INNOVATIONS IN THE ANALYSIS OF CHANDRA-ACIS OBSERVATIONS
International Nuclear Information System (INIS)
Broos, Patrick S.; Townsley, Leisa K.; Feigelson, Eric D.; Getman, Konstantin V.; Garmire, Gordon P.; Bauer, Franz E.
2010-01-01
As members of the instrument team for the Advanced CCD Imaging Spectrometer (ACIS) on NASA's Chandra X-ray Observatory and as Chandra General Observers, we have developed a wide variety of data analysis methods that we believe are useful to the Chandra community, and have constructed a significant body of publicly available software (the ACIS Extract package) addressing important ACIS data and science analysis tasks. This paper seeks to describe these data analysis methods for two purposes: to document the data analysis work performed in our own science projects and to help other ACIS observers judge whether these methods may be useful in their own projects (regardless of what tools and procedures they choose to implement those methods). The ACIS data analysis recommendations we offer here address much of the workflow in a typical ACIS project, including data preparation, point source detection via both wavelet decomposition and image reconstruction, masking point sources, identification of diffuse structures, event extraction for both point and diffuse sources, merging extractions from multiple observations, nonparametric broadband photometry, analysis of low-count spectra, and automation of these tasks. Many of the innovations presented here arise from several, often interwoven, complications that are found in many Chandra projects: large numbers of point sources (hundreds to several thousand), faint point sources, misaligned multiple observations of an astronomical field, point source crowding, and scientifically relevant diffuse emission.
Frameworks for ACI: Animals as Stakeholders in the Design Process
North, Steve; Mancini, Clara
2016-01-01
Animal-computer interaction (ACI) is an emerging discipline concerned with studying the relationship between animals and technology, designing interactive technology to support animals, and developing methodologies that can enable animals to participate in the design process as legitimate stakeholders. By welcoming animals to the design table, ACI is delineating new frontiers for interaction design. However, if co-designing HCI artifacts is already fraught with misunderstanding, how might ACI...
Chandra ACIS Sub-pixel Resolution
Kim, Dong-Woo; Anderson, C. S.; Mossman, A. E.; Allen, G. E.; Fabbiano, G.; Glotfelty, K. J.; Karovska, M.; Kashyap, V. L.; McDowell, J. C.
2011-05-01
We investigate how to achieve the best possible ACIS spatial resolution by binning in ACIS sub-pixel and applying an event repositioning algorithm after removing pixel-randomization from the pipeline data. We quantitatively assess the improvement in spatial resolution by (1) measuring point source sizes and (2) detecting faint point sources. The size of a bright (but no pile-up), on-axis point source can be reduced by about 20-30%. With the improve resolution, we detect 20% more faint sources when embedded on the extended, diffuse emission in a crowded field. We further discuss the false source rate of about 10% among the newly detected sources, using a few ultra-deep observations. We also find that the new algorithm does not introduce a grid structure by an aliasing effect for dithered observations and does not worsen the positional accuracy
The HTM Spatial Pooler—A Neocortical Algorithm for Online Sparse Distributed Coding
Directory of Open Access Journals (Sweden)
Yuwei Cui
2017-11-01
Full Text Available Hierarchical temporal memory (HTM provides a theoretical framework that models several key computational principles of the neocortex. In this paper, we analyze an important component of HTM, the HTM spatial pooler (SP. The SP models how neurons learn feedforward connections and form efficient representations of the input. It converts arbitrary binary input patterns into sparse distributed representations (SDRs using a combination of competitive Hebbian learning rules and homeostatic excitability control. We describe a number of key properties of the SP, including fast adaptation to changing input statistics, improved noise robustness through learning, efficient use of cells, and robustness to cell death. In order to quantify these properties we develop a set of metrics that can be directly computed from the SP outputs. We show how the properties are met using these metrics and targeted artificial simulations. We then demonstrate the value of the SP in a complete end-to-end real-world HTM system. We discuss the relationship with neuroscience and previous studies of sparse coding. The HTM spatial pooler represents a neurally inspired algorithm for learning sparse representations from noisy data streams in an online fashion.
The HTM Spatial Pooler-A Neocortical Algorithm for Online Sparse Distributed Coding.
Cui, Yuwei; Ahmad, Subutai; Hawkins, Jeff
2017-01-01
Hierarchical temporal memory (HTM) provides a theoretical framework that models several key computational principles of the neocortex. In this paper, we analyze an important component of HTM, the HTM spatial pooler (SP). The SP models how neurons learn feedforward connections and form efficient representations of the input. It converts arbitrary binary input patterns into sparse distributed representations (SDRs) using a combination of competitive Hebbian learning rules and homeostatic excitability control. We describe a number of key properties of the SP, including fast adaptation to changing input statistics, improved noise robustness through learning, efficient use of cells, and robustness to cell death. In order to quantify these properties we develop a set of metrics that can be directly computed from the SP outputs. We show how the properties are met using these metrics and targeted artificial simulations. We then demonstrate the value of the SP in a complete end-to-end real-world HTM system. We discuss the relationship with neuroscience and previous studies of sparse coding. The HTM spatial pooler represents a neurally inspired algorithm for learning sparse representations from noisy data streams in an online fashion.
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
A review on the technical basis for ACI 349 code revision to anchorage criteria
International Nuclear Information System (INIS)
Lee, N. H.; You, S. H.
1999-01-01
Anchors are widely used to attach structural and nonstructural elements to concrete in nuclear power plant construction. Anchorage to concrete in nuclear-related structure plant has been designed per ACI 349-90 Appendix B. However, a new criteria for anchorage based on the concrete capacity design(CCD) approach is ready for publication under the normal publication procedures by ACI 349 Code Committee. Both design procedures(ACI 349-90 and ACI 349-New) show rather different concrete capacities. Earlier comparable studies show that the CCD method is a more reliable predictor of concrete breakout than the 45-degree cone method(ACI 349-90), hence the CCD method adopted by ACI 349-New Code has been recommended. The philosophy of the current code is to design ductile fastenings, which requires a limit to guard against brittle concrete failure. On the other hand, the new code requires calculations for the concrete breakout strength, pullout strength, side-face blowout strength of fastener in tension, and concrete breakout strength, pryout strength of fastener in shear. Therefore, the new code can accurately predict the concrete failure capacity for different behavior of the anchorage system. In this review, the provisions of ACI 349-90 and ACI 349-New are compared to show the major differences with emphasis on the concrete breakout capacity
Cywilizacja łacińska: ekspansja-dominacja-kryzys
Kubiaczyk, Filip; Sareło, Zbigniew; Jakóbczyk, Stanisław; Kaźmierczak, Marek; Ciesielski, Mieszko; Kornacka-Sareło, Katarzyna; Kubiaczyk, Monika; Gaj, Beata; Gnyś-Nidecka, Małgorzata
2016-01-01
Cywilizacja łacińska. Ekspansja-dominacja-kryzys Abstrakt Teksty zebrane w niniejszym tomie skupiają się na problemie przyczyn kryzysu cywilizacji zachodniej, zwłaszcza jej tradycji łacińskiej, z różnych perspektyw badawczych (historycznej, filozoficznej, filologicznej i kulturoznawczej). To zróżnicowane podejście znalazło wyraz w odmiennym formułowaniu podejmowanych zagadnień i przyjętej metodologii, jak i użytej terminologii w odniesieniu do analizowanej kategorii. Pojęcia cywilizac...
HTM Spatial Pooler With Memristor Crossbar Circuits for Sparse Biometric Recognition.
James, Alex Pappachen; Fedorova, Irina; Ibrayev, Timur; Kudithipudi, Dhireesha
2017-06-01
Hierarchical Temporal Memory (HTM) is an online machine learning algorithm that emulates the neo-cortex. The development of a scalable on-chip HTM architecture is an open research area. The two core substructures of HTM are spatial pooler and temporal memory. In this work, we propose a new Spatial Pooler circuit design with parallel memristive crossbar arrays for the 2D columns. The proposed design was validated on two different benchmark datasets, face recognition, and speech recognition. The circuits are simulated and analyzed using a practical memristor device model and 0.18 μm IBM CMOS technology model. The databases AR, YALE, ORL, and UFI, are used to test the performance of the design in face recognition. TIMIT dataset is used for the speech recognition.
backissues.htm | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; backissues.htm. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from ...
contents.htm | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; contents.htm. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from ...
