermedades (MIPE), garantizando control a bajo costo y con un mínimo o inexistente impacto ambiental. El objetivo del presente estudio...

  4. NÍVEL DE INFESTAÇÃO DA BROCA DOS CITROS, Diploschema rotundicolle (SERVILLE, 1834) EM CINAMOMO E PLANTAS CÍTRICAS, EM SANTA MARIA - RS

    Dionísio Link; Ervandil Corrêa Costa

    1994-01-01

    RESUMO Aspectos da biologia e frequência de infestação de Diploschema rotundicolle (Serville, 1834) foram estudados em cinamomo e plantas cítricas, em Santa Maria - RS, durante os anos de 1989 e 1990. Há preferência para oviposição em citros. O ciclo evolutivo é maior em citros que em cinamomo. Emergem menos adultos em citros que em cinamomo. Há maior incidência de predadores nas galerias larvais, nas plantas cítricas.

  5. Phylogenetic and transcriptomic analysis of chemosensory receptors in a pair of divergent ant species reveals sex-specific signatures of odor coding.

    Xiaofan Zhou

    Full Text Available Ants are a highly successful family of insects that thrive in a variety of habitats across the world. Perhaps their best-known features are complex social organization and strict division of labor, separating reproduction from the day-to-day maintenance and care of the colony, as well as strict discrimination against foreign individuals. Since these social characteristics in ants are thought to be mediated by semiochemicals, a thorough analysis of these signals, and the receptors that detect them, is critical in revealing mechanisms that lead to stereotypic behaviors. To address these questions, we have defined and characterized the major chemoreceptor families in a pair of behaviorally and evolutionarily distinct ant species, Camponotus floridanus and Harpegnathos saltator. Through comprehensive re-annotation, we show that these ant species harbor some of the largest yet known repertoires of odorant receptors (Ors among insects, as well as a more modest number of gustatory receptors (Grs and variant ionotropic glutamate receptors (Irs. Our phylogenetic analyses further demonstrate remarkably rapid gains and losses of ant Ors, while Grs and Irs have also experienced birth-and-death evolution to different degrees. In addition, comparisons of antennal transcriptomes between sexes identify many chemoreceptors that are differentially expressed between males and females and between species. We have also revealed an agonist for a worker-enriched OR from C. floridanus, representing the first case of a heterologously characterized ant tuning Or. Collectively, our analysis reveals a large number of ant chemoreceptors exhibiting patterns of differential expression and evolution consistent with sex/species-specific functions. These differentially expressed genes are likely associated with sex-based differences, as well as the radically different social lifestyles observed between C. floridanus and H. saltator, and thus are targets for further functional

  6. A new species of Symbra (Hymenoptera, Eurytomidae, Heimbrinae from dry forest in Brazil and new occurrence records for other Heimbrinae Uma nova espécie de Symbra (Hymenoptera, Eurytomidae, Heimbrinae de uma área de Caatinga e novos registros de ocorrência de outros Heimbrinae

    Daniell Rodrigo Rodrigues Fernandes

    2012-12-01

    Full Text Available The geographic ranges of Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 and H. parallela Stage & Snelling, 1986 are extended based on study of material deposited in the entomological collections of the Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brazil of the Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brazil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae is described, illustrated and compared with S. cordobensis Stage & Snelling, 1986, the single species previously known for this genus. A key to the genera of Heimbrinae and to the species of Symbra is provided.Os limites geográficos de Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 e H. parallela Stage & Snelling, 1986 são estendidos com base no material examinado das coleções entomológicas do Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brasil e do Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brasil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae é descrita, ilustrada e comparada com a única espécie conhecida desse gênero, S. cordobensis Stage & Snelling, 1986. Uma chave para os gêneros de Heimbrinae e para as espécies de Symbra é fornecida.

  7. ESPÉCIES DE HISTERIDAE COLETADAS EM PIRACICABA, SP

    S.R. RODRIGUES

    1998-01-01

    Full Text Available Besouros predadores da família Histeridae foram coletados através do uso de armadilhas "pitfall" iscadas com massa fecal fresca de bovinos instaladas em área de pastagem em Piracicaba, SP. Coletaram-se durante o período de 15 de abril de 1995 a 17 de fevereiro de 1996, quatro espécies identificadas como Hister punctifer, Phelister panamensis, P. haemorrhous e P. rufinotus. A espécie P. panamensis é um importante predador de ovos e larvas de Haematobia irritans e representou 72,93% do total de insetos coletados.Histeridae beetles were collected using pitfall traps baited with cattle manure, placed in a pasture area in Piracicaba, SP, Brazil. The following species were collected from April 15th 1995 to February 17th 1996.: Hister punctifer, Phelister panamensis, P. haemorrhous and P. rufinotus. The species P. panamensis, an important predator of the horn fly, Haematobia irritans, represented 72,93% of all insects collected.

  8. Períodos de ausência de presas e estabilidade do controle biológico do ácaro-rajado Periods of prey absence and stability of the spider mite biological control

    Hamilton Oliveira

    2007-08-01

    Full Text Available O objetivo deste trabalho foi avaliar os parâmetros biológicos do ácaro predador Phytoseiulus macropilis na ausência de alimento por períodos de um a seis dias. Foram avaliados: o número de ovos por fêmea ao dia; o número total de ovos; a longevidade de fêmeas; e a razão sexual dos descendentes. Fêmeas que ficaram por mais de três dias sem alimento apresentaram queda em todas variáveis biológicas avaliadas. O predador P. macropilis somente se estabelecerá em campo se as manchas ocupadas pelo ácaro-rajado não estiverem muito distantes umas das outras.The objective of this work was to access the biological parameters of the predator mite Phytoseiulus macropilis in the food absence for periods of one or more days. Data evaluated were: egg number per female per day; total number of eggs; longevity of females; and the offspring sex rate. Female in starvation for three or more days showed decrease in all biological variables. P. macropilis only will settle in the field if patch populations occupied by spider mite are not very distant from each other.

  9. Food habits of bobcats in eastern Tennessee

    Story, J.D.; Galbraith, W.J.; Kitchings, J.T.

    1982-01-01

    Food habits of bobcats (Lynx rufus) in eastern Tennessee were determined from analyzing 176 cat samples collected on the Oak Ridge National Environmental Research Park. Remains of cottontail rabbits (Sylvilagus floridanus) were the most frequently occurring food item. White-tail deer (Odocoileus virginianus) and pine vole (Microtus pinetorum) remains also were found frequently in samples. Data obtained from this study indicated that food preferences for bobcats in eastern Tennessee are similar to those in other southeastern states where the habitat is similar to the Oak Ridge area and somewhat different from those with significantly different habitat.

  10. Parasites of cottontail rabbits of southern Illinois.

    Lepitzki, D A; Woolf, A; Bunn, B M

    1992-12-01

    Fifteen species of parasites including Haemaphysalis leporispalustris, Ixodes dentatus, Amblyomma americanum, Cediopsylla simplex, Odontopsyllus multispinosus, Cuterebra sp., Obeliscoides cuniculi, Trichostrongylus calcaratus, Trichostrongylus affinis, Longistriata noviberiae, Dermatoxys veligera, Trichuris sp., Mosgovoyia sp., Taenia pisiformis, and Hasstilesia tricolor as well as coccidia oocysts were collected from 96 cottontail rabbits (Sylvilagus floridanus) confined to a pen in southern Illinois in 1983 and 1984. The diversity of parasites and the intensities of infections were similar to published reports on free-ranging populations. Most variations in parasite abundances were attributable to season. Few lesions were seen in association with parasitism. PMID:1491303

  11. Epizootiology of an outbreak of cerebrospinal nematodiasis in cottontail rabbits and woodchucks.

    Jacobson, H A; Scanlon, P F; Nettles, V F; Davidson, W R

    1976-07-01

    An epizootic of cerebrospinal nematodiasis in cottontail rabbits (Sylvilagus floridanus) and woodchucks (Marmota monax) caused by Baylisascaris procyonis larvae followed the establishment of an ascarid-infected raccoon (Procyon lotor) population in a woodlot. Five of seven raccoons examined from the woodlot harbored ascarids, with one heavily infected animal shedding approximately 27,500 eggs per gram of feces. A laboratory-reared cottontail rabbit developed neurologic disease due to larval migration 80 days after infection with B. procyonis eggs from the raccoons. PMID:16498877

  12. Arrangement of repetitive sequences in the genome of herpesvirus Sylvilagus.

    Medveczky, M M; Geck, P; Clarke, C; Byrnes, J; Sullivan, J L; Medveczky, P G

    1989-02-01

    Herpesvirus sylvilagus is a lymphotropic (type gamma) herpesvirus of cottontail rabbits (Sylvilagus floridanus). Analysis of virion DNA of herpesvirus sylvilagus has revealed that the genome consists of one stretch of about 120 kilobase pairs of internal, unique DNA flanked by a variable number of 553-base-pair tandem repeats. The G + C content of the repetitive DNA is extremely high (83%), as determined by sequencing. The organization of the herpesvirus sylvilagus genome is, therefore, similar to that of the primate lymphotropic viruses herpesvirus saimiri and herpesvirus ateles. PMID:2911114

  13. Serum antibody prevalence for Herpesvirus sylvilagus, Bacillus piliformis and California serogroup arboviruses in cottontail rabbits from Pennsylvania.

    Dressler, R L; Ganaway, J R; Storm, G L; Tzilkowski, W M

    1988-04-01

    A serologic survey of 60 eastern cottontail rabbits (Sylvilagus floridanus) from three counties in Pennsylvania was conducted in March 1983. Serum antibody prevalences for Herpesvirus sylvilagus and La Crosse virus (California serogroup) were less than 4%. There was no evidence of previous exposure to either Jamestown Canyon or snowshoe hare viruses (California serogroup). Antibody to trivittatus virus (California serogroup) was found in 60% of the 20 cottontails from York County. No cottontails had antibodies to Bacillus piliformis, the etiologic agent of Tyzzer's disease. PMID:3373643

  14. Genetic differentiation among cottontails from isolated playa basins.

    Van den Bussche, R A; Hamilton, M J; Chesser, R K; Scribner, K T

    1987-11-30

    Protein variation in 182 Sylvilagus floridanus from 19 playa basins in Castro Co., Texas was examined using starch-gel electrophoresis. Heterozygote deficiencies were noted for all populations. This heterozygote deficiency may be due to differential selection against heterozygous individuals over the winter months. Results of F-statistics indicated a significant degree of population differentiation at six loci. Nei's genetic distance between populations ranged from 0.20 to 0.388 and a significant association between genetic distance and linear geographic distance among playas was found. These results suggest that genetic exchange and long-distance dispersal may be hindered by expanses of unsuitable habitat. PMID:3504804

  15. Circular Herpesvirus sylvilagus DNA in spleen cells of experimentally infected cottontail rabbits.

    Medveczky, P; Kramp, W J; Sullivan, J L

    1984-11-01

    Cottontail rabbits (Sylvilagus floridanus) were infected with Herpesvirus sylvilagus, and spleen cells were analyzed for the presence of virus-specific, covalently closed circular, and linear DNA molecules by a simple electrophoretic technique, followed by transfer to nitrocellulose filters and hybridization with cloned viral DNA (Gardella et al., J. Virol. 50:248-254, 1984). Approximately 0.2 copies per cell of circular DNA and 0.2 copies per cell of linear DNA were detected by hybridization with a cloned viral DNA fragment. The size of the viral DNA was estimated at ca. 158 kilobase pairs. Restriction endonuclease patterns suggested structural similarities to cottontail herpesvirus DNA. PMID:6092696

  16. Descubrimiento de mamíferos fósiles de edad lujanense (pleistoceno tardío) en el "desierto" de la tatacoa (huila, colombia)

    Villaroel A., Carlos; Brieva B., Jorge; Cadena, Alberto

    2012-01-01

    Se da a conocer el descubrimiento de una pequeña cuenca sedimentaria con mamíferos fósiles, en el lugar denominado Los Hoyos, dentro del ámbito del "desierto" de La Tatacoa. Aunque los estudios taxonómicos de los fósiles no están aún completos, no cabe duda de que se trata, de dos formas afines a especies vivientes, identificadas como Sylvilagus aff. floridanus y Tayassu aff. tajacu , y una tercera forma, referida a la familia Gomphotheriidae. Con base en esta pequeña fauna, se data el yacimi...

  17. Hematology and serum chemistry of cottontail rabbits of southern Illinois.

    Lepitzki, D A; Woolf, A

    1991-10-01

    In 1983 and 1984 blood was collected from 79 cottontail rabbits (Sylvilagus floridanus) confined to an outdoor enclosure in southern Illinois to establish reference values for hematology and serum chemistry. Packed cell volume, sodium, potassium, chloride, glucose, calcium, carbon dioxide, blood urea nitrogen, creatinine, uric acid, cholesterol, albumin, bilirubin, alkaline phosphatase, aspartate transaminase, alanine aminotransaminase, total protein, albumin/globulin ratio, and osmolality were measured. Sex and age (adult versus juvenile) of rabbit as well as season (June to September versus October to May) and method of capture (trap versus shot) variously affected most hematology and serum chemistry variables. PMID:1758030

  18. Sarcocystis and related organisms in Australian Wildlife: IV. Studies on Sarcocystis cuniculi in European rabbits (Oryctolagus cuniculus).