Directory of Open Access Journals (Sweden)
Klein Michael
2005-08-01
Full Text Available Abstract Background For solid tumors, image cytometry has been shown to be more sensitive for diagnosing DNA content abnormalities (aneuploidy than flow cytometry. Image cytometry has often been performed using the semi-automated CAS 200 system. Recently, an Automated Cellular Imaging System (ACIS was introduced to determine DNA content (DNA index, but it has not been validated. Methods Using the CAS 200 system and ACIS, we compared the DNA index (DI obtained from the same archived formalin-fixed and paraffin embedded tissue samples from Barrett's esophagus related lesions, including samples with specialized intestinal metaplasia without dysplasia, low-grade dysplasia, high-grade dysplasia and adenocarcinoma. Results Although there was a very good correlation between the DI values determined by ACIS and CAS 200, the former was 25% more sensitive in detecting aneuploidy. ACIS yielded a mean DI value 18% higher than that obtained by CAS 200 (p t test. In addition, the average time required to perform a DNA ploidy analysis was shorter with the ACIS (30–40 min than with the CAS 200 (40–70 min. Results obtained by ACIS gave excellent inter-and intra-observer variability (coefficient of correlation >0.9 for both, p Conclusion Compared with the CAS 200, the ACIS is a more sensitive and less time consuming technique for determining DNA ploidy. Results obtained by ACIS are also highly reproducible.
Ghylin, Trevor W; Garcia, Sarahi L; Moya, Francisco; Oyserman, Ben O; Schwientek, Patrick; Forest, Katrina T; Mutschler, James; Dwulit-Smith, Jeffrey; Chan, Leong-Keat; Martinez-Garcia, Manuel; Sczyrba, Alexander; Stepanauskas, Ramunas; Grossart, Hans-Peter; Woyke, Tanja; Warnecke, Falk; Malmstrom, Rex; Bertilsson, Stefan; McMahon, Katherine D
2014-12-01
Members of the acI lineage of Actinobacteria are the most abundant microorganisms in most freshwater lakes; however, our understanding of the keys to their success and their role in carbon and nutrient cycling in freshwater systems has been hampered by the lack of pure cultures and genomes. We obtained draft genome assemblies from 11 single cells representing three acI tribes (acI-A1, acI-A7, acI-B1) from four temperate lakes in the United States and Europe. Comparative analysis of acI SAGs and other available freshwater bacterial genomes showed that acI has more gene content directed toward carbohydrate acquisition as compared to Polynucleobacter and LD12 Alphaproteobacteria, which seem to specialize more on carboxylic acids. The acI genomes contain actinorhodopsin as well as some genes involved in anaplerotic carbon fixation indicating the capacity to supplement their known heterotrophic lifestyle. Genome-level differences between the acI-A and acI-B clades suggest specialization at the clade level for carbon substrate acquisition. Overall, the acI genomes appear to be highly streamlined versions of Actinobacteria that include some genes allowing it to take advantage of sunlight and N-rich organic compounds such as polyamines, di- and oligopeptides, branched-chain amino acids and cyanophycin. This work significantly expands the known metabolic potential of the cosmopolitan freshwater acI lineage and its ecological and genetic traits.
Tamoxifen induces regression of estradiol-induced mammary cancer in ACI.COP-Ept2 rat model
Ruhlen, Rachel L.; Willbrand, Dana M.; Besch-Williford, Cynthia L.; Ma, Lixin; Shull, James D.; Sauter, Edward R.
2008-01-01
The ACI rat is a unique model of human breast cancer in that mammary cancers are induced by estrogen without carcinogens, irradiation, xenografts or transgenic manipulations. We sought to characterize mammary cancers in a congenic variant of the ACI rat, the ACI.COP-Ept2. All rats with estradiol implants developed mammary cancers in 5–7 months. Rats bearing estradiol-induced mammary cancers were treated with tamoxifen for three weeks. Tamoxifen reduced tumor mass, measured by magnetic resonan...
An evaluation of ACI 349 code for design of the fastening system at nuclear power plant
International Nuclear Information System (INIS)
Jang, J.-B.; Suh, Y.-P.; Lee, J.-R.
2005-01-01
ACI 349 Code, revised on 2001, is only available for the anchor with diameter not exceeding 2 in. and tensile embedment not exceeding 25 in. in depth. So, ACI 349 Code can't be applied to the design of the large sized anchor with diameter exceeding 2 in. and tensile embedment exceeding 25 in. in depth which fastens the SG, RV, RCP, PZR, etc. at containment building. Therefore, an application of ACI 349 Code was investigated for the design of the small and large sized anchors under tensile load using the numerical analysis model which was developed on a basis of the various test data of cast-in-place anchor in this study. In conclusion, it is proved that ACI 349 Code is available for the design of the small and large sized cast-in-place anchor. (authors)
contents.htm | nov102005 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; nov102005; contents.htm. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be ...
Animal-Computer Interaction (ACI) : An analysis, a perspective, and guidelines
van den Broek, E.L.
2016-01-01
Animal-Computer Interaction (ACI)’s founding elements are discussed in relation to its overarching discipline Human-Computer Interaction (HCI). Its basic dimensions are identified: agent, computing machinery, and interaction, and their levels of processing: perceptual, cognitive, and affective.
Tamoxifen induces regression of estradiol-induced mammary cancer in the ACI.COP-Ept2 rat model.
Ruhlen, Rachel L; Willbrand, Dana M; Besch-Williford, Cynthia L; Ma, Lixin; Shull, James D; Sauter, Edward R
2009-10-01
The ACI rat is a unique model of human breast cancer in that mammary cancers are induced by estrogen without carcinogens, irradiation, xenografts or transgenic manipulations. We sought to characterize mammary cancers in a congenic variant of the ACI rat, the ACI.COP-Ept2. All rats with estradiol implants developed mammary cancers in 5-7 months. Rats bearing estradiol-induced mammary cancers were treated with tamoxifen for three weeks. Tamoxifen reduced tumor mass, measured by magnetic resonance imaging, by 89%. Tumors expressed estrogen receptors (ER), progesterone receptor (PR), and Erbb2. ERalpha and PR were overexpressed in tumor compared to adjacent non-tumor mammary gland. Thus, this model is highly relevant to hormone responsive human breast cancers.
articles32.htm | sep25 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; sep25; articles32.htm. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be ...
articles16.htm | jul10 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; jul10; articles16.htm. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...
Dietary quercetin exacerbates the development of estrogen-induced breast tumors in female ACI rats
International Nuclear Information System (INIS)
Singh, Bhupendra; Mense, Sarah M.; Bhat, Nimee K.; Putty, Sandeep; Guthiel, William A.; Remotti, Fabrizio; Bhat, Hari K.
2010-01-01
Phytoestrogens are plant compounds that structurally mimic the endogenous estrogen 17β-estradiol (E 2 ). Despite intense investigation, the net effect of phytoestrogen exposure on the breast remains unclear. The objective of the current study was to examine the effects of quercetin on E 2 -induced breast cancer in vivo. Female ACI rats were given quercetin (2.5 g/kg food) for 8 months. Animals were monitored weekly for palpable tumors, and at the end of the experiment, rats were euthanized, breast tumor and different tissues excised so that they could be examined for histopathologic changes, estrogen metabolic activity and oxidant stress. Quercetin alone did not induce mammary tumors in female ACI rats. However, in rats implanted with E 2 pellets, co-exposure to quercetin did not protect rats from E 2 -induced breast tumor development with 100% of the animals developing breast tumors within 8 months of treatment. No changes in serum quercetin levels were observed in quercetin and quercetin + E 2 -treated groups at the end of the experiment. Tumor latency was significantly decreased among rats from the quercetin + E 2 group relative to those in the E 2 group. Catechol-O-methyltransferase (COMT) activity was significantly downregulated in quercetin-exposed mammary tissue. Analysis of 8-isoprostane F 2α (8-iso-PGF 2α ) levels as a marker of oxidant stress showed that quercetin did not decrease E 2 -induced oxidant stress. These results indicate that quercetin (2.5 g/kg food) does not confer protection against breast cancer, does not inhibit E 2 -induced oxidant stress and may exacerbate breast carcinogenesis in E 2 -treated ACI rats. Inhibition of COMT activity by quercetin may expose breast cells chronically to E 2 and catechol estrogens. This would permit longer exposure times to the carcinogenic metabolites of E 2 and chronic exposure to oxidant stress as a result of metabolic redox cycling to estrogen metabolites, and thus quercetin may exacerbate E 2 -induced
Impact of ACI-ASME code on design and construction of nuclear containment structures
International Nuclear Information System (INIS)
Reedy, R.F.