    Munday, B L; Smith, D D; Frenkel, J K

    1980-04-01

    The role of the cat (Felis domestica) as a definitive host for Sarcocystis cuniculi of European rabbits (Oryctolagus cuniculus) was confirmed. It was shown that after dosing with sporocysts from cats, rabbits developed sarcocysts and these became infective for cats at not less than 93 days post-infection (p.i.). The earliest infection detected was at 142 days p.i. Infected muscle from an experimental rabbit did not transmit Sarcocystis when fed to other rabbits. Microscopically, sarcocysts in European rabbits (O. cuniculus) were morphologically indistinguishable from those in cottontail rabbits (Sylvilagus floridanus). PMID:6776293

  19. Dicty_cDB: CHP858 [Dicty_cDB

    Full Text Available lkskqtlymi*fql wyfqlvllikrillnl*tl*chsfkvknlsvnqiinilisxevvesvnllieanqkllal ikqtkdfnsehslatflnq...X248584 |BX248584.1 Blochmannia floridanus complete genome; segment 1/3. 32 0.021 10 BX842643 |BX842643.1 Mycoplasma...KRKKX--- ---hyvsfvkrxser*klvvdklhsikslkih*fnmfvlfsmvmvivvigknspnlev*q iyhrlqrl*qiltlkrilnsflkvifshqlnwnhvkrfslkfiinq...ESS ***, 10 unordered pieces. 40 0.10 5 AC007178 |AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 ma....0 %: nuclear 28.0 %: cytoplasmic 24.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: plasma membran

  20. Do captive-born greater rheas Rhea americana Linnaeus (Rheiformes, Rheidae remember antipredator training? Emas Rhea americana Linnaeus (Rheiformes, Rheidae se lembram do treinamento anti-predação?

    Cristiano S. de Azevedo

    2006-03-01

    Full Text Available The antipredator training is a powerful tool now being used to help the reintroduced animals to recognise and escape from their predators. Testing the memory capacity of the animals after antipredator training is important to evaluate if the application of the training is worthwhile. A group of 15 captive-born greater rheas was studied at Belo Horizonte Zoo. Eight birds were antipredator trained and seven birds were not. After the end of the antipredator training sessions, we run four memory tests at 40, 55, 70 and 88 days after training was completed. The memory tests consisted of showing a predator model to the rheas and recording their behavioural responses. It was measured the capacity of antipredator information storage, the influence of the group size on the behaviour of the birds and the influence of the antipredator training on the elicitation of the correct behavioural responses of the birds when confronted by a predator. The results showed that the rheas retained predator recognition for almost three months, that the group size affected the responses of the birds (more defence behaviours expressed when tested alone and that the antipredator training is essential to elicit the adequate antipredatory responses, since untrained birds behaved in a tranquil manner when confronted by a predator model. We concluded that antipredator training is worthwhile for future reintroduction programs for greater rheas, since their memory capacity is considerable.O treinamento anti-predação é uma ferramenta poderosa usada atualmente para ajudar os animais reintroduzidos a reconhecer e escapar de seus predadores. Testar a capacidade de memória dos animais após o treinamento é importante para se avaliar a validade de sua aplicação. Um grupo de 15 emas nascidas em cativeiro foi estudado no zoológico de Belo Horizonte. Oito aves foram treinadas contra predadores e sete não. Após o término dos treinamentos, foram realizados quatro testes de mem

  1. Systematic position of some nearctic Heligmosomoidea (Nematoda: Trichostrongylina) from the U.S. National Parasite collection and their description.

    Durette-Desset, Marie-Claude; Digiani, Maria Celina

    2005-08-01

    The systematic position of some heligmosomoid nematodes from rodents, deposited in the U.S. National Parasite Collection (USNPC), is revised, mainly through the study of their synlophe, which in all cases was unknown or insufficiently described. The material was registered as different species of Longistriata Schulz, 1926, a genus whose representatives are only parasitic in Holarctic insectivores. Longistriata norvegica Dikmans, 1935, parasitic in Rattus sp. becomes a synonym of Hassalstrongylus aduncus (Chandler, 1932). Specimens registered as Longistriata dalrymplei Dikmans, 1935, from Ondatra zibethicus, are confirmed to belong to Carolinensis (Travassos, 1937). Specimens registered as Longistriata noviberiae Dikmans, 1935, parasitic in Sylvilagus floridanus alacer, were found to belong to Vexillata, and Vexillata noviberiae n. comb. is here proposed. This is the first record of a species of Vexillata in a lagomorph. Other specimens registered as Longistriata norvegica, parasitic in Geomys floridanus austrinus, were also found to be an undescribed species of Vexillata (Hall, 1916), which is named Vexillata chitwoodi n. sp. This is similar to Vexillata chabaudi Yoyotte-Vado, 1972, Vexillata petteri Durette-Desset, 1970, Vexillata scorzai Guerrero, 1984 and Vexillata tejerai Guerrero, 1984, all having the same number of cuticular ridges (4 dorsal, 5 ventral) and the division of the dorsal ray at its apex. The most related species is V. chabaudi, which is differentiated from the new species by rays 4 not curved distally, by thick rays 8, and by a dorsal ray enlarged at the level of the arising of rays 8. PMID:17089761

  2. Monitorização do coelho-bravo na Reserva Natural da Serra da Malcata : 1998-2007

    Paula, Anabela Salvado

    2007-01-01

    O Coelho-bravo, Oryctolagus cuniculus, é uma espécie chave nos ecossistemas mediterrâneos ibéricos, desempenhando uma multiplicidade de papéis na dinâmica dos mesmos, dos quais de destaca o facto de ser principal “espécie presa” de um largo espectro de predadores, como por exemplo o Lince-ibérico e a Águia-imperial, e ser uma das principais espécies cinegéticas em Portugal. Na Reserva Natural da Serra da Malcata – RNSM, as suas populações têm sofrido um acentuado declínio, r...

  3. A new species of Symbra (Hymenoptera, Eurytomidae, Heimbrinae from dry forest in Brazil and new occurrence records for other Heimbrinae

    Daniell Rodrigo Rodrigues Fernandes

    2012-12-01

    Full Text Available The geographic ranges of Heimbra opaca (Ashmead, 1894, H. bicolor Subba Rao, 1978 and H. parallela Stage & Snelling, 1986 are extended based on study of material deposited in the entomological collections of the Laboratório de Sistemática e Bioecologia de Parasitoides e Predadores da APTA (Ribeirão Preto, SP, Brazil of the Instituto Brasileiro de Geografia e Estatística (Brasília, DF, Brazil. Symbra potiguara Perioto & Fernandes sp. nov. (Hymenoptera, Eurytomidae is described, illustrated and compared with S. cordobensis Stage & Snelling, 1986, the single species previously known for this genus. A key to the genera of Heimbrinae and to the species of Symbra is provided.

  4. Selección natural sobre a cor das flores de Gentiana lutea L.

    Veiga Blanco, Tania

    2015-01-01

    A variación floral dentro dunha de especie pode resultar da variación espacial nos axentes de selección. A cor floral podería variar pola selección dos animais que se alimentan das plantas. Os polinizadores poderían exercer selección natural sobre a cor, si a cor inflúe na eficacia do consumo. Outros axentes de selección, como os predadores de sementes, poderían seleccionar sobre a cor, si a cor indica recursos alimentarios (sementes) ou si a cor está relacionada con defensas químicas. Así, a...

  5. Hemiptera acuáticos asociados a los estuarios de la costa pacífica colombiana Aquatic Hemiptera associated to estuaries of the colombian pacific coast

    DORA N. PADILLAGIL; OSVALDO ARCOS P.

    2011-01-01

    la mayoría de los hemípteros acuáticos son insectos predadores que habitan en agua dulce, estuarios y mar. Las familias que incluyen especies de hábitat salobres y estuarios son Gerridae y Veliidae. Con el fin de contribuir al conocimiento faunístico y ecológico de los hemípteros acuáticos asociados a los estuarios de la Costa Pacífica de Colombia y de la región del Chocó biogeográfico, se estudiaron seis estuarios del municipio de Tumaco: El Bajito, El Morro, Villa del Sol, Agua clara, Chilv...

  6. Categorização funcional trófica das comunidades de macroinvertebrados de dois reservatórios na região Centro-Oeste do Estado de São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v31i1.331 Functional feeding groups of benthics macroinvertebrates communities of two lentic systems in the central west region of São Paulo State - DOI: 10.4025/actascibiolsci.v31i1.331

    Jandira Liria Biscalquini Talamoni; Gustavo Mayer Pauleto; Fabio Laurindo da Silva; Sonia Silveira Ruiz

    2009-01-01

    A utilização do conceito de guilda pode ser útil para a categorização funcional trófica de comunidades, pois não há obrigatoriedade da identificação dos organismos em nível de espécie, nem de tratar cada espécie como uma entidade separada. O objetivo deste estudo foi analisar os grupos funcionais tróficos (coletores-catadores, coletores-filtradores, fragmentadores, predadores e raspadores) das comunidades de macroinvertebrados de dois reservatórios da região Centro-Oeste do Estado de São Paul...

  7. Ecological Roles of Coleoptera Associated with Carcasses in Caatinga

    Wellington Santos

    2013-12-01

    Resumo. O papel ecológico da coleopterofauna associada a carcaças de porcos em uma área de Caatinga foi examinado. Para captura desses insetos foram utilizadas armadilhas do tipo bandeja, pitfall e Shannon modificada, durante duas estações (seca e chuvosa. 4.851 coleópteros foram coletados, pertencentes a 19 famílias e 88 espécies. A categoria ecológica mais abundante foi predador/parasita (72,7%, seguida por onívoro (15,1%, necrófago (10,9% e incidental (1,3%. Futuros estudos sobre biologia das espécies predadoras/parasitas são necessários para se determinar sua possível utilidade forense na estimativa do intervalo pós-morte.

  8. Dieta de Leopardus colocolo (Carnivora: Felidae en la Reserva Nacional de Junín, Junín, Perú

    Ursula Fajardo

    2014-05-01

    Full Text Available Este estudio caracteriza la dieta de Leopardus colocolo en los alrededores del lago Junín, en el centro del Perú, a partir de los restos de las presas presentes en 43 heces. El origen de las heces del predador se determinó a partir del ADN mitocondrial de las células epiteliales intestinales adheridas a la superficie de las heces, utilizando como marcador la región de control. Los restos de las presas fueron identificados utilizando literatura especializada y la comparación con especímenes de colección, identificando un total of 14 ítems alimenticios pertenecientes a mamíferos de las familias Cricetidae (6, Chinchillidae (1 y Caviidae (1 y aves de las familias Anatidae (3 y Rallidae (2, y un grupo de aves no identificadas (1. Los roedores fueron el principal componente de la dieta de L. colocolo, en frecuencia y biomasa, seguido por las aves. Entre los ítems alimenticios consumidos, el roedor cricétido pequeño Calomys sp. fue el más frecuente; sin embargo, el mayor aporte de biomasa relativa fue proporcionado por el roedor mediano Cavia tschudii. La amplitud de nicho obtenida fue baja (Bsta= 0.17, indicando una dieta especializada. Nuestros resultados confirman que, como ocurre con la mayoría de felinos pequeños neotropicales, L. colocolo es un predador especializado en la captura de vertebrados, principalmente mamíferos pequeños. No se registró variación estacional en la dieta y el análisis de las clases de edad de los roedores cricétidos mostró que los adultos fueron los más consumidos. Se infiere que L. colocolo tiene un patrón de actividad diurno y nocturno.

  9. Feeding of Pellona flavipinnis (Clupeiformes, Pristigasteridaein a Central Amazonian floodplain Dieta de Pellona flavipinnis (Clupeiformes, Pristigasteridae em planície alagada da Amazônia Central

    Sandra S. Moreira-Hara

    2009-06-01

    Full Text Available The feeding habits of Pellona flavipinnis (Valenciennes, 1836 at Catalão, a floodplain area on the Brazilian Central Amazon was studied. Data was obtained during three hydrological cycles, between September 1999 and September 2003. Diet composition, daily and seasonal variation in the feeding activity and the relationship between predator's size and its prey were analyzed. Almost 80% of the food consumed has autochthonous origin and diet was composed basically by insects and fish. Juvenile fish predominated in the stomach contents of all size classes but there was no significant relationship between predator's size and its prey. Pellona flavipinnis may be considered a carnivorous species which feeds mainly on juvenile (young-of-the-year specimens of other fish. More intense feeding activity occurred at night and in the high water period.Os hábitos alimentares de Pellona flavipinnis (Valenciennes, 1836 de uma área de várzea na Amazônia Central, Catalão, foram estudados. Foram utilizados dados referentes a três ciclos hidrológicos, entre setembro de 1999 e setembro de 2003. Foram analisados a dieta, a atividade alimentar diária e sazonal e a relação entre o comprimento da presa e o do predador. Cerca de 80% dos alimentos consumidos eram de origem autóctone e a dieta composta basicamente de insetos e peixes. Peixes juvenis predominaram nos conteúdos estomacais de exemplares de todas as classes de tamanho, mas não houve relação significativa entre o tamanho do predador e o das presas consumidas. Pellona flavipinnis pode ser considerada uma espécie carnívora que se alimenta principalmente de indivíduos juvenis de outras espécies de peixes. A atividade alimentar foi maior durante a noite e no período da cheia.

  10. The almost invisible league: crypsis and association between minute fishes and shrimps as a possible defence against visually hunting predators

    Lucélia Nobre Carvalho

    2006-06-01

    Full Text Available Camouflage is one of the most widespread defence modes used by substrate-dwelling animals, whereas transparency is generally found in open-water organisms. Both these defence types are regarded as effective against visually guided predators. We present here three assemblages of similarly-sized freshwater fish and shrimp species which apparently rely on camouflage and transparency to evade some of their potential predators. In one of the associations, there is a transition from cryptic colours and translucency to transparency of the component species according to the position each of them occupies in the habitat. The likeness between the fishes and the shrimps is here regarded as a type of protective association similar to numerical or social mimicry. Additionally, we suggest that the assemblage may contain Batesian-like mimicry components.Camuflagem é um dos tipos de defesa mais bem distribuídos entre os animais que vivem no substrato, sendo a transparência geralmente encontrada em organismos pelágicos. Ambos os tipos de defesa são considerados como eficientes contra predadores visualmente orientados. Apresentamos três conjuntos de espécies de peixes e camarões de tamanhos similares, que aparentemente dependem da camuflagem e transparência para escapar de potenciais predadores. Em uma das associações, há uma transição de coloração críptica ou translúcida para transparente, de acordo com a posição que cada espécie ocupa no habitat. A semelhança entre peixes e camarões é aqui considerada como um tipo de associação protetiva, similar a mimetismo numérico ou social. Além disso, sugerimos que o conjunto pode conter elementos similares ao mimetismo Batesiano.

  11. A non-digging zoobenthivorous fish attracts two opportunistic predatory fish associates

    Cristina Sazima

    2005-09-01

    Full Text Available Following behaviour among reef fishes involves mostly a digging nuclear species while foraging, which attracts opportunistic followers preying on the exposed organisms. The flying gurnard Dactylopterus volitans preys on benthic animals, mostly crustaceans and small fishes, scratching and probing the bottom with the inner rays of its pectoral fins. We recorded the flying gurnard being followed by two opportunistic predators, the yellow jack Caranx bartholomaei and the coney Cephalopholis fulva at Fernando de Noronha, off northeast Brazil. Albeit not actually digging the substrate, the flying gurnard acts as a nuclear species by exploring algae tufts and by its wandering near the boulders and ledges, disturbing and flushing out hidden animals which thus become available to predation.Entre os peixes recifais, uma espécie fossadora nuclear em atividade de forrageamento pode atrair seguidores oportunistas que se alimentam de organismos expostos pela atividade do nuclear. O coió-voador Dactylopterus volitans alimenta-se de animais bentônicos, principalmente crustáceos e pequenos peixes, explorando o substrato com os primeiros raios externos de suas nadadeiras peitorais. Registramos o coió sendo seguido por dois predadores oportunistas, a guarajuba Caranx bartholomaei e a piraúna Cephalopholis fulva, em Fernando de Noronha, ao largo da costa Nordeste do Brasil. Apesar de não agir como uma espécie fossadora do substrato, o coió atua como uma espécie nuclear por explorar os tufos de algas e também pela sua passagem próxima às rochas e lajes, espantando e desentocando animais escondidos que, assim, tornam-se vulneráveis aos predadores.

  12. Nutritional upgrading for omnivorous carpenter ants by the endosymbiont Blochmannia

    Mueller Martin J

    2007-10-01

    Full Text Available Abstract Background Carpenter ants (genus Camponotus are considered to be omnivores. Nonetheless, the genome sequence of Blochmannia floridanus, the obligate intracellular endosymbiont of Camponotus floridanus, suggests a function in nutritional upgrading of host resources by the bacterium. Thus, the strongly reduced genome of the endosymbiont retains genes for all subunits of a functional urease, as well as those for biosynthetic pathways for all but one (arginine of the amino acids essential to the host. Results Nutritional upgrading by Blochmannia was tested in 90-day feeding experiments with brood-raising in worker-groups on chemically defined diets with and without essential amino acids and treated or not with antibiotics. Control groups were fed with cockroaches, honey water and Bhatkar agar. Worker-groups were provided with brood collected from the queenright mother-colonies (45 eggs and 45 first instar larvae each. Brood production did not differ significantly between groups of symbiotic workers on diets with and without essential amino acids. However, aposymbiotic worker groups raised significantly less brood on a diet lacking essential amino acids. Reduced brood production by aposymbiotic workers was compensated when those groups were provided with essential amino acids in their diet. Decrease of endosymbionts due to treatment with antibiotic was monitored by qRT-PCR and FISH after the 90-day experimental period. Urease function was confirmed by feeding experiments using 15N-labelled urea. GC-MS analysis of 15N-enrichment of free amino acids in workers revealed significant labelling of the non-essential amino acids alanine, glycine, aspartic acid, and glutamic acid, as well as of the essential amino acids methionine and phenylalanine. Conclusion Our results show that endosymbiotic Blochmannia nutritionally upgrade the diet of C. floridanus hosts to provide essential amino acids, and that it may also play a role in nitrogen recycling

  13. Dicty_cDB: Contig-U09515-1 [Dicty_cDB

    Full Text Available 3( AM086400 |pid:none) Staphylococcus simulans pSCFS4 pla... 41 0.074 ( Q00357 ) RecName: Full=Putative HC-toxin...07( AM238664 |pid:none) Streptomyces ambofaciens ATCC 2... 41 0.097 CP001019_129( CP001019 |pid:none) Coxiel...pid:none) Bacillus cereus subsp. cytotoxi... 48 8e-04 BX248583_225( BX248583 |pid:none) Blochmannia floridanus co...U928167_421( CU928167 |pid:none) Kluyveromyces thermotolerans str... 46 0.002 ( P02980 ) RecName: Full=Tetracycline resistance prot...41( CU928180 |pid:none) Kluyveromyces thermotolerans str... 43 0.020 CP000323_195

  14. Avaliação da infestação e diversidade de Teredinidae (Mollusca - Bivalvia ao longo da costa do estado do Rio de Janeiro, Brasil Evaluation of the infestation and diversity of Teredinidae (Mollusca - Bivalvia along the coast of Rio de Janeiro State, Brazil

    Andrea de O. R. Junqueira

    1989-01-01

    Full Text Available In order to evaluate the diversity and infestation level of Teredinidae wood-boring molluscs, ten satations were chosen along the coast of Rio de Janeiro State. Using five pine-wood panels in each station, it was possible to distinguish five areas according to species dominance. Ilha Grande Bay is characterized by the dominance of Lyrodus floridanus (Bartsch, 1922; Sepetiba Bay, by Bankia fimbriatula Moll & Roch, 1931, Tijuca Lagoon by Teredo navalis Linnaeus, 1758; Guanabara Bay by Notoredo knoxi (Bartsch, 1917 and Araruama Lagoon by Teredo furcifera Martens, 1894. Specific composition and dominance of these species were due mainly to abiotic factors such as salinity whereas infestation level was associated not only to salinity but also to other factors such as the quantity and quality of fouling, the presence of larval dispersion focus and the wood supply in each area.

  15. [Diversity and microstructure of quitons (Mollusca: Polyplacophora) from the Caribbean of Costa Rica].

    García-Ríos, Cedar I; Alvarez-Ruiz, Migdalia

    2011-03-01

    Diversity and microstructure of quitons (Mollusca: Polyplacophora) from the Caribbean of Costa Rica. The polyplacophorans of the coral reef on the Caribbean coast of Costa Rica have been insufficiently studied. The examination of coral rubble accumulated in the shallow sublitoral waters on four collection stations in Provincia Limón revealed a higher diversity of chitons than was documented. From the country eight species were previously known: Ischnochiton erythronotus (C.B. Adams 1845); Ischnoplax pectinata (Sowerby 1840); Stenoplax boogii (Haddon 1886); S. purpurascens (C.B. Adams 1845); Acanthopleura granulata (Gmelin 1791); Chiton marmoratus Gmelin 1791; C. tuberculatus Linnaeus 1758 and Acanthochitona rhodea (Pilsbry 1893). This study added five more species that are reported here for the first time: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954 and Cryptoconchus floridanus (Dall 1889). PMID:21516641

  16. Cuticular Hydrocarbon Pheromones for Social Behavior and Their Coding in the Ant Antenna

    Kavita R. Sharma

    2015-08-01

    Full Text Available The sophisticated organization of eusocial insect societies is largely based on the regulation of complex behaviors by hydrocarbon pheromones present on the cuticle. We used electrophysiology to investigate the detection of cuticular hydrocarbons (CHCs by female-specific olfactory sensilla basiconica on the antenna of Camponotus floridanus ants through the utilization of one of the largest family of odorant receptors characterized so far in insects. These sensilla, each of which contains multiple olfactory receptor neurons, are differentially sensitive to CHCs and allow them to be classified into three broad groups that collectively detect every hydrocarbon tested, including queen and worker-enriched CHCs. This broad-spectrum sensitivity is conserved in a related species, Camponotus laevigatus, allowing these ants to detect CHCs from both nestmates and non-nestmates. Behavioral assays demonstrate that these ants are excellent at discriminating CHCs detected by the antenna, including enantiomers of a candidate queen pheromone that regulates the reproductive division of labor.

  17. Comparative infectivity of Babesia divergens and a zoonotic Babesia divergens-like parasite in cattle.

    Holman, Patricia J; Spencer, Angela M; Telford, Sam R; Goethert, Heidi K; Allen, Andrew J; Knowles, Donald P; Goff, Will L

    2005-11-01

    Babesia divergens-like parasites identified in human babesiosis cases in Missouri and Kentucky and in eastern cottontail rabbits (Sylvilagus floridanus) on Nantucket Island, Massachusetts, share identical small subunit ribosomal RNA gene sequences. This sequence is 99.8% identical to that of Babesia divergens, suggesting that the U.S. parasite may be B. divergens, a causative agent of human and bovine babesiosis in Europe. Holstein-Friesian calves were inoculated with cultured Nantucket Island Babesia sp. (NR831) and B. divergens parasites and monitored by clinical signs, Giemsa-stained blood films, PCR, and culture. The NR831 recipients did not exhibit clinical signs of infection and remained negative for all assays. The B. divergens recipients developed clinical infections and became positive by all assays. NR831 recipients were fully susceptible upon challenge inoculation with B. divergens. This study confirms that the Nantucket Island Babesia sp. is not conspecific with B. divergens based on host specificity for cattle. PMID:16282295

  18. Herpesvirus sylvilagus infects both B and T lymphocytes in vivo.

    Kramp, W J; Medveczky, P; Mulder, C; Hinze, H C; Sullivan, J L

    1985-10-01

    Herpesvirus sylvilagus infection of cottontail rabbits (Sylvilagus floridanus) was studied as a model of herpesvirus-induced lymphoproliferative disorders. Leukocytosis, splenomegaly, proliferation of T cells and virus production by lymphocytes characterized this infectious mononucleosis-like disease. Approximately two copies of circular herpesvirus sylvilagus genomes per cell were detected in spleen cells at 2 weeks postinfection, and circular genomes could still be observed after 4 months. Circular viral genomes were found in both B and T lymphocytes. Small amounts of linear viral DNA (0.1 to 0.3 copies per cell) were also detected in both B and T cells. These results indicated that the virus did not replicate in the majority of lymphocytes in vivo. Herpesvirus sylvilagus infection in cottontail rabbits could be useful as a model for studying the complex virus-host relationships of lymphotropic herpesviruses and perhaps as an animal model for Epstein-Barr virus infection in humans. PMID:2993667

  19. First report of Obeliscoides cuniculi in European brown hare (Lepus europaeus).

    Tizzani, Paolo; Menzano, Arianna; Catalano, Stefano; Rossi, Luca; Meneguz, Pier Giuseppe

    2011-09-01

    Obeliscoides cuniculi is a New World nematode parasite of the Trichostrongilidae family infecting the gastric tract of different domestic and wild Lagomorph species. This parasite is reported for the first time from a European brown hare (Lepus europaeus). The nematodes isolated from the gastro-intestinal tract were identified using the primary characteristics used to differentiate the species of this genus as adults morphology (length and thickness) and other characteristics of spicules, cervical papillae, cuticular ridges and striations. In the Italian study area, the European brown hare lives in sympatry with the eastern cottontail (Sylvilagus floridanus), species in which the nematode was previously isolated; therefore, the possibility of a cross-infestation must be considered. PMID:21484345

  20. Herpesvirus sylvilagus in cottontail rabbits: attempted laboratory transmission by two insect species.

    Spieker, J O; Yuill, T M

    1977-01-01

    The vector potential of the rabbit flea (Cediopsylla simplex) and a mosquito (Aedes triseriatus) was investigated for Herpesvirus sylvilagus transmission among cottontail rabbits (Sylvilagus floridanus). Twelve groups of 12-50 fleas were fed on three viremic cottontails for 2-21 days before transfer to 12 susceptible rabbits. Standard interrupted feeding trials employed five groups of 6-12 mosquitoes, two viremic donor cottontails anf five healthy recipients. No evidence of virus was detected from recipients' blood nor did they develop specific antibody. Virus acquisition and persistence in the insects was evaluated by attempting to recover the virus from 19 pools of mosquitoes engorged on viremic blood and 36 pools of engorged fleas or those living on viremic hosts for 1-21 days. Results were negative. PMID:190425

  1. Metazoan parasites of the eastern cottontail rabbit in western Kentucky.

    Strohlein, D A; Christensen, B M

    1983-01-01

    Forty-five eastern cottontail rabbits (Sylvilagus floridanus Allen), collected over a 15 mo period from two areas of western Kentucky, were examined for disease conditions, helminth and arthropod parasites. A single lymphosarcoma, two cutaneous papillomas and the following parasites were identified: Hasstilesia tricolor, Taenia pisiformis, Cittotaenia variabilis, Raillietina stilesiella, Obeliscoides cuniculi, Trichuris leporis, Longistriata noviberiae, Trichostrongylus calcaratus, Dermatoxys veligera, Odontopsyllus multispinosus, Cediopsylla simplex, Haemaphysalis leporispalustris, Ixodes dentatus, Amblyomma americanum, and Dermacentor variabilis. Simpson's Indices indicated that parasite communities were fairly diverse, with some degree of dominance exhibited by O. cuniculi, T. pisiformis and H. leporispalustris. The parasite faunas of rabbits from the two areas were similar. Hasstilesia tricolor was associated with the absence of kidney fat. PMID:6842731

  2. A homologue of the rabbit kappa-chain allotype b9 ON IgG from a cottontail rabbit.

    Tosi, S L; Mage, R G; Tosi, R M

    1976-08-01

    Eight out of 12 anti-b9 antisera tested strongly bound 125IgG of only one of four individual cottontail rabbits (Sylvilagus floridanus). In addition to this apparent polymorphism of a b9 homologue in cottontail rabbits, a polymorphism defined by some anti-b5 antisera was found. Three of 15 anti-b5 antisera reacted with IgG from only two of the four cottontail rabbits. Reactions with anti-b4 and anti-b6 were similar to those with hare IgG. Most anti-b4 and anti-b6 antisera bound the IgG from each animal. The cottontails we tested also resembled the hare with respect to their weak reactivity with some anti-a2 antisera (Vh allotype) and strong reactivity with anti-15 (an allotype localized in the Fc portion of rabbit gamma-chains). PMID:820806