1978-01-01
The effect of the ACI-ASME code for design and construction of concrete containment structures on the nuclear and concrete industries is examined. Topics covered include purpose of the code, general requirements, responsibilities and duties, design and construction specifications, quality assurance, inspection, the liner, and stamping
Sonsmann, F K; Strunk, M; Gediga, K; John, C; Schliemann, S; Seyfarth, F; Elsner, P; Diepgen, T L; Kutz, G; John, S M
2014-05-01
To date, there are no legally binding requirements concerning product testing in cosmetics. This leads to various manufacturer-specific test methods and absent transparent information on skin cleansing products. A standardized in vivo test procedure for assessment of cleansing efficacy and corresponding barrier impairment by the cleaning process is needed, especially in the occupational context where repeated hand washing procedures may be performed at short intervals. For the standardization of the cleansing procedure, an Automated Cleansing Device (ACiD) was designed and evaluated. Different smooth washing surfaces of the equipment for ACiD (incl. goat hair, felt, felt covered with nitrile caps) were evaluated regarding their skin compatibility. ACiD allows an automated, fully standardized skin washing procedure. Felt covered with nitrile as washing surface of the rotating washing units leads to a homogenous cleansing result and does not cause detectable skin irritation, neither clinically nor as assessed by skin bioengineering methods (transepidermal water loss, chromametry). Automated Cleansing Device may be useful for standardized evaluation of the cleansing effectiveness and parallel assessment of the corresponding irritancy potential of industrial skin cleansers. This will allow objectifying efficacy and safety of industrial skin cleansers, thus enabling market transparency and facilitating rational choice of products. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Niemeyer, P; Andereya, S; Angele, P; Ateschrang, A; Aurich, M; Baumann, M; Behrens, P; Bosch, U; Erggelet, C; Fickert, S; Fritz, J; Gebhard, H; Gelse, K; Günther, D; Hoburg, A; Kasten, P; Kolombe, T; Madry, H; Marlovits, S; Meenen, N M; Müller, P E; Nöth, U; Petersen, J P; Pietschmann, M; Richter, W; Rolauffs, B; Rhunau, K; Schewe, B; Steinert, A; Steinwachs, M R; Welsch, G H; Zinser, W; Albrecht, D
2013-02-01
Autologous chondrocyte transplantation/implantation (ACT/ACI) is an established and recognised procedure for the treatment of localised full-thickness cartilage defects of the knee. The present review of the working group "Clinical Tissue Regeneration" of the German Society of Orthopaedics and Traumatology (DGOU) describes the biology and function of healthy articular cartilage, the present state of knowledge concerning potential consequences of primary cartilage lesions and the suitable indication for ACI. Based on current evidence, an indication for ACI is given for symptomatic cartilage defects starting from defect sizes of more than 3-4 cm2; in the case of young and active sports patients at 2.5 cm2. Advanced degenerative joint disease is the single most important contraindication. The review gives a concise overview on important scientific background, the results of clinical studies and discusses advantages and disadvantages of ACI. Georg Thieme Verlag KG Stuttgart · New York.
Soto, Esteban; Richey, Christine; Stevens, Brittany; Yun, Susan; Kenelty, Kirsten; Reichley, Stephen; Griffin, Matt; Kurobe, Tomofumi; Camus, Al
2017-03-30
A mortality event in cultured white sturgeon Acipenser transmontanus (Richardson, 1836) sub-adults was investigated. After transfer between farms, high mortality was observed in fish, associated with back arching, abnormal swimming, and ulcerative skin lesions. Necropsy of moribund individuals revealed hemorrhagic ascites and petechial hemorrhages in the coelomic peritoneum and serosa of internal organs. Acipenserid herpesvirus 2 (AciHV-2) was isolated from external tissue samples, then identified and genotyped by sequencing of the terminase and polymerase genes. In addition, Streptococcus iniae was recovered from internal organs of affected fish. Histologic changes were limited to interstitial hematopoietic areas of the kidney and consisted of small foci of necrosis accompanied by fibrin deposition, minimal inflammatory response, and small numbers of bacterial cocci compatible with streptococci. Identity was confirmed by partial sequencing of the 16S rRNA, rpoB, and gyrB genes. Genetic fingerprinting demonstrated a genetic profile distinct from S. iniae isolates recovered from previous outbreaks in wild and cultured fish in North America, South America, and the Caribbean. Although the isolates were resistant to white sturgeon complement in serum killing assays, in vivo challenges failed to fulfill Koch's postulates. However, the clinical presentation, coupled with consistent recovery of S. iniae and AciHV-2 from moribund fish, suggests viral and bacterial co-infection were the proximate cause of death. To our knowledge, this represents the first report of AciHV-2 and S. iniae co-infection in cultured white sturgeon.
4th IEEE/ACIS International Conference on Computer and Information Science
2016-01-01
This edited book presents scientific results of the 14th IEEE/ACIS International Conference on Computer and Information Science (ICIS 2015) which was held on June 28 – July 1, 2015 in Las Vegas, USA. The aim of this conference was to bring together researchers and scientists, businessmen and entrepreneurs, teachers, engineers, computer users, and students to discuss the numerous fields of computer science and to share their experiences and exchange new ideas and information in a meaningful way. Research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them.
Directory of Open Access Journals (Sweden)
Farhana Anwar
2017-01-01
Full Text Available Simulation has been done using SCAPS-1D to examine the efficiency of CH3NH3SnI3-based solar cells including various HTM layers such as spiro-OMeTAD, Cu2O, and CuSCN. ZnO nanorod array has been considered as an ETM layer. Device parameters such as thickness of the CH3NH3SnI3 layer, defect density of interfaces, density of states, and metal work function were studied. For optimum parameters of all three structures, efficiency of 20.21%, 20.23%, and 18.34% has been achieved for spiro-OMeTAD, Cu2O, and CuSCN, respectively. From the simulations, an alternative lead-free perovskite solar cell is introduced with the CH3NH3SnI3 absorber layer, ZnO nanorod ETM layer, and Cu2O HTM layer.
Simulation of HTM processes in buffer-rock barriers based on the French HLW disposal concept
International Nuclear Information System (INIS)
Li, Xiaoshuo; Roehlig, Klaus-Juergen; Zhang, Chunliang
2012-01-01
Document available in extended abstract form only. The main objectives of this paper are to gain experience with modelling and analysis of HTM processes in clay rock and bentonite buffer surrounding heat-generating radioactive waste. The French concept for HLW disposal in drifts with backfilled bentonite buffer considered in numerical calculations which are carried out by using the computer code CODE-BRIGHT developed by the Technical University of Catalonia in Barcelona. The French repository designed by ANDRA is located in the middle of the Callovo-Oxfordian argillaceous formation (COX) of 250 m thickness at a depth of 500 to 630 m below the surface. The French concept has been simplified at this simulation work. A drift is considered to be excavated at a depth of 500 m below the surface. It has a diameter of 2.2 m and a length of 20 m. A large volume of the rock mass around the drift is taken into account by an axisymmetric model of 100 m radius and 100 m length. In fact, this model represents a cylindrical rock-buffer-system with the central axis of the containers, as shown in Figure 1. Some points are selected in the buffer and the rock along the radial line (dash yellow line) in the middle of the drift for recording HTM parameters with time. The display and analysis of the results at this paper are chiefly along this line. The simulation work has been divided to two time steps. At the first step, the drift excavation and ventilation is simulated by reducing the stress normal to the drift wall down to zero and circulating gas along the drift wall with relative humidity of 85 %. Following the drift excavation and ventilation, the HLW containers and the bentonite are emplaced in the drift as the second step of the simulation. This is simulated by simultaneously applying the initial conditions of the buffer and the decayed heat emitting from the waste containers as thermal boundary conditions. Two materials (Clay rock and bentonite buffer) are taken into account
12th ACIS/IEEE International Conference on Computer Science and Information Science
2013-01-01
This edited book presents scientific results of the 12th IEEE/ACIS International Conference on Computer and Information Science (ICIS 2013) which was held on June 16-20, 2013 in Toki Messe, Niigata, Japan. The aim of this conference was to bring together scientists, engineers, computer users, and students to share their experiences and exchange new ideas, research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them The conference organizers selected the best 20 papers from those papers accepted for presentation at the conference. The papers were chosen based on review scores submitted by members of the program committee, and underwent further rigorous rounds of review.