  3. Genome structure of cottontail rabbit herpesvirus.

    Cebrian, J; Berthelot, N; Laithier, M

    1989-02-01

    The genome structure of a herpesvirus isolated from primary cultures of kidney cells from the cottontail rabbit Sylvilagus floridanus was elucidated by using electron microscopy and restriction enzyme analysis. The genome, which was about 150 kilobase pairs long and which had an average G + C composition of 45%, consisted of two regions with unique base sequences (54 and 47 kilobase pairs) enclosed by reiterations of a 925-base-pair sequence with a variable copy number. The internal repeats were in opposite polarity with respect to the terminal repeats, and both unique regions underwent inversion. The nucleotide sequence of the repeat unit was determined, and virion DNA termini were precisely localized within this sequence. Elements showing homology with the cleavage-packaging signals common to other herpesviruses were detected. The data indicate that this virus is different from the previously described herpesvirus sylvilagus. PMID:2911115

  4. Aversive responses of white-tailed deer,Odocoileus virginianus, to predator urines.

    Swihart, R K; Pignatello, J J; Mattina, M J

    1991-04-01

    We tested whether predator odors could reduce winter browsing of woody plants by white-tailed deer (Odocoileus virginianus). Urine from bobcats (Lyra rufus) and coyotes (Canis latrans) significantly reduced browsing of Japanese yews (Taxus cuspidata), and repellency was enhanced when urine was reapplied weekly as a topical spray. Urine of cottontail rabbits (Sylvilagus floridanus) and humans did not reduce damage, suggesting that deer do not respond aversively to odors of nonpredatory mammals or occasional predators with which they lack a long evolutionary association. Bobcat and coyote urine were more effective in tests conducted with eastern hemlock (Tsuga canadensis), which is less palatable to white-tailed deer than Japanese yew. A dichloromethane extract of bobcat urine was as effective as unextracted urine in reducing damage to hemlocks. Testing of the organic components of bobcat urine, particularly the volatile components, may enable identification of the compounds responsible for the repellency we observed. PMID:24258921

  5. Ascorbic acid and L-gulonolactone oxidase in lagomorphs.

    Jenness, R; Birney, E C; Ayaz, K L

    1978-01-01

    1. The activity of L-gulonolactone oxidase (EC 1.1.3.8) in the liver of eastern cottontail rabbits (Sylvilagus floridanus) is about 10-fold greater in winter than in summer. 2. L-gulonolactone oxidase activity is low and tissue ascorbate high during all seasons in snowshoe hares (Lepus americanus). 3. Liver contents of ascorbate fall to low levels in L. americanus fed on rabbit chow in the laboratory. 4. The activity of L-gulonolactone oxidase in liver of Sylvilagus and Oryctolagus is depressed by feeding high levels of L-ascorbic acid. 5. The New Zealand White breed of domestic rabbit (Oryctolagus cuniculus) has considerably higher levels of L-gulonolactone oxidase and liver ascorbate than does the Dutch breed. 6. In a wild population of Oryctolagus sampled in Australia L-gulonolactone oxidase levels were intermediate between those of the two domestic breeds and more variable than either. PMID:318384

  6. Plasma osmotic and electrolyte concentrations of largemouth bass from some acidic Florida lakes

    Canfield, D.E. Jr.; Maceina, M.J.; Nordlie, F.G.; Shireman, J.V.

    1985-05-01

    Five acidic clear (pH 3.7-4.9), three acidic colored (pH 4.1-4.6), and three neutral (pH 6.9-7.3) north-central Florida lakes were surveyed in 1983 to determine plasma osmotic and electrolyte concentrations, growth, and coefficients of condition for largemouth bass Micropterus salmoides floridanus. Plasma osmotic concentrations averaged greater than 273 milliosmoles/kg in fish from acidic colored and circumneutral lakes, but averaged less than 269 milliosmoles/kg in four of the acidic clear lakes. Growth and coefficients of condition of largemouth bass > 305 mm total length in the acidic lakes were significantly lower than in the neutral lakes. Reductions in fish growth and condition, however, could be related to either acidic conditions or lake trophic status. 29 references, 3 tables.

  7. A review of Gongylonema spp. (Nematoda: Gongylonematidae) in North American rodents with description of a new species from the cotton rat, Sigmodon hispidus (Mammalia: Cricetidae).

    Kinsella, John M; Robles, Maria Del Rosario; Preisser, Whitney C

    2016-01-01

    Gongylonema archboldi n. sp. (Nematoda: Gongylonematidae) is described from tunnels in the gastric mucosa of the stomach of the cotton rat (Sigmodon hispidus) from Highlands County, Florida, U.S.A. Measurements are also given for specimens from cotton mice (Peromyscus gossypinus), oldfield mice (Peromyscus polionotus), Florida mice (Podomys floridanus), and golden mice (Ochrotomys nuttalli) from the same locality. Additional specimens were collected from the cotton rat and the rice rat (Oryzomys palustris) from Berry Island, San Patricio County, Texas. The new species is differentiated from congeners by a combination of the following characters: length of the left spicule, length and shape of the gubernaculum, distribution of cuticular bosses, length of esophagus, and distance of the vulva from the posterior end. The status of the genus Gongylonema in North American rodents is reviewed. PMID:27394819

  8. A Century of Shope Papillomavirus in Museum Rabbit Specimens.

    Escudero Duch, Clara; Williams, Richard A J; Timm, Robert M; Perez-Tris, Javier; Benitez, Laura

    2015-01-01

    Sylvilagus floridanus Papillomavirus (SfPV) causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus) from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, and whether SfPV occurs throughout the host range, or just in the Midwest. Secondary aims were to detect distinct strains, and evidence for strain spatio-temporal specificity. We found 20 of 1395 rabbits in the KU collection SfPV symptomatic. Three of 17 lagomorph species (S. nuttallii, and the two known hosts) were symptomatic, while Brachylagus, Lepus and eight additional Sylvilagus species were not. 13 symptomatic individuals were positive by molecular testing, including the first S. nuttallii detection. Prevalence of symptomatic individuals was significantly higher in Sylvilagus (1.8%) than Lepus. Half of these specimens came from Kansas, though new molecular detections were obtained from Jalisco-Mexico's first-and Nebraska, Nevada, New Mexico, and Texas, USA. We document the oldest lab-confirmed case (Kansas, 1915), pre-dating Shope's first case. SfPV amplification was possible from 63.2% of symptomatic museum specimens. Using multiple methodologies, rolling circle amplification and, multiple isothermal displacement amplification in addition to PCR, greatly improved detection rates. Short sequences were obtained from six individuals for two genes. L1 gene sequences were identical to all previously detected sequences; E7 gene sequences, were more variable, yielding five distinct SfPV1 strains that differing by less than 2% from strains circulating in the Midwest and Mexico, between 1915 and 2005. Our results do not clarify whether strains are host species specific, though

  9. Pragas e inimigos naturais na soja e no milho cultivados em sistemas diversificados Pests and their natural enemies on soybean and corn grown in diversified systems

    Francisco Jorge Cividanes

    2002-12-01

    Full Text Available A consorciação de culturas e o plantio direto podem influenciar a dinâmica populacional de insetos, aumentando ou diminuindo a densidade populacional de pragas e de inimigos naturais. Deste modo, avaliaram-se os efeitos de sistemas de plantio direto e da consorciação soja [Glycine max (L. Merrill] e milho (Zea mays L. sobre as populações de insetos-pragas e inimigos naturais. Os tratamentos constituíram um fatorial 3x2 (monocultura de soja, monocultura de milho, consorciação soja-milho em plantio direto e plantio convencional. Os insetos foram amostrados pelo método do pano, rede entomológica e procura visual. No milho, a ocorrência de insetos-pragas da parte aérea e insetos predadores não foi influenciada pelo manejo do solo. Lagartas de Helicoverpa zea ocorreram em maior número (5,1 no milho em consorciação. Na soja, adultos de Anticarsia gemmatalis e do predador Cycloneda sanguinea foram mais abundantes em plantio direto, respectivamente, 0,4 e 2,4 insetos. Observou-se maior número do sirfídeo Toxomerus sp. em plantio convencional (1,3. Nas condições de consorciação, verificou-se baixo número de Diabrotica gracilenta (11,5 na soja, enquanto que Maecolaspis sp. (5,0 e Megascelis sp. (17,0 e os predadores C. sanguinea (2,3, Doru sp. (0,8, Geocoris sp. (1,5 e Toxomerus sp. (1,4 ocorreram em alta densidade.Intercropping and no-tillage systems can affect the population dynamics of insects, increasing or decreasing the population density of pests and natural enemies. The objective of this study was to evaluate the effects of no-tillage and strip intercropping of soybean [Glycine max (L. Merrill] and corn (Zea mays L. on the abundance of insect pests and their natural enemies. Plots were arranged in a randomized complete block design in a 3 x 2 factorial experiment (soybean monoculture, corn monoculture, strip intercropping of soybean-corn under no-tillage and conventional tillage. Insects were sampled using sweep net

  10. Análise crítica dos sistemas neurais envolvidos nas respostas de medo inato Critical analysis of the neural systems organizing innate fear responses

    Newton Sabino Canteras

    2003-12-01

    Full Text Available O nosso entendimento das bases neurofisiológicas da reação emocional do medo baseia-se em grande parte nos estudos que envolvem respostas condicionadas a estímulos fisicamente aversivos, como, por exemplo, o choque elétrico nas patas. Enquanto este paradigma parece ser útil para avaliarmos os sistemas neurais envolvidos na resposta do, assim chamado, medo condicionado (que tipicamente tem se limitado à observação da resposta de congelamento, este paradigma parece ter sérias limitações para investigarmos as bases neurais das respostas de medo em circunstancias naturais. Trabalhos recentes utilizando técnicas de lesões neurais bem como de mapeamento funcional em animais expostos a predadores naturais, ou somente ao odor destes predadores, revelam uma série de estruturas neurais como responsáveis pelas respostas de medo inato, bastante distintas daquelas previamente implicadas nas respostas de condicionamento aversivo. Como revisto no presente trabalho, entre estas estruturas temos distritos diferenciados da zona medial do hipotálamo; setores específicos da amídala e do sistema septo-hipocampal, envolvidos, respectivamente no processamento de pistas relacionadas à presença do predador e na análise contextual do ambiente; e setores da matéria cinzenta periaquedutal, já classicamente envolvidos na expressão de respostas de defesa. Estas informações podem ser potencialmente importantes para a análise e terapêutica de psicopatologias relacionadas aos distúrbios da reação emocional de medo.Unconditioned emotional responses elicited by exposure to a predator have served as the prototypical exemplar for analyses of the behavioral biology of fear-related emotionality. However, the primary research model for the study of fear has involved shock-based cue and context conditioning. While these shock-based models have provided a good understanding of neural systems regulating specific conditioned fear-related behaviors

  11. Fitoseídeos (Acari: Phytoseiidae associados a cafezais e fragmentos florestais vizinhos Phytoseiids (Acari: Phytoseiidae associated to coffee plantations and adjacent forest fragments

    Ester Azevedo Silva

    2010-10-01

    Full Text Available Existem poucas informações sobre a fauna de ácaros predadores (Phytoseiidae em ambientes naturais brasileiros adjacentes a agroecossistemas cafeeiros (Coffea spp. ou sobre a influência que essa vegetação exerce como reservatório de ácaros predadores. Neste estudo, objetivou-se avaliar a diversidade destes organismos em cafeeiros e fragmentos florestais adjacentes. Coletaram-se amostras das espécies Calyptranthes clusiifolia (Miq. O. Berg (Myrtaceae, Esenbeckia febrifuga (A. St.-Hil. A. Juss. ex Mart. (Rutaceae, Metrodorea stipularis Mart. (Rutaceae e Allophylus semidentatus (Miq. Radlk. (Sapindaceae, em oito fragmentos florestais, de 5 a 51 ha, e cafezais adjacentes, nos meses de junho (final período chuvoso e outubro (final período seco nos anos 2004 e 2005, na região Sul do Estado de Minas Gerais. Ácaros foram extraídos das folhas, utilizando o método de lavagem e, em seguida, montados em lâminas de microscopia em meio de Hoyer, para identificação específica. No total foram identificados 2.348 fitoseídeos, sendo 2.090 nos fragmentos florestais e 258 espécimes nos cafezais adjacentes, pertencentes a 38 espécies. Servindo-se de análise faunística, a espécie Iphiseiodes zuluagai Denmark & Muma, 1972 apresentou os melhores índices no agroecossistema cafeeiro, sendo muito frequente e constante nas épocas estudadas. Nos fragmentos florestais Amblyseius herbicolus Chant, 1959, Iphiseiodes affs. neonobilis Denmark & Muma, 1978, Leonseius regularis DeLeon, 1965 e Euseius alatus DeLeon, 1966 foram dominantes, muito abundantes, muito frequentes e constantes nas épocas estudadas. Podemos concluir que a vegetação nativa abriga ácaros predadores, inimigos naturais de ácaros-praga, que ocorrem na cultura cafeeira, possibilitando o desenvolvimento de programas de manejo ecológico com áreas de vegetação natural e agroecossistemas cafeeiros adjacentes.There is little information about the fauna of predatory mites

  12. Alterations on piscivorous diet following change in abundance of prey after impoundment in a Neotropical river

    Geuza Cantanhêde

    2008-12-01

    . pantaneiro consumiu 41 presas, enquanto que no período II foram registradas 14 presas, sendo que M. dichroura foi a presa mais consumida, passando a representar 95% da dieta, enquanto no período I representava apenas 15%. A relação entre o tamanho do predador e da presa foi positiva em ambos os períodos, porém significativamente diferente. No período II pequenos e grandes predadores consumiram principalmente pequenas presas (M. dichroura. Os resultados mostraram que A. pantaneiro consumiu, no período II, a presa mais abundante e disponível, alterando a composição de sua dieta, amplitude do nicho alimentar e tamanho da presa. Estas alterações provavelmente causaram um decréscimo nos custos energéticos associados à procura da presa, maximizando o ganho de energia do predador.

  13. Fitofagia de Podisus nigrispinus em algodoeiro e plantas daninhas Phytophagy by Podisus nigrispinus on cotton plants and weeds

    Walter Santos Evangelista Júnior

    2004-05-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de seis plantas daninhas e do algodoeiro no desenvolvimento, reprodução e sobrevivência do percevejo predador Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae sob escassez parcial de presas, alimentação em intervalos de três dias, e ausência total de presas. Com escassez parcial de presas, o desenvolvimento ninfal foi maior em Ricinus communis e menor em Bidens pilosa. Viabilidade dos ínstares, peso de fêmeas, período de pré-oviposição e fecundidade foram similares entre as plantas, porém o peso de machos e longevidade de fêmeas foram reduzidos em Desmodium tortuosum e R. communis, respectivamente. Com base nos parâmetros de tabela de vida foi estimada melhor performance do predador em Amaranthus hybridus, D. tortuosum e R. communis. Ninfas submetidas à escassez total de presas viveram mais em Ageratum conyzoides, B. pilosa, D. tortuosum e Euphorbia heterophylla; porém não viveram além do terceiro ínstar. A longevidade de fêmeas do predador foi favorecida pela presença de A. conyzoides em relação a Gossypium hirsutum, vivendo em média 15,7 e 29,8 dias, respectivamente. No entanto, a disponibilidade de plantas não foi suficiente para as fêmeas atingirem maturação sexual e produção de ovos, quando submetidas à escassez total de presas.This work evaluated the effect of six weeds and cotton plants on predatory stinkbug Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae development, reproduction and survival under partial prey scarcity, three days feeding intervals, and total absence of prey. Nymphal developmental periods under partial prey scarceness with three days of feeding intervals were higher on Ricinus communis and lower on Bidens pilosa. Partial prey scarcity did not affect nymphal viability, adult female weight and reproductive characteristics, but male weight and female longevity were reduced in Desmodium tortuosum and R. communis, respectively

  14. Impact and Selectivity of Insecticides to Predators and Parasitoids

    Flávio Lemes Fernandes

    2010-04-01

    Full Text Available Problems with the use of insecticides has brought losses, such as, negative impact on natural enemies. When these beneficial insects reduce cause the eruption of pests and resurgence it’s more common. Thus principles of conservation these arthropods are extremely important in the biological natural control of pests, so that these enemies may present a high performance. Because of the negative impacts caused by insecticides on agriculture and their harmful effects on natural enemies, the objective of this article is to approach two important subjects, divided into three parts. Part I relates to the description of the main crop pests and their natural enemies; Part II involves the impact of insecticides on predators and parasitoids and Part III focuses on the selectivity of several groups of insecticides to natural enemies. Before spraying insecticides, it is necessary to choose a product that is efficient to pests and selective to natural enemies. So, it is indispensable to identify correctly the groups and species of natural enemies, since insecticides have an impact on their survival, growth, development, reproduction (sexual ratio, fecundity, longevity and fertility, and behavior (motility, orientation, feeding, oviposition and learning of insects. The mechanisms of toxicity and selectivity of insecticides are related to the properties of higher or lower solubility and molecular weight. Besides, characteristics of the cuticular composition of the integument of natural enemies are extremely important in the selectivity of a product or the tolerance of a certain predator or parasitoid to this molecules.Impacto e Seletividade de Inseticidas para Predadores e ParasitóidesResumo.Dentre os problemas advindos do uso de inseticidas, a destruição de inimigos naturais é fator importante. Estes insetos benéficos podem reduzir problemas de erupção de pragas secundárias, ressurgência de pragas e manter a praga abaixo do nível de dano econ

  15. Diet of four annual killifishes: an intra and interspecific comparison

    Gabriel Laufer

    2009-03-01

    Full Text Available We examined the diet of 4 annual fishes, Austrolebias viarius, Austrolebias cheradophilus, Austrolebias luteoflammulatus and Cynopoecilus melanotaenia inhabiting temporal ponds of southeastern Uruguay, by analysis of stomach contents. Fishes were captured from fifty ephemeral ponds of Castillos Lagoon basin, in the region of the Humedales del Este. We identified 13099 individual prey items extracted from 669 stomachs of the four captured species. In the studied system, annual killifishes represents the most abundant and conspicuous top predators. Killifishes are generalist key predators at the ephemeral ponds of the studied system, consuming mostly aquatic items. Zooplancton represented the bulk of the diet in the four analyzed species, followed by eggs, algae and diatoms. Insects are the next group in prey number, as follows: Diptera larvae (especially Chironomidae and Cullicidae, Ephemeroptera (especially Betidae, and coleopteran larvae (especially Dytiscidae. Acari are also important prey in number. The four fish species differ in diet composition and in diet richness. A general pattern of differences in diet richness among killifish species and demographic groups could be related to variations in body sizes. As top predators annual killifishes are an important component of the temporal pond ecosystems. Understanding the natural history of this species and their communities is necessary in order to conserve them.Nós examinamos a dieta de 4 peixes anuais, Austrolebias viarius, Austrolebias cheradophilus, Austrolebias luteoflammulatus e Cynopoecilus melanotaenia, que habitam poças temporárias do sudeste do Uruguai, através da análise de conteúdo estomacal. Os peixes foram capturados em cinco poças temporárias da bacia da lagoa Castillos, na região de Humedales del Este. Nós identificamos 13099 itens de presas estraídos de 669 estômagos das quatro espécies. No sistema estudado, peixes anuais representam os predadores de topo mais

  16. Variação espaço-temporal na distribuição e abundância de Moenkhausia sanctaefilomenae (Characiformes: Characidae em lagoas da planície de inundação do rio Cuiabá, Pantanal, Brasil=Spatial-temporal variation of the distribution and abundance of Moenkhausia sanctaefilomenae at lagoons of the Cuiaba river floodplain, Pantanal, Brazil

    Jerry Penha

    2012-01-01

    Full Text Available Identificar os fatores bióticos e abióticos que determinam a variação na distribuição e abundância das populações, tornou-se nos últimos anos um grande desafio para os ecologistas. Assim neste estudo foram avaliados o efeito das variáveis abióticas e a abundância de predadores sobre a abundância de Moenkhausia sanctaefilomenae, a variação no comprimento médio dos indivíduos entre lagoas e períodos e o efeito das variáveis abióticas e da abundância de predadores sobre a estrutura em comprimento. Foram amostradas 16 lagoas da planície de inundação do rio Cuiabá, no período de junho (vazante, setembro (seca e dezembro (enchente de 2005 e março (cheia de 2006. Para M. sanctaefilomenae, a distribuição é mais ampla e a abundância é maior no final da vazante, início da seca, reduzindo-se gradualmente ao longo dos períodos de seca, enchente e cheia. Adicionalmente, o período afeta a estrutura em tamanho das populações, que são espacialmente homogêneas. Indivíduos menores foram capturados no final do período de vazante e os maiores ao início da enchente. Durante o final da vazante/início da seca, a variação espacial na abundância da população foi relacionada positivamente com o pH, o oxigênio dissolvido e cobertura de macrófitas e área da lagoa, mas, não com a abundância local de predadores na zona litorânea das lagoas.Identifying the biotic and abiotic factors that determine the variation in the distribution and abundance of populations has become a great challenge for the field of ecology in recent years. Thus, in this study we evaluated the effect of abiotic variables and the abundance of predators on the abundance of Moenkhausia sanctaefilomenae, the variation in the average length of the individuals between lakes and periods, and the effect of the abiotic variables and abundance of predators on the structure in length of that species. Sixteen lakes of the Cuiabá river flood plain were sampled

  17. Activity, habitat use, feeding behavior, and diet of four sympatric species of Serranidae (Actinopterygii: Perciformes in southeastern Brazil

    Fernando Zaniolo Gibran

    2007-09-01

    serranídeos são predadores oportunistas que utilizam um total de nove táticas diferentes para capturar suas presas, alimentando-se principalmente de crustáceos durante o dia e crepúsculo, e permanecendo estacionários e inativos durante a noite. Um estudo ecomorfológico foi empregado para testar seu valor preditivo. Foi verificado que tal abordagem deve ser utilizada com cautela e sempre complementada com observações diretas no ambiente. Apesar de morfologicamente e comportamentalmente muito semelhantes, D. formosum e D. radiale mostraram divergências com relação ao tipo de substrato preferido pelos maiores indivíduos, que são exclusivamente predadores de espreita. Por outro lado, E. marginatus mostrou possuir hábitos de vida mais sedentários do que M. acutirostris, o mais versátil predador dentre as espécies estudadas. As espécies de Diplectrum estudadas, assim como E. marginatus, podem ser classificadas como serranídeos bentônicos, enquanto que M. acutirostris pode ser classificada como uma espécie nectobentônica.

  18. Ecological aspects of a Cosmopolites sordidus (Germar (Coleoptera: Curculionidae population in São Miguel do Iguaçu, PR./ Aspectos ecológicos da população de Cosmopolites sordidus, (Germar (Coleoptera: Curculionidae em São Miguel do Iguaçu, PR

    Cristiane Rohde

    2006-06-01

    Full Text Available The population dynamics of Cosmopolites sordidus (Germar was studied in banana crops (cultivar Nanicão at São Miguel do Iguaçu, PR, using roof-tile-like baits, between June/2003 and May/2004. Adults infected by entomopathogenic fungi were recorded, and predators were also found on the baits. A comparative bioassay was carried out between the Beauveria bassiana isolate obtained from the experiment area and from other regions in Brazil against C. sordidus adults. The population peaks of C. sordidus adults occurred in June and July, a period with mild temperatures and low precipitation. The population of C. sordidus larvae, however, was concentrated in December. The insect predators found in the area were insects of the following orders: Coleoptera (Carabidae, Dermaptera (Forficulidae, Hemiptera (Reduviidae, Hymenoptera (Formicidae, and spiders of the families Ctenidae, Clubionidae, and Lycosidae, with a population peak two months after the pest population peak. A low number of C. sordidus adults infected by B. bassiana was found, with an annual mean of 0.44%. In the laboratory, the B. bassiana isolates were pathogenic to the insects.Estudou-se a dinâmica populacional de Cosmopolites sordidus (Germar em cultivo de banana(cultivar Nanicão, em São Miguel do Iguaçu, PR, através de iscas do tipo telha, entre junho/2003 a maio/2004. Atribuiu-se conceito ao estado de conservação da isca, visando observar sua durabilidade e atratividade. Registraram-se adultos infectados por fungos entomopatogênicos, sendo também encontrados predadores nas iscas. Realizou-se um bioensaio com isolados de Beauveria bassiana da área experimental e de Centros de Pesquisa do Brasil, para avaliar a patogenicidade em C. sordidus. Verificou-se que os picos populacionais de adultos de C. sordidus ocorreram em junho e julho, período de temperaturas amenas e baixas precipitações, enquanto que as larvas foram mais abundantes em dezembro. Os insetos predadores

  19. Parasitismo natural em ovos crisopídeos Natural egg parasitism of chrysopids

    Maria Alice de Medeiros

    2009-02-01

    Full Text Available Os predadores, em geral, apresentam hábitos generalistas e por isso podem ser usados em programas de controle biológico, em diferentes agroecossistemas. A sobrevivência dos predadores é afetada por diversos fatores, como, por exemplo, a presença de parasitóides. Este trabalho foi conduzido com os objetivos de identificar os parasitóides de crisopídeos, especialmente os parasitóides de ovos, e determinar o nível de parasitismo natural. As amostragens foram feitas na Embrapa Hortaliças, em campos de milho-doce, de setembro/1997 a fevereiro/1998. Os ovos de crisopídeos foram coletados semanalmente, sendo individualizados em cápsulas de gelatina até a emergência da larva e/ou do parasitóide. Foram coletados 800 ovos de crisopídeos, sendo que em 71% dos ovos, as larvas sobreviveram; 9% dos ovos foram considerados inviáveis e 20% foram parasitados por seis espécies de microhimenópteros. Destes, 57% foram parasitados por Telenomus sp. (Scelionidae, 32% por Trichogramma pretiosum (Trichogrammatidae, 6% por Oencyrtus chrysopae Crawford (Encyrtidae e 5% por Aprostocetus sp. (Eulophidae.Most predators, in general, have generalist habits and can be used as biological control agents in several crops. Predator survival is affected by several factors, such as occurrence of parasitoids. The main purpose of this research was to identify the parasitoids of chrysopids, especially egg parasitoids and their level of parasitism. The samples were taken in a sweet-corn field at Embrapa Hortaliças from September/1997 to February/1998. The chrysopids eggs were collected weekly and then individualized in gelatine capsules until larval or parasitoid emergency. A total of 800 eggs were collected. The predator emerged from 71% of the eggs, 9% were inviable eggs and the other 20% were parasitized by six species of microhymenopterans. Among these, 57% were parasitized by Telenomus sp. (Scelionidae, 32% were parasitized by Trichogramma pretiosum

  20. Impact and Selectivity of Insecticides to Predators and Parasitoids

    Flávio Fernandes

    2010-04-01

    Resumo.Dentre os problemas advindos do uso de inseticidas, a destruição de inimigos naturais é fator importante. Estes insetos benéficos podem reduzir problemas de erupção de pragas secundárias, ressurgência de pragas e manter a praga abaixo do nível de dano econômico. Dessa forma a conservação de inimigos naturais, para que os mesmos exerçam alta performance frente às pragas, é de extrema importância em controle biológico de pragas. Método de controle essencial utilizados nos programas de manejo integrado de pragas. Tendo em vista os impactos negativos dos inseticidas na agricultura e os seus efeitos adversos sobre os inimigos naturais, este artigo visa abordar dois assuntos importantes, que para isso é dividido em três partes. A parte I relacionada com o reconhecimento das principais pragas agrícolas e seus inimigos naturais; a parte II envolve o impacto dos inseticidas sobre os predadores e parasitóides e a parte III abordará sobre a seletividade dos diversos grupos de inseticidas aos inimigos naturais. Antes de se pulverizar inseticida é necessário a escolha de um produto que seja seletivo e eficiente, assim torna-se imprescindível identificar de forma correta os grupos e espécies de inimigos naturais. Uma vez que os inseticidas apresentam impacto sobre a sobrevivência, o crescimento e desenvolvimento, na reprodução (razão sexual, fecundidade, longevidade e fertilidade, no comportamento (mobilidade, orientação, alimentação, oviposição e aprendizado. Os mecanismos de toxicidade e seletividade dos inseticidas estão relacionados às propriedades de maior ou menor solubilidade e peso molecular. Além disso, características da composição cuticular do integumento dos inimigos naturais são de extrema importância na seletividade de um produto ou a tolerância de determinado predador ou parasitóide.