3th IEEE/ACIS International Conference on Computer and Information Science
2015-01-01
This edited book presents scientific results of the 13th IEEE/ACIS International Conference on Computer and Information Science (ICIS 2014) which was held on June 4-6, 2014 in Taiyuan, China. The aim of this conference was to bring together researchers and scientists, businessmen and entrepreneurs, teachers, engineers, computer users, and students to discuss the numerous fields of computer science and to share their experiences and exchange new ideas and information in a meaningful way. Research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them. The conference organizers selected the best papers from those papers accepted for presentation at the conference. The papers were chosen based on review scores submitted by members of the program committee, and underwent further rigorous rounds of review. This publication captures 14 of the conference’s most promis...
Shiraki, Katsuhisa; Lu, Huimei; Ishimura, Yoshimasa; Kashiwabara, Shoji; Uesaka, Toshihiro; Katoh, Osamu; Watanabe, Hiromitsu
2002-09-01
In this experiment, methylnitrosourea (MNU) was administered, followed by N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), to assess effects of surrogate mothering on tumor. One or two day old male SD pups were treated with or without 30 mg/kg body weight of MNU and nursed by SD or ACI surrogate mothers for 5 weeks. When 6-weeks-old they were then treated with 100 ppm MNNG or tap water for 16 weeks. The tumor incidence in the MNNG alone group was significantly lower than with MNU alone or MNU+MNNG (p surrogate mothers after treatment with MNU was increased as compared with the SD mother group. Cumulative development of tumors in the ACI surrogate mother group was also delayed (p mother's milk.
Studies in Computational Intelligence : Volume 492
2013-01-01
This edited book presents scientific results of the 14th ACIS/IEEE International Conference on Software Engineering, Artificial Intelligence, Networking and Parallel/Distributed Computing (SNPD 2013), held in Honolulu, Hawaii, USA on July 1-3, 2013. The aim of this conference was to bring together scientists, engineers, computer users, and students to share their experiences and exchange new ideas, research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them. The conference organizers selected the 17 outstanding papers from those papers accepted for presentation at the conference.
2015-01-01
This edited book presents scientific results of 15th IEEE/ACIS International Conference on Software Engineering, Artificial Intelligence, Networking and Parallel/Distributed Computing (SNPD 2014) held on June 30 – July 2, 2014 in Las Vegas Nevada, USA. The aim of this conference was to bring together scientists, engineers, computer users, and students to share their experiences and exchange new ideas, research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them. The conference organizers selected the 13 outstanding papers from those papers accepted for presentation at the conference.
2016-01-01
This edited book presents scientific results of the 16th IEEE/ACIS International Conference on Software Engineering, Artificial Intelligence, Networking and Parallel/Distributed Computing (SNPD 2015) which was held on June 1 – 3, 2015 in Takamatsu, Japan. The aim of this conference was to bring together researchers and scientists, businessmen and entrepreneurs, teachers, engineers, computer users, and students to discuss the numerous fields of computer science and to share their experiences and exchange new ideas and information in a meaningful way. Research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them.
SNPD 2016
2016-01-01
This edited book presents scientific results of the 17th IEEE/ACIS International Conference on Software Engineering, Artificial Intelligence, Networking and Parallel/Distributed Computing (SNPD 2016) which was held on May 30 - June 1, 2016 in Shanghai, China. The aim of this conference was to bring together researchers and scientists, businessmen and entrepreneurs, teachers, engineers, computer users, and students to discuss the numerous fields of computer science and to share their experiences and exchange new ideas and information in a meaningful way. Research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them.
Hemp farming development and socioeconomic position of Bačka: Example of Odžaci
Directory of Open Access Journals (Sweden)
Stojanović Vladimir
2016-01-01
Full Text Available Hemp is a very important agricultural crop for Bačka region. For centuries, hemp had been grown in this area and it had a crucial importance not only for the agriculture, but for the industry and trade of this region as well. From uncultivated, poorly inhabited and underdeveloped area in 18th century, Bačka made its way to a promising region in which agriculture and industry represent the backbone of the economic development. Significant number of colonial settlements from 18th century and colonization period during rule of Austro-Hungarian empress Maria Theresa recognized growing hemp as their main opportunities to prosper. Later on, in these settlements, the small manufactories for hemp processing were built which eventually had grown into larger factories for hemp fabric production. The town of Odžaci was one of these settlements. From a small colonial settlement, it became one of the important industrial centres in Bačka region.
Möller, Frank Josef; Pemp, Daniela; Soukup, Sebastian T; Wende, Kathleen; Zhang, Xiajie; Zierau, Oliver; Muders, Michael H; Bosland, Maarten C; Kulling, Sabine E; Lehmann, Leane; Vollmer, Günter
2016-08-01
There is an ongoing debate whether the intake of soy-derived isoflavones (sISO) mediates beneficial or adverse effects with regard to breast cancer risk. Therefore, we investigated whether nutritional exposure to a sISO-enriched diet from conception until adulthood impacts on 17β-estradiol (E2)-induced carcinogenesis in the rat mammary gland (MG). August-Copenhagen-Irish (ACI) rats were exposed to dietary sISO from conception until postnatal day 285. Silastic tubes containing E2 were used to induce MG tumorigenesis. Body weight, food intake, and tumor growth were recorded weekly. At necropsy, the number, position, size, and weight of each tumor were determined. Plasma samples underwent sISO analysis, and the morphology of MG was analyzed. Tumor incidence and multiplicity were reduced by 20 and 56 %, respectively, in the sISO-exposed rats compared to the control rats. Time-to-tumor onset was shortened from 25 to 20 weeks, and larger tumors developed in the sISO-exposed rats. The histological phenotype of the MG tumors was independent of the sISO diet received, and it included both comedo and cribriform phenotypes. Morphological analyses of the whole-mounted MGs also showed no diet-dependent differences. Lifelong exposure to sISO reduced the overall incidence of MG carcinomas in ACI rats, although the time-to-tumor was significantly shortened.
International Nuclear Information System (INIS)
Qian Jun; Feng Gansheng
2003-01-01
Objective: To evaluate the therapeutic efficiency of various methods of interventional therapy in the ACI-rat model of hepatocellular carcinoma, and to assess the value of this model in the experiments of interventional therapy. Methods: The subcapsular implantation of a solid Morris Hepatoma 3924A (1 mm 3 ) in the livers was carried out in 58 male ACI-rats. 13 days after the implantation, the tumor volume (V 1 ) was measured by using magnetic resonance tomography (MRT). After laparotomy and retrograde placement of catheter into the gastroduodenal artery (14 d), the following protocols of interventional therapy were performed: (A) Mitomycin C (n = 4); (B) Degradable starch microspheres (DSM) (n = 4); (C) Lipiodol (n = 5); (D) Ligation (n = 4); (E) Mitomycin C + DSM (n = 4); (F) Mitomycin C + ligation (n = 5); (G) Mitomycin C + Lipiodol (n = 5); (H) DSM + ligation (n = 4); (I) Lipiodol + ligation (n = 4); (J) Mitomycin C + Poly-lactide-coglycollide-microspheres (Plcg) (n = 4); (K) Mitomycin C + Lipiodol + ligation (n = 4); (L) Mitomycin C + DSM + ligation (n = 4); (M) 0.9% NaCl (control group, n = 7). 13 days after these therapies the change of the tumor volume (V 2 ) was determined by MRT again. Results: The rate of implantation was 100%. V 2 /V 1 was 4.50 in group A, 12.73 in group B, 15.84 in group C, 10.17 in group D, 90.20 in group E, 7.16 in group F, 4.08 in group G, 3.45 in group H, 9.99 in group I, 2.86 in group J, 3.76 in group K, 7.71 in group L, and 27.12 in group M, respectively. Compared to the control group, groups A, G, H, J and K showed significant reduced tumor growth (χ 2 = 5.238, 8.571, 5.238, 5.238, 5.238, P = 0.045, 0.008, 0.045, 0.045, 0.045) in the period of observation, whereas the other groups showed no statistical significant differences by the tumor growth [χ 2 = 1.016(B), 3.086(C), 1.016(D), 2.213(E), 3.086(F), 1.061(I), 1.061(L), P = 0.348 (B), 0.121 (C), 0.348 (D), 0.199 (E), 0.121 (F), 0.348 (I), 0.348(L)]. Conclusion: This model of
Shiraki, Katsuhisa; Lu, Huimei; Ishimura, Yoshimasa; Kashiwabara, Shoji; Uesaka, Toshihiro; Katoh, Osamu; Watanabe, Hiromitsu
2002-01-01
In this experiment, MNU was administered, followed by MNNG, to assess effects ofsurrogate mothering on tumor. One or two day old male SD pups were treated with or without30mg/kg body weight of methylnitrosourea (MNU) and nursed by SD or ACI surrogate mothersfor 5 weeks. When 6-weeks-old they were then treated with 100ppmN-methyl-N-nitro-N-nitrosoguanidine (MNNG) or tap water for 16 weeks. The tumor incidencein the MNNG alone group was significantly lower than with MNU alone or MNU+MNNG (p
International Nuclear Information System (INIS)
Mori, Hideki; Iwata, Hitoshi; Morishita, Yukio; Mori, Yoshio; Ohno, Takatoshi; Tanaka, Takuji; Sasaki, Shunsaku.