  1. Influência de sistemas de produção sobre a ocorrência de inimigos naturais de afídeos em pomares de pessegueiros em Araucária-PR Influence of systems of production on the occurrence of natural enemies of aphids on orchards of peach trees in Araucaria-PR

    Joselia Maria Schuber

    2008-06-01

    Full Text Available A pressão da sociedade tem forçado a adoção de sistemas de produção de frutas mais sustentáveis e de menor impacto ambiental. O objetivo deste trabalho foi verificar a influência dos sistemas de produção de Boas Práticas Agrícolas (BPA e Convencional (PC sobre a diversidade de inimigos naturais de afídeos presentes em seis pomares de pessegueiros no município de Araucária-PR, de julho de 2005 a setembro de 2006. O levantamento do número de inimigos naturais foi realizado por meio de cinco métodos de amostragens: visual em plantas de pessegueiros e em plantas invasoras; armadilhas Möericke; funil e adesivas. No sistema BPA, foram coletados mais espécimes de inimigos naturais (53%, em relação aos pomares PCs (46%, havendo a ocorrência, em ambos, de predadores das famílias Syrphidae, Coccinellidae e Chrysopidae e parasitóides da ordem Hymenoptera. Do total de inimigos naturais coletados, verificou-se a ocorrência de maior quantidade de predadores de afídeos.The pressure of the society has forced the adoption of more sustainable fruit production systems and with less environmental impact. The objective of this work was to verify the influence of production systems of Good Agricultural Practices (GAP and Conventional Production (CP, about the diversity of natural enemies of aphids present on six orchards of peach trees in the city of Araucaria, PR, from July 2005 to September 2006. The evaluation of the number of natural enemies of aphid's species was made by means of five sampling methods: visual in plants of peach trees; visual in invading plants; yellow water traps of Möericke type; funnel and adhesive traps. In the system GPA, more specimens of natural enemies had been collected (53% in relation to orchards CP (46%, having the occurrence, in both orchards, of predators of the Syrphidae, Coccinellidae and Chrysopidae family and parasitoids of Hymenoptera order. Concerning the total of collected natural enemies, it was

  2. Comparação econômica entre controle biológico e químico para o manejo de ácaro-vermelho em macieira Economic comparison of biological and chemical control in the management of red spider mites in apple orchard

    Lino Bittencourt Monteiro

    2006-12-01

    Full Text Available O ácaro-vermelho da macieira, Panonychus ulmi (Acari: Tetranychidae, é uma importante praga na cultura da macieira em Fraiburgo - SC, e o controle biológico aplicado foi implantado em meados dos anos 90. O objetivo deste trabalho foi demonstrar os benefícios econômicos da utilização do controle biológico no manejo do ácaro-vermelho. A avaliação foi realizada em dois pomares comerciais de macieiras. Em um deles, foi implantado o controle biológico aplicado de ácaros, baseado na liberação do ácaro predador Neoseiulus californicus (Acari: Phytoseiidae, seleção de inseticidas e manejo de ervas invasoras, e o outro pomar seguiu o manejo convencional de artrópodes, baseado na aplicação de produtos químicos para o controle de insetos, ácaros fitófagos e ervas invasoras. A análise econômica mostrou que os custos com mão-de-obra e máquinas foram semelhantes em ambos os pomares, entretanto os custos com acaricidas foram significativamente inferiores no pomar onde o manejo foi o controle biológico, demonstrando que, apesar da necessidade de investimentos em instalações para a criação do ácaro predador e custos de manutenção das mesmas, a estratégia biológica foi economicamente viável.Red spider mite, Panonychus ulmi (Acari: Tetranychidae is a significant pest in apple tree in Fraiburgo, Santa Catarina (SC and applied biological control was implemented in the mid-nineties. The objective of this study was to demonstrate the economic benefits of biological control in the management of red spider mite. The assessment was carried out in two commercial orchards, one of which was subjected to biological control of spider mite by releasing the predator Neoseiulus californicus, insecticide selection and weed management, and the other to conventional arthropod management, based on the application of chemicals to control insects, phytofagous mites and weed. Economic analysis showed that the costs for labor and machines were

  3. Faunistic survey of sandstone caves from Altinópolis region, São Paulo State, Brazil

    Douglas Zeppelini Filho

    2003-01-01

    Full Text Available The fauna of eight sandstone caves of the region of Altinópolis, (Serra Geral Arenitic Speleological province, São Paulo State, Southeastern Brazil was surveyed. Our results improve the previous faunistic knowledge of the region, recording 15 new occurrences for Brazilian caves and 26 for Brazilian sandstone caves. The fauna is characterized by a large number of detritivores/omnivores such as crickets and cockroaches, and several predators like spiders and heteropterans in bat guano.A fauna de oito cavernas areníticas da região de Altinópolis (província espeleológica arenítica da Serra Geral, Estado de São Paulo, Sudeste do Brasil foi amostrada. Nossos resultados aumentaram o conhecimento faunístico prévio da região, com o registro de 15 novas ocorrências para cavernas brasileiras e 26 para cavernas brasileiras em arenito. A fauna é caracterizada por um grande número de detritívoros/carnívoros tais como grilos e baratas, diversos predadores tais como aranhas e heterópteros no guano de morcego.

  4. Efeitos do sistema de plantio e da consorciação soja-milho sobre artrópodes capturados no solo

    Cividanes Francisco Jorge

    2002-01-01

    Full Text Available O objetivo deste estudo foi avaliar os efeitos do plantio direto e da consorciação soja [Glycine max (L. Merrill] e milho (Zea mays L. sobre artrópodes que vivem no solo. Os tratamentos constituíram um fatorial 3 x 2 (monocultura de soja, monocultura de milho, consorciação soja-milho x plantio direto, plantio convencional em blocos casualizados com quatro repetições; as amostragens foram efetuadas com armadilhas de solo, durante 1996 a 1998. Resultados estatisticamente significativos em pelo menos uma safra indicaram que o plantio direto foi favorável a predadores, como formigas (Brachymyrmex sp., Camponotus spp. e Ectatomma sp., carabídeos (Metius sp. e aranhas (Lycosidae. A consorciação soja-milho aumentou o número de Acrididae, enquanto a presença do milho favoreceu a ocorrência de Dermaptera em sistemas de consorciação soja-milho.

  5. A resistência aos inseticidas e sua medida em mosquitos

    Mario B. Aragão

    1972-04-01

    Full Text Available Depois de um ligeiro histórico scbre a evolução dos inseticidas, o autor chama a atenção para a mudança radical sofrida pela tática de combate a insetos, cem o aparecimento dos inseticidas orgânicos persistentes. Antes o que se visava era o inseto ou o seu alimento, depois passou-se a envenenar todo o espaço frequentado por esses animais. Lembra que existem, em alguns lugares, ambientes naturalmente envenenados onde prosperam seres vivos, perfeitamente adaptados a essas condições. Isso permitia prever o aparecimento de resistência aos inseticidas na escala hoje observada. Cita alguns çens e enzimas responsáveis pela resistência a alguns grupos de inseticidas e salienta a importância desses estudos para a descoberta de substâncias sinergentes. Descreve a técnica adotada pela Organização Mundial da Saúde para medir a susceptibilidade de mosquitos adultos. Menciona os processos de controle biológico por machos esterilizados, parasitas e predadores, e lembra que as duas campanhas contra insetos de importância sanitária que tiveram maior êxito no Brasil, a do Aedes aegypti e a do Anopheles gambiae, utilizaram táticas ecléticas, como é hoje preconizado pelos cntomologistas de vanguarda, no que se convencionou chamar de luta integrada.

  6. INSETOS AQUÁTICOS EM UM LAGO ARTIFICIAL NO SUL DO BRASIL

    Mario Arthur Favretto

    2014-08-01

    Full Text Available O presente trabalho teve como objetivo caracterizar a entomofauna aquática em um lago artificial no perímetro urbano no município de Joaçaba, estado de Santa Catarina, sul do Brasil. As coletas foram realizadas nos meses de agosto, outubro, novembro e dezembro de 2013, durante o período matutino com auxílio de rede entomológica. No total foram coletados 300 exemplares divididos em cinco ordens. Odonata foi a ordem mais abundante, tendo sido representada por Coenagrionidae, Lestidae e Aeshnidae. Ainda Hemiptera foi representada por Notonectidae, Belostomatidae, Nepidae, Gerridae, Mesovellidae e Corixidae e Ephemeroptera com Baetidae. Quanto aos grupos tróficos funcionais, 85% das espécies foram de predadores, 10% de fragmentadores/coletores e 5% de coletores. Palavras-chave: Entomofauna aquática. Hemiptera. Odonata. Sul do Brasil. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n2p113-116

  7. Fatores que influenciam o ataque de mosca-branca em jiloeiro Factors affecting attack rate of the whitefly on Solanum gilo

    Germano Leão Demolin Leite

    2002-07-01

    Full Text Available Este trabalho objetivou determinar os efeitos de pluviosidade e temperatura, predadores e parasitóides, dossel e idade das plantas, tipos e densidades de tricomas foliares, compostos químicos foliares, níveis de N e de K foliares, sobre a intensidade de ataque de mosca-branca Bemisia tabaci (Hemiptera: Aleyrodidae em jiloeiro Solanum gilo var. 'Gigante Portuguesa'. As densidades de ninfas e de adultos de B. tabaci foram maiores nas folhas baixeiras do que nas apicais das plantas de jiloeiro. Com o aumento da temperatura do ar, observou-se incremento na densidade de adultos de B. tabaci nas folhas de jiloeiro.The objective of this study was to determine the effect of rainfall and temperature, predators and parasitoids, height within the canopy and plant age, chemical composition of leaves, levels of nitrogen and potassium in leaves and density of trichomes in leaves, on attack intensity of the whitefly Bemisia tabaci (Hemiptera: Aleyrodidae on Solanum gilo var. 'Portuguese giant'. Densities of nymphs and of adults of B. tabaci were higher on leaves of the lower part than on those of the apical parts of plants of S. gilo. The number of adults of B. tabaci on leaves of S. gilo increased with temperature.

  8. Toxicidade residual de alguns agrotóxicos recomendado na agricultura sobre Neoseiulus californicus (McGregor (Acari: Phytoseiidae Residual toxicity of some pesticides recommended for citrus orchards on the predaceous mite Neoseiulus californicus (McGregor (Acari: phytoseiidae

    Marcos Zatti da Silva

    2007-04-01

    Full Text Available O objetivo do trabalho foi avaliar a toxicidade residual de alguns agrotóxicos utilizados em citros sobre Neoseiulus californicus (McGregor em condições de laboratório. O método de bioensaio adotado foi o de contato residual. Folhas de citros da variedade Pêra, acondicionadas em arenas, foram pulverizadas em torre de Potter. A toxicidade residual dos produtos foi avaliada duas horas e 1; 3; 5; 7; 10; 14 e 21 dias após a aplicação. Em cada arena, foram transferidas dez fêmeas adultas de N. californicus, juntamente com uma quantidade suficiente de Tetranychus urticae, como fonte de alimento. As avaliações de mortalidade foram realizadas 72 horas após a transferência dos ácaros para as arenas. Os agrotóxicos acrinathrin, deltamethrin, dinocap, enxofre, fenpropathrin, óxido de fenbutatin e propargite não causaram mortalidades significativas em adultos de N. californicus. Foram registradas mortalidades de 29,8; 24,0 e 34,1% para ácaros N. californicus expostos a resíduos de duas horas de idade de abamectim, azocyclotin e cyhexatin, respectivamente. Dicofol, pyridaben e chlorfenapyr causaram 100% de mortalidade aos ácaros predadores expostos aos resíduos tóxicos dos acaricidas, com duas horas de idade. Abamectin provocou mortalidade significativa por um período inferior a um dia. Resíduos dos acaricidas azocyclotin, cyhexatin, dicofol, pyridaben e chlorfenapyr provocaram mortalidades significativas por períodos de 1; 1; 10; 10 e 21dias, respectivamente. Os resultados obtidos no presente experimento servem de subsídio para a escolha adequada dos agrotóxicos a serem utilizados em pomares de citros nos quais N. californicus esteja presente ou naqueles em que o predador venha a ser liberado. Esses resultados também servem para a escolha do momento mais favorável para a liberação dos ácaros predadores dessa espécie no campo, após a aplicação de agrotóxicos nos pomares. Estudos conduzidos em condições de campo ainda s

  9. Colonização de macroinvertebrados bentônicos em detritos foliares em um riacho de primeira ordem na Floresta Atlântica do nordeste brasileiro

    Iris Gabrielly Arruda dos Santos

    2015-03-01

    Full Text Available O objetivo do estudo foi avaliar a colonização de macroinvertebrados bentônicos em detritos foliares de Inga ingoides (Leguminosae em experimentos de campo em um riacho de primeira ordem da Mata Atlântica do Estado de Pernambuco no nordeste do Brasil. Um total de 270 bolsas de folhiço, distribuídas em três trechos do riacho com características similares em relação à morfologia e parâmetros físicos e químicos da água foram submersas, entre fevereiro a julho de 2013 e retiradas após 7, 30, 60, 90 e 120 dias. Dois tratamentos foram utilizados: colonização e exclusão da macrofauna. O percentual de biomassa remanescente final (%R foi maior para bolsas de colonização do que para as de exclusão, evidenciando a efetiva participação dos macroinvertebrados no processo de decomposição. Os fragmentadores apresentaram menor participação no processo de decomposição foliar de I. ingoides, sendo Tripletides (Trichoptera: Leptoceridae, Polypedillum e Stenochironomus (Diptera, Chironomidae os táxons predominantes na macrofauna. Filtrador foi o grupo trófico funcional predominante (45,6%, seguido por predador (31,2%, coletor (11,8%, raspador (6,7% e fragmentador (4,8%.