1990-01-01
The effect of radiation on chemical hepatocarcinogenesis was examined in 3 groups of male ACI/N rats. In Group I, 21 rats received dietary administration of N-2-fluorenylacetamide (FAA) (0.02%) for 16 weeks. Six of the rats were killed at the cessation of FAA exposure. The remaining rats were then given the basal diet until termination (32 weeks). In Group II, 16 rats were given FAA for 16 weeks. The animals were then given radiation (whole body; 3 Gy) and kept on the diet for the subsequent 16 weeks. Thirteen rats of Group III were kept on the basal diet throughout the experiment. They received radiation for 16 weeks after the start of the experiment. Liver tumors were obtained in Groups I and II. The multiplicity of the neoplastic nodules or hepatocellular carcinomas of Group II (6.5±2.5 or 1.4±0.9) was significantly greater than that of Group I (2.9±1.7 or 0.3±0.4, respectively) (p<0.001). Furthermore, the incidence of hepatocellular carcinoma of Group II (13/16) was also significantly higher than that of Group I (4/15) (p<0.003). The results clearly indicate a synergistic effect of radiation with FAA on the hepatocarcinogenesis. The effect of radiation in this rat model appeared to be on the early progression of the carcinogenesis. (author)
Curcumin Implants, not Curcumin Diet Inhibits Estrogen-Induced Mammary Carcinogenesis in ACI Rats
Bansal, Shyam S.; kausar, Hina; Vadhanam, Manicka V.; Ravoori, Srivani; Pan, Jianmin; Rai, Shesh N.; Gupta, Ramesh C.
2014-01-01
Curcumin is widely known for its anti-oxidant, anti-inflammatory and anti-proliferative activities in cell culture studies. However, poor oral bioavailability limited its efficacy in animal and clinical studies. Recently, we developed polymeric curcumin implants that circumvents oral bioavailability issues, and tested their potential against 17β-estradiol (E2)-mediated mammary tumorigenesis. Female ACI rats were administered curcumin either via diet (1,000 ppm) or via polymeric curcumin implants (two 2-cm; 200 mg each; 20% drug load) 4 days prior to grafting a subcutaneous E2 silastic implant (1.2 cm, 9 mg E2). Implants were changed after 4½ months to provide higher curcumin dose at the appearance of palpable tumors. The animals were euthanized after 3 weeks, 3 months and after the tumor incidence reached >80% (~6 months) in control animals. The curcumin administered via implants resulted in significant reduction in both the tumor multiplicity (2±1 vs 5±3; p=0.001) and tumor volume (184±198 mm3 vs 280±141 mm3; p=0.0283); the dietary curcumin, however, was ineffective. Dietary curcumin increased hepatic CYP1A and CYP1B1 activities without any effect on CYP3A4 activity whereas curcumin implants increased both CYP1A and CYP3A4 activities but decreased CYP1B1 activity in presence of E2. Since CYP1A and 3A4 metabolize most of the E2 to its non-carcinogenic 2-OH metabolite and CYP1B1 produces potentially carcinogenic 4-OH metabolite, favorable modulation of these CYPs via systemically delivered curcumin could be one of the potential mechanisms. The analysis of plasma and liver by HPLC showed substantially higher curcumin levels via implants versus the dietary route despite substantially higher dose administered. PMID:24501322
Wang, Junfeng; Fabbiano, G.; Elvis, M.; Risaliti, G.; Karovska, M.; Zezas, A.; Mundell, C. G.
2011-05-01
We report on the imaging analysis of 200 ks Chandra ACIS-S observations of the nearby Seyfert 1 galaxy NGC 4151. Structured soft X-ray emission is observed to extend from 30 pc to 1.5 kpc. We find strong evidence for jet-gas cloud interaction in the inner 150 pc region, confirming our previous HRC results. Self-consistent photoionization models provide good descriptions of the spectra of the optical bi-cone, supporting the dominant role of nuclear photoionization. Presence of both low and high ionization spectral components and extended emission in the X-ray image perpendicular to the bi-cone indicates leakage of nuclear ionization. Using spatially resolved features, we estimate the kinematic power of the outflow in NGC 4151 to be 0.3% of its bolometric luminosity. This work is supported by NASA grant GO8-9101X and GO1-12009X.
Liu, Xiangyan; Dai, Xiaobing; He, Xudong; Gao, Pengcheng
2013-10-01
Image-spectrum integrated instrument is an infrared scanning system which integrates optics, mechanics, electrics and information processing. Not only can it achieve scene imaging, but also it can detect, track and identify targets of interests in the scene through acquiring their spectra. After having a brief introduction to image-spectrum integrated instrument and analyzing how 2D scanning mirror works, this paper built 3D model of 2D scanning mirror and simulated its motion using two PCs basing on VC++ and ACIS/HOOPS. Two PCs communicate with each other through serial ports. One PC serves as host computer, on which controlling software runs, is responsible for loading image sequence, image processing, target detecting, and generating and sending motion commands to scanning mirror. The other serves as slave computer, on which scanning mirror motion simulation software runs, is responsible for receiving motion commands to control scanning mirror to finish corresponding movements. This method proposed in this paper adopted semi-physical virtual prototype technology and used real scene image sequence to control virtual 2D scanning mirror and simulates motion of real 2D scanning mirror. It has no need for real scanning mirror and is of important practical significance for debugging controlling software of 2D scanning mirror.
International Nuclear Information System (INIS)
Wang, Junfeng; Fabbiano, Giuseppina; Elvis, Martin; Risaliti, Guido; Karovska, Margarita; Zezas, Andreas; Mundell, Carole G.; Dumas, Gaelle; Schinnerer, Eva
2011-01-01
This paper is the third in a series in which we present deep Chandra ACIS-S imaging spectroscopy of the Seyfert 1 galaxy NGC 4151, devoted to study its complex circumnuclear X-ray emission. Emission features in the soft X-ray spectrum of the bright extended emission (L 0.3-2 k eV ∼ 10 40 erg s –1 ) at r > 130 pc (2'') are consistent with blended brighter O VII, O VIII, and Ne IX lines seen in the Chandra HETGS and XMM-Newton RGS spectra below 2 keV. We construct emission line images of these features and find good morphological correlations with the narrow-line region clouds mapped in [O III] λ5007. Self-consistent photoionization models provide good descriptions of the spectra of the large-scale emission, as well as resolved structures, supporting the dominant role of nuclear photoionization, although displacement of optical and X-ray features implies a more complex medium. Collisionally ionized emission is estimated to be ∼ ☉ yr –1 at 130 pc and the kinematic power of the ionized outflow is 1.7 × 10 41 erg s –1 , approximately 0.3% of the bolometric luminosity of the active nucleus in NGC 4151.
Wang, Junfeng; Fabbiano, Giuseppina; Risaliti, Guido; Elvis, Martin; Karovska, Margarita; Zezas, Andreas; Mundell, Carole G.; Dumas, Gaelle; Schinnerer, Eva
2011-03-01
We report on the imaging analysis of ~200 ks sub-arcsecond resolution Chandra Advanced CCD Imaging Spectrometer (ACIS-S) observations of the nearby Seyfert 1 galaxy NGC 4151. Bright, structured soft X-ray emission is observed to extend from 30 pc to 1.3 kpc in the southwest from the nucleus, much farther than seen in earlier X-ray studies. The terminus of the northeastern X-ray emission is spatially coincident with a CO gas lane, where the outflow likely encounters dense gas in the host galactic disk. X-ray emission is also detected outside the boundaries of the ionization cone, which indicates that the gas there is not completely shielded from the nuclear continuum, as would be the case for a molecular torus collimating the bicone. In the central r < 200 pc region, the subpixel processing of the ACIS data recovers the morphological details on scales of <30 pc (<0farcs5) first discovered in Chandra High Resolution Camera images. The X-ray emission is more absorbed toward the boundaries of the ionization cone, as well as perpendicular to the bicone along the direction of a putative torus in NGC 4151. The innermost region where X-ray emission shows the highest hardness ratio is spatially coincident with the near-infrared-resolved H2 emission and dusty spirals we find in an Hubble Space Telescope V - H color image. The agreement between the observed H2 line flux and the value predicted from X-ray-irradiated molecular cloud models supports photo-excitation by X-rays from the active nucleus as the origin of the H2 line, although contribution from UV fluorescence or collisional excitation cannot be ruled out with current data. The discrepancy between the mass of cold molecular gas inferred from recent CO and near-infrared H2 observations may be explained by the anomalous CO abundance in this X-ray-dominated region. The total H2 mass derived from the X-ray observation agrees with the recent measurement by Storchi-Bergmann et al.
International Nuclear Information System (INIS)
Truebenbach, Jochen; Graepler, Florian; Pereira, Philippe L; Ruck, Peter; Lauer, Ulrich; Gregor, Michael; Claussen, Claus-D.; Huppert, Peter E.
2000-01-01
Purpose: For experimental studies investigating modalities and efficacy of transarterial chemoembolization (TACE) in hepatocellular carcinoma (HCC) an animal model resembling the human situation as closely as possible would be appropriate. Specifically, reproducible tumor growth characteristics with the capability for appropriate in vivo imaging to monitor treatment efficacy are required.Methods: Morris hepatoma 3924A was implanted into the liver of 30 ACI rats. Tumor growth was followed by angiography (n=10), ultrasound (US, n=30), native computed tomography (CT. n=16), and native magnetic resonance imaging (MRU n=30) between day 8 and day 36 after implantation. The radiological morphological characteristics were compared with the macroscopic and microscopic histological findings of the explanted tumors.Results: In all 30 animals a solitary liver tumor was found and macroscopically no signs of metastases, ascites, or peritoneal tumor were visible. On histopathological examination tumor sizes ranged between 27 ± 3 mm 3 (day 8) and 3468 ± 79 mm 3 (day 36). The first signs of tumor necrosis occurred at day 16. US allowed tumor visualization from day 8, MRI from day 8, angiography from day 10, and CT from day 14.Conclusions: The tumor model has the potential to be used for the visualization of tumor growth by MRI and US. The potential for monitoring therapeutic effects of TACE needs to be investigated.
International Nuclear Information System (INIS)
Kotowicz, Janusz; Michalski, Sebastian
2015-01-01
An oxy-type power plant was analyzed in this paper, equipped with a hard-coal-fired pulverized fuel boiler, a steam turbine, a CO 2 capture unit and an ASU (air separation unit) with a four-end-type high-temperature membrane. The gross electrical power of the plant is 600 MW; the live and reheated steam parameters are 650 °C/30 MPa and 670 °C/6 MPa, respectively. In this paper, computations were performed for three air compressor pressure ratios (β = 15; 20; 30) and a range of oxygen recovery rate (50% ≤ R ≤ ∼99%). The net efficiency of the oxy-type plant reached 38.7% compared to 46.5% for the reference plant. The equation to calculate a membrane area was derived in this paper. The defining dependence relationship between the R and β was also derived. The total investment costs for the ASU and the entire plant was determined as a function of R and β. Similarly, the break-even price of electricity and its individual components were determined. The break-even price for R ≈ 98% and β = 15 is 1.73 EUR/MWh higher than for the reference plant (63.14 EUR/MWh). In the conducted risk analysis, a Monte Carlo method was used. With a probability of 50%, the break-even price for the oxy-type and reference plants are ≤67.05 EUR/MWh and ≤69.98 EUR/MWh, respectively. - Highlights: • Analysis of a power plant with a “four-end” HTM for oxygen production was made. • The equation to calculate the HT membrane area was derived in this paper. • Break-even price of electricity of analyzed and reference plants were determined. • Risk analysis of the analyzed and reference plants was made. • Comparison of all results for the analyzed and reference plants were made
Moyer, Richard A; Hummer, Kim E; Finn, Chad E; Frei, Balz; Wrolstad, Ronald E
2002-01-30
Fruits from 107 genotypes of Vaccinium L., Rubus L., and Ribes L., were analyzed for total anthocyanins (ACY), total phenolics (TPH), and antioxidant capacities as determined by oxygen radical absorbing capacity (ORAC) and ferric reducing antioxidant power (FRAP). Fruit size was highly correlated (r = 0.84) with ACY within Vaccinium corymbosum L., but was not correlated to ACY across eight other Vaccinium species, or within 27 blackberry hybrids. Certain Vaccinium and Ribes fruits with pigmented flesh were lower in ACY, TPH, ORAC, and FRAP compared to those values in berries with nonpigmented flesh. ORAC values ranged from 19 to 131 micromol Trolox equivalents/g in Vaccinium, from 13 to 146 in Rubus, and from 17 to 116 in Ribes. Though ACY may indicate TPH, the range observed in ACY/TPH ratios precludes prediction of ACY from TPH and vice versa for a single genotype. In general, TPH was more highly correlated to antioxidant capacity than ACY was. This study demonstrates the wide diversity of phytochemical levels and antioxidant capacities within and across three genera of small fruit.
International Nuclear Information System (INIS)
Horiguchi, Takashi; Yoshida, Kazunari; Sato, Syuzo; Kawase, Takeshi; Toya, Shigeo; Mizukami, Masahiro
1998-01-01
In this study we described the significance of asymptomatic cerebral infarction (ACI) and periventricular hyperintensity (PVH) observed on brain MRI in a system for detection of asymptomatic brain disease with 1,200 cases. The risk factors (RF), population in each age bracket of ACI and PVH, among groups with hypertension (HTG) and without RF (no-RFG), were investigated. The RF of ACI were hypertension (HT), diabetes mellitus (DM), and aging. Without DM, those are common RF of PVH. The population of PVH and ACI with PVH increased with aging in no-RFG. On the other hand, only the population of ACI with PVH increased with aging in HTG. The rate of these abnormal findings in HTG was significantly higher than that in no-RFG. In addition, HT accelerated the occurrence of these findings by 10-20 years. When patients were over 60 years old, ACI increased rapidly. Accordingly, we concluded that PVH and ACI had a common background. Long term follow up concerning the incidence of ACI in the group with only PVH was necessary. It was desirable that treatment for RF should be effected before the age of sixty. (author)
Directory of Open Access Journals (Sweden)
Agranati, G.
2010-12-01
Full Text Available The objective of this study is to evaluate the applicability of the ACI-08, EC-2, and EHE-08 models for the estimating of the mechanical properties of self-compacting concrete (SCC. The mechanical properties considered are the modulus of elasticity, tensile strength, and modulus of rupture. In order to statistically evaluate the applicability of the models it was necessary to compile an extensive database that included the experimental results for the various mechanical properties analyzed and the exact dosifications of the mixtures. The first part of the study includes an analysis of each one of the models, together with a regression analysis in order to evaluate the behavior and the adaptability to the different models. The specific characterization parameters for each concrete mixture were used to calculate the various mechanical properties applying the different estimation models. The second part of the analysis consisted in comparing the experimental results with the estimated results for all the mixtures in order to evaluate the applicability of these models to SCC.