  10. Categorização funcional trófica das comunidades de macroinvertebrados de dois reservatórios na região Centro-Oeste do Estado de São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v31i1.331 Functional feeding groups of benthics macroinvertebrates communities of two lentic systems in the central west region of São Paulo State - DOI: 10.4025/actascibiolsci.v31i1.331

    Jandira Liria Biscalquini Talamoni

    2009-04-01

    Full Text Available A utilização do conceito de guilda pode ser útil para a categorização funcional trófica de comunidades, pois não há obrigatoriedade da identificação dos organismos em nível de espécie, nem de tratar cada espécie como uma entidade separada. O objetivo deste estudo foi analisar os grupos funcionais tróficos (coletores-catadores, coletores-filtradores, fragmentadores, predadores e raspadores das comunidades de macroinvertebrados de dois reservatórios da região Centro-Oeste do Estado de São Paulo, Brasil. As amostragens foram realizadas nos períodos chuvoso (março/abril - 2001 e de seca (julho/agosto - 2001 e os dados obtidos indicam que os coletores-catadores foram a guilda mais frequente. Este fato sugere grande importância da matéria orgânica como recurso alimentar na dieta dos macroinvertebrados analisados.The aim of this study was analyze the functional feeding groups (collectors, shredders, predators and grazer-scrapers of benthic macroinvertebrates communities in two lentic systems in the central west region of São Paulo State. The samples were realized in rainy (March/April - 2001 and dry (July/August - 2001 seasons. The results obtained contribute for the best knowledgement of benthic macroinvertebrate community on those two systems.

  11. Use of the flooded forest by fish assemblages in lakes of the National Park of Anavilhanas (Amazonas, Brazil Uso do igapó por assembléias de peixes nos lagos no Parque Nacional das Anavilhanas (Amazonas, Brasil

    Janette Noveras

    2012-01-01

    Full Text Available We evaluated diversity and distribution of fish species in two habitats: flooded forest and open water of lakes of Rio Negro. Each of four lakes within the Anavilhanas Archipelago was sampled three times from 2009-2010. Species diversity generally was higher in flooded forests and at night, according to correspondence analysis. Predators were most active at night, but showed no preference between the flooded forest and open water habitats. Omnivores, filter feeders, and detritivores were most active during the day.Avaliamos a diversidade e a distribuição de espécies de peixes em dois habitats: floresta alagada e água aberta de lagos do rio Negro. Três amostragens foram realizadas em quatro lagos do Arquipélago de Anavilhanas, em 2009 e 2010. Em geral, a diversidade de espécies foi maior na floresta alagada e durante a noite. A análise de correspondência indicou que predadores estavam mais ativos a noite nos dois habitats. Onívoros, filtradores e detritívoros foram mais capturados durante o dia.

  12. Lesiones post mortales por fauna cadavérica: La acción de las hormigas sobre el cadáver Post-mortal injuries by cadaveric fauna: The action of the ants on human corpses

    P.M. Garamendi

    2008-04-01

    Full Text Available Los animales pueden actuar como predadores de los restos humanos y las lesiones postmortales que infligen en los cadáveres pueden dar lugar a errores de interpretación de los hallazgos en las autopsias forenses. Entre la fauna cadavérica, las hormigas constituyen un caso excepcional al ser los únicos insectos que pueden iniciar su actividad predadora antes de instaurarse la putrefacción. Las hormigas suelen producir lesiones que por su asiento y morfología resultan típicas. Se presenta un caso en el que se evidencia la presencia de lesiones de morfología típica por la acción lesiva postmortal de hormigas, pero con una extensión y localización inhabituales.Post-mortem animal predation can lead to errors when interpreting forensic autopsy findings. Ants are the only insects that can attack human corpses after death and before decomposition process starts. Ants produce post mortal injuries in the skin that have a distinct location and morphology. We present a forensic case in which post mortal injuries produced by ants in a human corpse had a typical morphology; however their location and extension were unusual.

  13. Predation on Alouatta guariba clamitans Cabrera (Primates, Atelidae by Leopardus pardalis (Linnaeus (Carnivora, Felidae Predação em Alouatta guariba clamitans Cabrera (Primates, Atelidae por Leopardus pordalis (Linnaeus (Carnivora, Felidae

    João M. D. Miranda

    2005-09-01

    Full Text Available There are a few studies about predation on primates. Howler monkeys, being relatively large animals, were believed to be preyed on successfully only by medium to large-sized carnivores and large birds of prey. Our study took place at Chácara Payquerê, which is situated in the municipality of Balsa Nova, State of Paraná, Southern Brazil. Fingers and nails from Alouatta guariba clamitans Cabrera, 1940 were founded in two faecal samples from Leopardus pardalis (Linnaeus, 1758. With our documentation large howler monkey remains in faeces, the possibility of ocelot being a potential predator of all Neotropical primates should be taken into consideration.São poucos os estudos sobre a predação de primatas. Sendo os bugios animais relativamente grandes, acredita-se que somente médios e grandes carnívoros e grandes rapineiros possam lograr sucesso em sua predação. O estudo foi realizado na Chácara Payquerê, situada no município de Balsa Nova, Estado do Paraná, sul do Brasil. Dedos e unhas de Alouatta guariba clamitans Cabrera, 1940 foram encontradas em duas amostras fecais de Leopardus pardalis (Linnaeus, 1758 que foram coletadas. Com este registro de grande primata em fezes, a possibilidade de a jaguatirica ser um potencial predador de todos os primatas neotropicais pode ser levada em consideração.

  14. Dinámica de polifenoles y estudio anatomo-histoquímico en Schinus longifolius (Lindl. Speg. (Anacardiaceae en respuesta a la infección por Calophya mammifex (Hemiptera - Calophyidae

    Ignacio AGUDELO

    2013-01-01

    Full Text Available Se analizaron los fenoles totales, taninos totales, proantocianidinas, flavonoides totales y ácidos hidroxicinámicos totales de hojas sanas y agallas de Schinus longifolius (Lindl. Speg. (Anacardiaceae infectado por Calophya mammifex (Hemiptera - Calophyidae. La agalla presenta una variación cuali-cuantitativa de los polifenoles estudiados, con una disminución de los fenoles, taninos, flavonoides y ácidos hidroxicinámicos y un aumento en el contenido de proantocianidinas, cuyo monómero se transforma en cianidina luego del clivaje ácido. Se realizó además un análisis anatómico de la agalla donde se encontraron acúmulos de esclereidas y un mayor desarrollo vascular respecto de la hoja sana y un ensayo histoquímico que mostró una expresión diferencial de metabolitos polifenólicos en sus tejidos. C. mammifex utiliza la agalla como refugio contra las condiciones climáticas adversas y predadores y provee además de alimento con menos compuestos potencialmente perjudiciales en las etapas tempranas de su desarrollo.

  15. Density and habitat requirements of sympatric hares and cottontails in northern Italy

    Anna Vidus Rosin

    2010-06-01

    Full Text Available Abstract From 2005 to 2009, densities and habitat selection by the European hare (Lepus europaeus and Eastern cottontail (Sylvilagus floridanus were assessed during feeding activity in an intensively cultivated area in northern Italy. Hare average density (74 ind./km2 was comparable to the highest values reported for European farming areas. Preand post-breeding density fluctuated widely across the study years, probably as a consequence of changes in the carrying capacity of the study area. Cottontail population size progressively increased, as expected for a recently introduced species supported by high reproductive performances. Hares used both crops and spontaneous vegetation during their feeding activity. Conversely, cottontails avoided winter cereals and preferred to feed on alfalfa. Our results suggest that simplified agro-ecosystems cannot maintain high density hare populations even at a short time scale. Landscape heterogeneity could enhance the chances of coexistence between the two lagomorphs.
    Riassunto Densità ed esigenze ecologiche della lepre e del silvilago in condizioni di simpatria in Italia settentrionale Tra il 2005 e il 2009, la densità e l’uso del habitat durante l’attività di alimentazione da parte della Lepre europea (Lepus europaeus e del Silvilago (Sylvilagus floridanus sono stati indagati in un’area intensamente coltivata nell’Italia settentrionale. La densità media della lepre nell’area di studio (74 ind./km2 corrisponde ai valori maggiori riportati per le aree agricole europee. Le densità pre- e post riproduttive della lepre hanno mostrato sensibili fluttuazioni durante il periodo di studio, probabilmente dovute ai cambiamenti stagionali della capacità portante dell’area di studio. L’abbondanza del silvilago è aumentata durante gli ultimi tre anni di studio, come prevedibile per una

  16. A Century of Shope Papillomavirus in Museum Rabbit Specimens.

    Clara Escudero Duch

    Full Text Available Sylvilagus floridanus Papillomavirus (SfPV causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, and whether SfPV occurs throughout the host range, or just in the Midwest. Secondary aims were to detect distinct strains, and evidence for strain spatio-temporal specificity. We found 20 of 1395 rabbits in the KU collection SfPV symptomatic. Three of 17 lagomorph species (S. nuttallii, and the two known hosts were symptomatic, while Brachylagus, Lepus and eight additional Sylvilagus species were not. 13 symptomatic individuals were positive by molecular testing, including the first S. nuttallii detection. Prevalence of symptomatic individuals was significantly higher in Sylvilagus (1.8% than Lepus. Half of these specimens came from Kansas, though new molecular detections were obtained from Jalisco-Mexico's first-and Nebraska, Nevada, New Mexico, and Texas, USA. We document the oldest lab-confirmed case (Kansas, 1915, pre-dating Shope's first case. SfPV amplification was possible from 63.2% of symptomatic museum specimens. Using multiple methodologies, rolling circle amplification and, multiple isothermal displacement amplification in addition to PCR, greatly improved detection rates. Short sequences were obtained from six individuals for two genes. L1 gene sequences were identical to all previously detected sequences; E7 gene sequences, were more variable, yielding five distinct SfPV1 strains that differing by less than 2% from strains circulating in the Midwest and Mexico, between 1915 and 2005. Our results do not clarify whether strains are host species

  17. Colonization of artificial substrata by teredinid larvae released from a previously infested focus at Ilha Grande Bay, RJ

    Ricardo Silva Varotto

    1998-08-01

    Full Text Available The colonization pattern of wooden panels by teredinid larvae released from a previously infested focus was investigated. Panels were placed at different distances (1, 10, 20m and in different directions from the focus. The colonization experiment took place at Parcel do Aleijado, Ilha Grande Bay, RJ. The focus remained immersed in nearly surface water, by the coast, during three months for infestation by teredinids. After this period, it was transferred to the study site. The infested focus and colonization panels remained in water, 10m deep, for three months more. Total density and density of the dominant species were considered for each group of panels. Five teredinid species were found: Bankia fimbriatula, Bankia gouldi, Lyrodus floridanus, Lyrodus massa and Teredo furcifera. The dominant species was Teredo furcifera (76.6%. Significant differences were only observed between directions for total teredinids and for dominant species density. Results concerning the dominant species Teredo furcifera were even more expressive and suggested the occurrence of a local water circulation pattern.Foi estudado o padrão de colonização de larvas de teredinídeo liberadas a partir de um foco previamente infestado. Coletores foram posicionados a diferentes distâncias (1m, 10m, 20m e em diferentes sentidos a partir do foco. O experimento de colonização foi realizado junto ao Parcel do Aleijado, Baía da Ilha Grande, RJ. O foco permaneceu imerso próximo à superfície, junto à costa, durante 3 meses para infestação por teredinídeos. Após este período, foi tranferido para a área de estudo. O foco infestado e os coletores permaneceram imersos, a 10m de profundidade, por mais 3 meses. Foram consideradas a densidade total e a densidade da espécie dominante para cada grupo de coletores. Foram encontradas 5 espécies de teredinídeos: Bankia fimbriatula, Bankia gouldi, Lyrodus floridanus, Lyrodus massa and Teredo furcifera. A espécie dominante foi

  18. Characterization and expression of the antifungal protein from Monascus pilosus and its distribution among various Monascus species.

    Tu, Ching-Yu; Chen, Yu-Pei; Yu, Ming-Chen; Hwang, Ing-Er; Wu, Dai-Ying; Liaw, Li-Ling

    2016-07-01

    Monascus species are traditionally used for food preservation. This study used the disc diffusion method to verify the antifungal activity of protein extracted from Monascus pilosus BCRC38072 against 15 fungal pathogens. An antifungal protein, designated as MAFP1, was successfully purified and confirmed through N-terminal sequencing. To further explore the antifungal gene, a mafp1 gene that is similar to that of PgAFP from Penicillium chrysogenum was cloned from M. pilosus BCRC38072. According to the N-terminal sequencing and in silico analysis, the signal peptide was assumed to have 18 amino acids and the mature MAFP1 to contain 58 peptides. Moreover, the mafp1 gene was recognized in Monascus ruber, Monascus barkeri, Monascus floridanus, and Monascus lunisporas through polymerase chain reaction and DNA sequencing and showed high homology. By contrast, the mafp1 gene was absent in Monascus kaoliang, Monascus purpureus, and Monascus sanguineus. In addition, the mafp1 gene with N-terminal polyhistidine fusion was overexpressed in Escherichia coli. However, the antifungal activity of recombinant MAFP1 was significantly lower than that of native MAFP1. According to the properties of MAFP1, Monascus species may have food preservation applications. PMID:26803705

  19. Discovery of defense- and neuropeptides in social ants by genome-mining.

    Christian W Gruber

    Full Text Available Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant, Camponotus floridanus (carpenter ant and Harpegnathos saltator (basal genus. Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae and supports recent findings in Tribolium castaneum (red flour beetle and Nasonia vitripennis (parasitoid wasp, and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee, another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value.