El presente trabajo de investigación tiene como finalidad estudiar la aplicabilidad de los modelos de cálculo del ACI-08, Eurocódigo 2 y de la EHE-08 utilizados para la estimar las propiedades mecánicas del hormigón convencional, en el hormigón autocompactante. Las propiedades mecánicas estudiadas han sido: el módulo de deformación, la resistencia a tracción y la resistencia a flexotracción. Para llevar a cabo la investigación fue necesario construir una extensa base de datos que permitiera albergar en ella una gran cantidad de dosificaciones de hormigón autocompactante y un amplio rango de valores de sus propiedades mecánicas para lograr una muestra lo más representativa posible. En primera instancia se comparó el comportamiento de cada uno de estos modelos normativos de cálculo, con la curva de regresión de los datos obtenidos para el hormig
Wang, Junfeng; Fabbiano, Giuseppina; Elvis, Martin; Risaliti, Guido; Karovska, Margarita; Zezas, Andreas; Mundell, Carole G.; Dumas, Gaelle; Schinnerer, Eva
2011-11-01
This paper is the third in a series in which we present deep Chandra ACIS-S imaging spectroscopy of the Seyfert 1 galaxy NGC 4151, devoted to study its complex circumnuclear X-ray emission. Emission features in the soft X-ray spectrum of the bright extended emission (L 0.3-2 keV ~ 1040 erg s-1) at r > 130 pc (2'') are consistent with blended brighter O VII, O VIII, and Ne IX lines seen in the Chandra HETGS and XMM-Newton RGS spectra below 2 keV. We construct emission line images of these features and find good morphological correlations with the narrow-line region clouds mapped in [O III] λ5007. Self-consistent photoionization models provide good descriptions of the spectra of the large-scale emission, as well as resolved structures, supporting the dominant role of nuclear photoionization, although displacement of optical and X-ray features implies a more complex medium. Collisionally ionized emission is estimated to be lsim12% of the extended emission. Presence of both low- and high-ionization spectral components and extended emission in the X-ray image perpendicular to the bicone indicates leakage of nuclear ionization, likely filtered through warm absorbers, instead of being blocked by a continuous obscuring torus. The ratios of [O III]/soft X-ray flux are approximately constant (~15) for the 1.5 kpc radius spanned by these measurements, indicating similar relative contributions from the low- and high-ionization gas phases at different radial distances from the nucleus. If the [O III] and X-ray emission arise from a single photoionized medium, this further implies an outflow with a wind-like density profile. Using spatially resolved X-ray features, we estimate that the mass outflow rate in NGC 4151 is ~2 M ⊙ yr-1 at 130 pc and the kinematic power of the ionized outflow is 1.7 × 1041 erg s-1, approximately 0.3% of the bolometric luminosity of the active nucleus in NGC 4151.
Role Strain in Collegiate Athletic Training Approved Clinical Instructors
Henning, Jolene M; Weidner, Thomas G
2008-01-01
Context: Certified athletic trainers who serve as Approved Clinical Instructors (ACIs) in the collegiate setting are balancing various roles (eg, patient care and related administrative tasks, clinical education). Whether this balancing act is associated with role strain in athletic trainers has not been examined. Objective: To examine the degree of, and contributing factors (eg, socialization experiences, professional and employment demographics, job congruency) to, role strain in collegiate ACIs. Design: Cross-sectional survey design. Setting: Geographically stratified random sample of ACIs affiliated with accredited athletic training education programs at National Collegiate Athletic Association (NCAA) Division I, II, and III institutions. Patients or Other Participants: 118 collegiate ACIs (47 head athletic trainers, 45 assistant athletic trainers, 26 graduate assistant athletic trainers). Main Outcome Measure(s): The Athletic Training ACI Role Strain Inventory, which measures total degree of role strain, 7 subscales of role strain, socialization experiences, professional and employment characteristics, and congruency in job responsibilities. Results: A total of 49% (n = 58) of the participants experienced a moderate to high degree of role strain. Role Overload was the highest contributing subscale to total role strain. No differences were noted between total role strain and role occupant groups, NCAA division, or sex. Graduate assistant athletic trainers experienced a greater degree of role incompetence than head athletic trainers did (P = .001). Division II ACIs reported a greater degree of inter-role conflict than those in Division I (P = .02). Female ACIs reported a greater degree of role incompetence than male ACIs (P = .01). Those ACIs who stated that the ACI training provided by their institution did not adequately prepare them for the role as an ACI experienced greater role strain (P < .001). Conclusions: The ACIs in the
Energy Technology Data Exchange (ETDEWEB)
Wang, Song; Qiu, Yanli; Liu, Jifeng [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Bregman, Joel N., E-mail: songw@bao.ac.cn, E-mail: jfliu@bao.ac.cn [University of Michigan, Ann Arbor, MI 48109 (United States)
2016-09-20
Based on the recently completed Chandra /ACIS survey of X-ray point sources in nearby galaxies, we study the X-ray luminosity functions (XLFs) for X-ray point sources in different types of galaxies and the statistical properties of ultraluminous X-ray sources (ULXs). Uniform procedures are developed to compute the detection threshold, to estimate the foreground/background contamination, and to calculate the XLFs for individual galaxies and groups of galaxies, resulting in an XLF library of 343 galaxies of different types. With the large number of surveyed galaxies, we have studied the XLFs and ULX properties across different host galaxy types, and confirm with good statistics that the XLF slope flattens from lenticular ( α ∼ 1.50 ± 0.07) to elliptical (∼1.21 ± 0.02), to spirals (∼0.80 ± 0.02), to peculiars (∼0.55 ± 0.30), and to irregulars (∼0.26 ± 0.10). The XLF break dividing the neutron star and black hole binaries is also confirmed, albeit at quite different break luminosities for different types of galaxies. A radial dependency is found for ellipticals, with a flatter XLF slope for sources located between D {sub 25} and 2 D {sub 25}, suggesting the XLF slopes in the outer region of early-type galaxies are dominated by low-mass X-ray binaries in globular clusters. This study shows that the ULX rate in early-type galaxies is 0.24 ± 0.05 ULXs per surveyed galaxy, on a 5 σ confidence level. The XLF for ULXs in late-type galaxies extends smoothly until it drops abruptly around 4 × 10{sup 40} erg s{sup −1}, and this break may suggest a mild boundary between the stellar black hole population possibly including 30 M {sub ⊙} black holes with super-Eddington radiation and intermediate mass black holes.
Carbon emission intensity in electricity production: A global analysis
International Nuclear Information System (INIS)
Ang, B.W.; Su, Bin
2016-01-01
We study changes in the aggregate carbon intensity (ACI) for electricity at the global and country levels. The ACI is defined as the energy-related CO_2 emissions in electricity production divided by the electricity produced. It is a performance indicator since a decrease in its value is a desirable outcome from the environmental and climate change viewpoints. From 1990 to 2013, the ACI computed at the global level decreased only marginally. However, fairly substantial decreases were observed in many countries. This apparent anomaly arises from a geographical shift in global electricity production with countries having a high ACI increasingly taking up a larger electricity production share. It is found that globally and in most major electricity producing countries, reduction in their ACI was due mainly to improvements in the thermal efficiency of electricity generation rather than to fuel switching. Estimates of the above-mentioned effects are made using LMDI decomposition analysis. Our study reveals several challenges in reducing global CO_2 emissions from the electricity production sector although technically the reduction potential for the sector is known to be great. - Highlights: •Variations of aggregate carbon intensity (ACI) for electricity of world countries are analysed. •Main drivers of changes in ACI of major electricity producing countries are studied using index decomposition analysis. •Geographical shift in electricity production had a significant impact on global ACI. •Improvements in the thermal efficiency of generation were the main driver of reduction in ACI.
DEFF Research Database (Denmark)
Niemeyer, Philipp; Pestka, Jan M; Kreuz, Peter C
2008-01-01
BACKGROUND: Although autologous chondrocyte implantation (ACI) is a well-established therapy for the treatment of isolated cartilage defects of the knee joint, little is known about typical complications and their treatment after ACI. HYPOTHESIS: Unsatisfactory outcome after ACI is associated...
Improving Bridging from Informatics Practice to Theory.
Lehmann, C U; Gundlapalli, A V
2015-01-01
In 1962, Methods of Information in Medicine ( MIM ) began to publish papers on the methodology and scientific fundamentals of organizing, representing, and analyzing data, information, and knowledge in biomedicine and health care. Considered a companion journal, Applied Clinical Informatics ( ACI ) was launched in 2009 with a mission to establish a platform that allows sharing of knowledge between clinical medicine and health IT specialists as well as to bridge gaps between visionary design and successful and pragmatic deployment of clinical information systems. Both journals are official journals of the International Medical Informatics Association. As a follow-up to prior work, we set out to explore congruencies and interdependencies in publications of ACI and MIM. The objectives were to describe the major topics discussed in articles published in ACI in 2014 and to determine if there was evidence that theory in 2014 MIM publications was informed by practice described in ACI publications in any year. We also set out to describe lessons learned in the context of bridging informatics practice and theory and offer opinions on how ACI editorial policies could evolve to foster and improve such bridging. We conducted a retrospective observational study and reviewed all articles published in ACI during the calendar year 2014 (Volume 5) for their main theme, conclusions, and key words. We then reviewed the citations of all MIM papers from 2014 to determine if there were references to ACI articles from any year. Lessons learned in the context of bridging informatics practice and theory and opinions on ACI editorial policies were developed by consensus among the two authors. A total of 70 articles were published in ACI in 2014. Clinical decision support, clinical documentation, usability, Meaningful Use, health information exchange, patient portals, and clinical research informatics emerged as major themes. Only one MIM article from 2014 cited an ACI article. There
International Nuclear Information System (INIS)
Oluwole, S.F.; Iga, C.; Lau, H.; Hardy, M.A.