  20. Discovery of defense- and neuropeptides in social ants by genome-mining.

    Gruber, Christian W; Muttenthaler, Markus

    2012-01-01

    Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant), Camponotus floridanus (carpenter ant) and Harpegnathos saltator (basal genus). Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins) and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae) and supports recent findings in Tribolium castaneum (red flour beetle) and Nasonia vitripennis (parasitoid wasp), and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee), another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family) and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value. PMID:22448224

  1. Structural Changes of Oil Palm Empty Fruit Bunch (OPEFB after Fungal and Phosphoric Acid Pretreatment

    Mohammad J. Taherzadeh

    2012-12-01

    Full Text Available Oil palm empty fruit bunch (OPEFB was pretreated using white-rot fungus Pleurotus floridanus, phosphoric acid or their combination, and the results were evaluated based on the biomass components, and its structural and morphological changes. The carbohydrate losses after fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 7.89%, 35.65%, and 33.77%, respectively. The pretreatments changed the hydrogen bonds of cellulose and linkages between lignin and carbohydrate, which is associated with crystallinity of cellulose of OPEFB. Lateral Order Index (LOI of OPEFB with no pretreatment, with fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 2.77, 1.42, 0.67, and 0.60, respectively. Phosphoric acid pretreatment showed morphological changes of OPEFB, indicated by the damage of fibre structure into smaller particle size. The fungal-, phosphoric acid-, and fungal followed by phosphoric acid pretreatments have improved the digestibility of OPEFB’s cellulose by 4, 6.3, and 7.4 folds, respectively.

  2. Structural changes of oil palm empty fruit bunch (OPEFB) after fungal and phosphoric acid pretreatment.

    Isroi; Ishola, Mofoluwake M; Millati, Ria; Syamsiah, Siti; Cahyanto, Muhammad N; Niklasson, Claes; Taherzadeh, Mohammad J

    2012-01-01

    Oil palm empty fruit bunch (OPEFB) was pretreated using white-rot fungus Pleurotus floridanus, phosphoric acid or their combination, and the results were evaluated based on the biomass components, and its structural and morphological changes. The carbohydrate losses after fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 7.89%, 35.65%, and 33.77%, respectively. The pretreatments changed the hydrogen bonds of cellulose and linkages between lignin and carbohydrate, which is associated with crystallinity of cellulose of OPEFB. Lateral Order Index (LOI) of OPEFB with no pretreatment, with fungal, phosphoric acid, and fungal followed by phosphoric acid pretreatments were 2.77, 1.42, 0.67, and 0.60, respectively. Phosphoric acid pretreatment showed morphological changes of OPEFB, indicated by the damage of fibre structure into smaller particle size. The fungal-, phosphoric acid-, and fungal followed by phosphoric acid pretreatments have improved the digestibility of OPEFB's cellulose by 4, 6.3, and 7.4 folds, respectively. PMID:23247371

  3. Ability of bed bug-detecting canines to locate live bed bugs and viable bed bug eggs.

    Pfiester, Margie; Koehler, Philip G; Pereira, Roberto M

    2008-08-01

    The bed bug, Cimex lectularius L., like other bed bug species, is difficult to visually locate because it is cryptic. Detector dogs are useful for locating bed bugs because they use olfaction rather than vision. Dogs were trained to detect the bed bug (as few as one adult male or female) and viable bed bug eggs (five, collected 5-6 d after feeding) by using a modified food and verbal reward system. Their efficacy was tested with bed bugs and viable bed bug eggs placed in vented polyvinyl chloride containers. Dogs were able to discriminate bed bugs from Camponotus floridanus Buckley, Blattella germanica (L.), and Reticulitermes flavipes (Kollar), with a 97.5% positive indication rate (correct indication of bed bugs when present) and 0% false positives (incorrect indication of bed bugs when not present). Dogs also were able to discriminate live bed bugs and viable bed bug eggs from dead bed bugs, cast skins, and feces, with a 95% positive indication rate and a 3% false positive rate on bed bug feces. In a controlled experiment in hotel rooms, dogs were 98% accurate in locating live bed bugs. A pseudoscent prepared from pentane extraction of bed bugs was recognized by trained dogs as bed bug scent (100% indication). The pseudoscent could be used to facilitate detector dog training and quality assurance programs. If trained properly, dogs can be used effectively to locate live bed bugs and viable bed bug eggs. PMID:18767752

  4. Biological and physical contributions to the accumulation of strombid gastropods in a Pliocene shell bed

    Geary, D.H. (Univ. of Wisconsin, Madison (USA)); Allmon, W.D. (Univ. of South Florida, Tampa (USA))

    1990-06-01

    Before the evolutionary and ecological information contained in shell beds can be interpreted, the conditions of shell bed formation must be understood. Here the authors investigate the mode and time scale of accumulation of a dense layer of Strombus floridanus in the Pliocene Pinecrest Beds of Florida. They utilize a variety of comparative taphonomic data, including the extent of encrustation and boring on strombid shells of different ontogenetic ages, and on accompanying pelecypods of different ecological types. The taphonomic comparisons enable them to reconstruct more accurately the events of shell bed formation. The formation of the strombid shell layer involved both biological and physical components. The characteristically gregarious behavior of Strombus is reflected in the large number of individuals preserved in this layer. Based on average densities of individuals in strombid colonies today, the authors estimate that a time period of tens to hundreds of years was required to accumulate these fossils. Repeated sediment winnowing by storms, followed by rapid reburial in a regime of at least episodically high sedimentation rates, is the most likely mechanism of accumulation, and accounts for the observed patterns of encrustation and boring on the shells of Strombus and various associated pelecypods. The origin of Florida's Plio-Pleistocene shelly sands is poorly understood; analysis of this bed may provide a working model for future taphonomic studies.

  5. Prevalence of antibodies to Toxoplasma gondii in wild mammals of Missouri and east central Kansas: biologic and ecologic considerations of transmission.

    Smith, D D; Frenkel, J K

    1995-01-01

    Sera from 273 wild mammals from Missouri and Kansas (USA), collected between December 1974 and December 1987, were tested for the presence of antibodies to Toxoplasma gondii using the Sabin-Feldman dye test. Sixty-five (24%) had antibodies at titers of > or = 1:8, including 38 (66%) of 58 carnivores, 14 (15%) of 94 omnivores, 13 (11%) of 117 herbivores, and none of four insectivores. The prevalence of antibodies in mice (Mus musculus and Peromyscus spp.) and rats (Rattus norvegicus and Sigmodon hispidus) was low (3%), while medium sized herbivores such as squirrels (Sciurus spp.), rabbits (Sylvilagus floridanus), and muskrats (Ondatra zibethicus) had prevalences of about 18%. Red foxes (Vulpes fulva) and mink (Mustela vison) had the highest prevalence of antibodies with frequencies of 90 and 66%, respectively. In 32 attempts to isolate Toxoplasma gondii from wild mammals with positive (> or = 1:4) titers, only six (19%) were successful: a gray squirrel (Sciurus carolinensis), a beaver (Castor canadensis), an opossum (Didelphis marsupialis), a red fox and two mink. These findings are consistent with the hypothesis that the probability of infection with Toxoplasma gondii, and therefore prevalence of antibodies in wildlife, is greatest in carnivores. PMID:7563419

  6. Analyses of mammalian sera in enzyme-linked immunosorbent assays with different strains of Borrelia burgdorferi sensu lato.

    Magnarelli, L A; Anderson, J F; Johnson, R C

    1995-04-01

    Blood samples were collected from cottontail rabbits (Sylvilagus floridanus), raccoons (Procyon lotor), white-footed mice (Peromyscus leucopus), and white-tailed deer (Odocoileus virginianus) between 1977 and 1991 in southern Connecticut and New York State (USA) and were tested for antibodies against eight strains of Borrelia burgdorferi sensu lato in enzyme-linked immunosorbent assays. Among these spirochetes were six strains of B. burgdorferi sensu stricto, one strain of B. garinii (=IP90) and a strain (IPF) in group VS461. Sera from each study group reacted positively to all strains having origins in North America and Eurasia. Assay sensitivities normally ranged between 85% and 100% for all study groups. The lowest sensitivity (66%) was noted when mouse sera were tested with B. garinii, an isolate from Ixodes persulcatus in the former Soviet Union. Differences in serum reactivity to various strains were noted for all study groups, but because of multiple shared antigens among the closely related spirochetes tested, the selection of a particular North American strain of B. burgdorferi sensu stricto did not appear to be a critical factor for optimal assay performance. Locally obtained strains of this bacterium are preferred as coating antigens for serologic testing because of their availability. PMID:8583632

  7. First isolation and cultivation of Borrelia burgdorferi sensu lato from Missouri.

    Oliver, J H; Kollars, T M; Chandler, F W; James, A M; Masters, E J; Lane, R S; Huey, L O

    1998-01-01

    Five Borrelia burgdorferi sensu lato isolates from Missouri are described. This represents the first report and characterization of such isolates from that state. The isolates were obtained from either Ixodes dentatus or Amblyomma americanum ticks that had been feeding on cottontail rabbits (Sylvilagus floridanus) from a farm in Bollinger County, Mo., where a human case of Lyme disease had been reported. All isolates were screened immunologically by indirect immunofluorescence by using monoclonal antibodies to B. burgdorferi-specific outer surface protein A (OspA) (antibodies H3TS and H5332), B. burgdorferi-specific OspB (antibody H6831), Borrelia (genus)-specific antiflagellin (antibody H9724), and Borrelia hermsii-specific antibody (antibody H9826). Analysis of the isolates also involved a comparison of their protein profiles by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Finally, the isolates were analyzed by PCR with six pairs of primers known to amplify selected DNA target sequences specifically found in the reference strain B. burgdorferi B-31. Although some genetic variability was detected among the five isolates as well as between them and the B-31 strain, enough similarities were found to classify them as B. burgdorferi sensu lato. PMID:9431909

  8. Lead bioaccessibility in food web intermediates and the influence on ecological risk characterization.

    Kaufman, Claire A; Bennett, Joseph R; Koch, Iris; Reimer, Kenneth J

    2007-08-15

    Models simulating gastric conditions of mammalian (eastern cottontail, Sylvilagus floridanus; short-tailed shrew, Blarina brevicauda) and avian (American robin, Turdus migratorius) receptors were used to investigate the proportion of lead (Pb) mobilized into the digestive juices (the bioaccessible fraction) from soil, earthworms, and vegetation collected at a rifle and pistol (RP) range in eastern Ontario, Canada. Pb concentrations averaged 5044 mg kg(-1) in RP range surface soils, 727 mg kg(-1) in earthworm tissue, and 2945 mg kg(-1) in unwashed vegetation. For mammalian gastric models, the bioaccessible fraction of Pb in soils was 66 +/- 22%, in earthworm tissue was 77 +/- 14%, and in unwashed vegetation was 50 +/- 37%. For the avian gastric model, the bioaccessible fraction of Pb in soil was 53 +/- 43% and in earthworm tissue was 73 +/- 13%. The incorporation of soil and food web intermediate bioaccessibility data into standard risk calculations resulted in predicted risk being reduced for all receptors. The inclusion of bioaccessibility during ecological risk assessment affords a more realistic estimate of contaminant exposure, and is a valuable tool for use in contaminated sites management. PMID:17874804

  9. Ticks (Acari: Ixodidae) collected from small and medium-sized Kansas mammals.

    Brillhart, D B; Fox, L B; Upton, S J

    1994-05-01

    Seven species of hard-bodied ticks were collected from 20 species of small and medium-sized mammals in Kansas; Amblyomma americanum L., Dermacentor variabilis (Say), Haemaphysalis leporispalustris (Packard), Ixodes cookei Packard, I. kingi Bishopp, I. sculptus Neumann, and I. texanus Banks. Dermacentor variabilis was found statewide, A. americanum only in the eastern one-third of the state, and the Ixodes spp. and H. leporispalustris were widely scattered. The most common tick found was D. variabilis, both by itself and in association with other ticks. Mammals that ticks were collected from included Canis latrans Say, Cynomys ludovicianus ludovicianus (Ord), Didelphis virginianus Kerr, Geomys bursarius (Shaw), Lynx rufus (Schreber), Marmota monax bunkeri Black, Mephitis mephitis (Schreber), Microtus ochrogaster (Wagner), Mus musculus L., Peromyscus leucopus (Rafinesque), P. maniculatus (Wagner), Procyon lotor hirtus Nelson and Goldman, Reithrodontomys megalotis (Baird), Sciurus niger rufiventer Geoffroy, Sigmodon hispidus texianus (Audubon and Bachman), Sylvilagus floridanus (J. A. Allen), Taxidea taxus taxus (Schreber), and Vulpes velox velox (Say). PMID:8057327

  10. Ixodes dammini (Acari: Ixodidae) infestation on medium-sized mammals and blue jays in northwestern Illinois.

    Mannelli, A; Kitron, U; Jones, C J; Slajchert, T L

    1993-09-01

    High prevalence of infestation of five species of medium-sized mammals and blue jays, Cyanocitta cristata (L.), by immature Ixodes dammini Spielman, Clifford, Piesman and Corwin was found in Castle Rock State Park in northwestern Illinois during May-August 1991. Raccoons, Procyon lotor L., and opossums, Didelphis virginiana Kerr, were infested with the highest larval densities and were trapped primarily in bottomland forest and ecotone habitats. All species had similar nymphal densities, except the eastern cottontails, Sylvilagus floridanus Allen, which were infested with fewer nymphs. Infestation by I. dammini is reported for the first time for fox squirrels, Sciurus niger E. G. St. Hilaire, and for the first time in the midwestern United States for blue jays, C. cristata. These two species were hosts for nymphs in upland forest habitat. Molting rates varied among ticks that fed on different host species and among larvae that fed on individuals of the same species. Molting rate is proposed as an important factor in determining the relative importance of a host species to I. dammini population dynamics. PMID:8254647