1985-01-01
The effect of donor-specific blood transfusion was compared to that of UVB-irradiated donor-specific blood transfusion on heart allograft survival in inbred rats with major histocompatibility differences. In one series ACI rats received heterotopic heart grafts from Lewis rats and 1 mL transfusion of donor-type blood at 1, 2, and 3 weeks prior to the transplantation. Fifty percent of the grafts were permanently accepted (survival greater than 200 days). Following UVB-irradiated donor-specific blood transfusion, 55% of the grafts survived indefinitely. In a mixed lymphocyte reaction ACI lymphocytes are weak responders to Lewis lymphocytes. In another series, Lewis rats received ACI hearts. Donor-specific transfusions at 1, 2, and 3 weeks prior to transplantation did not significantly alter the survival of heart allografts. Lewis lymphocytes react strongly to ACI stimulator cells in a mixed lymphocyte reaction. However, when the donor blood was UVB-irradiated prior to transfusion, the ACI allograft survival was significantly prolonged in this ACI-to-Lewis strain combination. When Lewis rats received W/F hearts following either donor-specific or UVB-irradiated donor-specific transfusions, the hearts' survival was similarly and significantly prolonged, but did not become permanent. Mixed lymphocyte reaction reveals that the stimulation index of Lewis lymphocytes against W/F lymphocytes is greater than that of ACI versus Lewis, but is less than that between Lewis responder cells against ACI stimulators
Directory of Open Access Journals (Sweden)
Elena Moreno Pulido
2008-01-01
Full Text Available Este trabajo tiene como objetivo el estudio de la iconografía monetaria de las cecas marítimas de la Bética, desde los inicios de su acuñación hasta el cierre de las mismas. El análisis sincrónico, iconográfico e iconológico conjunto de su numerario muestra las conexiones económicas y culturales entre estas ciudades, a la vez que presenta visualmente el avance de la romanización, así como la integración de estas comunidades, tradicionalmente púnicas, en la cultura latinaThis work takes as a target the study of the monetary iconography of the marine mints of the Baetica, from the beginnings of his coinage up to the closing of the same ones. The synchronous iconographic and iconologic analysis of his money shows the economic and cultural connections between these cities, simultaneously it presents visually the advance of the roman civilization, as well as the integration of these communities, phoenician traditionally, in the Latin culture.
Diversity and Seasonal Dynamics of Actinobacteria Populations in Four Lakes in Northeastern Germany
Allgaier, Martin; Grossart, Hans-Peter
2006-01-01
The phylogenetic diversity and seasonal dynamics of freshwater Actinobacteria populations in four limnologically different lakes of the Mecklenburg-Brandenburg Lake District (northeastern Germany) were investigated. Fluorescence in situ hybridization was used to determine the seasonal abundances and dynamics of total Actinobacteria (probe HGC69a) and the three actinobacterial subclusters acI, acI-A, and acI-B (probes AcI-852, AcI-840-1, and AcI-840-2). Seasonal means of total Actinobacteria abundances in the epilimnia of the lakes varied from 13 to 36%, with maximum values of 30 to 58%, of all DAPI (4′,6′-diamidino-2-phenylindole)-stained cells. Around 80% of total Actinobacteria belonged to the acI cluster. The two subclusters acI-A and acI-B accounted for 60 to 91% of the acI cluster and showed seasonal means of 49% (acI-B) and 23% (acI-A) in relation to the acI cluster. Total Actinobacteria and members of the clusters acI and acI-B showed distinct seasonal changes in their absolute abundances, with maxima in late spring and fall/winter. In eight clone libraries constructed from the lakes, a total of 76 actinobacterial 16S rRNA gene sequences were identified from a total of 177 clones. The majority of the Actinobacteria sequences belonged to the acI and acIV cluster. Several new clusters and subclusters were found (acSTL, scB1-4, and acIVA-D). The majority of all obtained 16S rRNA gene sequences are distinct from those of already-cultured freshwater Actinobacteria. PMID:16672495
International Nuclear Information System (INIS)
Shinagawa, Toshio; Hiraiwa, Yoshio; Mizuno, Seio; Kusunoki, Norio; Nitta, Yu; Matsubara, Takao; Iwainaka, Yoichi; Konishi, Hideo
1992-01-01
Quantitative analysis of abdominal aorta calcification by X-ray CT is useful method for non-invasive diagnosis of atherosclerosis. We recently examined the relationship between the X-ray CT measurement of abdominal aorta calcification and the degree of obesity. For this purpose, the body mass index (BMI) and the subcutaneous fat thickness (determined by X-ray CT at the umbilical level) were analyzed in relation to the abdominal aorta calcification index (ACI) in 845 patients (453 males and 392 females aged 40-79 years). Patients with BMI under 20 were classified as 'lean', those with BMI between 20-26 as 'normal' and those with BMI over 26 as 'obese'. 1. Among males, the ACI was highest in lean individuals and lowest in obese individuals. The difference in ACI between lean and obese males was significant in the middle aged group (40-65 years). Among females, no relationship was observed between the degree of obesity and ACI. 2. Among males, ACI was higher in individuals with low subcutaneous fat thickness and lower in individuals with greater subcutaneous fat thickness. The difference was significant in the middle aged group. Among females, no relationship was observed between the two parameters. 3. When the visceral fat to subcutaneous fat ratio (V/S) in 85 males and females aged 60-69 years was analyzed in relation to ACI, ACI tended to decrease as the V/S increased, in both males and females. 4. Relationships between BMI and subcutaneous fat thickness, between BMI and lipids and between lipids and ACI were also analyzed. (author)
Zhang, Chi; Cai, You-Zhi; Lin, Xiang-Jin
2016-05-01
A literature review of the first-, second- and third-generation autologous chondrocyte implantation (ACI) technique for the treatment of large-sized (>4 cm(2)) and full-thickness knee cartilage defects in young adults was conducted, examining the current literature on features, clinical scores, complications, magnetic resonance image (MRI) and histological outcomes, rehabilitation and cost-effectiveness. A literature review was carried out in the main medical databases to evaluate the several studies concerning ACI treatment of large-sized and full-thickness knee cartilage defects in young adults. ACI technique has been shown to relieve symptoms and improve functional assessment in large-sized (>4 cm(2)) and full-thickness knee articular cartilage defect of young adults in short- and medium-term follow-up. Besides, low level of evidence demonstrated its efficiency and durability at long-term follow-up after implantation. Furthermore, MRI and histological evaluations provided the evidence that graft can return back to the previous nearly normal cartilage via ACI techniques. Clinical outcomes tend to be similar in different ACI techniques, but with simplified procedure, low complication rate and better graft quality in the third-generation ACI technique. ACI based on the experience of cell-based therapy, with the high potential to regenerate hyaline-like tissue, represents clinical development in treatment of large-sized and full-thickness knee cartilage defects. IV.
Directory of Open Access Journals (Sweden)
Leila Lotfi
2015-06-01
Full Text Available An aqueous solution of Pectinex (containing cellulase, hemicellulase, and pectinase at 1%, 2.5%, 5%, 7%, and 10% concentrations and 40°C was used to extract anthocyanins (Acys of saffron tepals at 20, 40, 60, 120 and 180 min reaction times and compared with ethanol solvent under similar conditions. The Acys of the Pectinex solution reached 6.7 mg/g of tepal powder (∼40% more than the ethanol method when the enzyme concentrations and extraction times were, respectively, 5% and 60 min. The Acys of aqueous enzymes had three times slower degradation rates and 50% more attractive chroma color than the ones recovered by ethanol solution after 3 h of extraction time. Additionally, the Acys of the ethanol solution lost its content sharply (>45% and its chroma changed quickly (due to the browning and polymerization. High performance liquid chromatography (HPLC analysis showed that Acys extracted with mixed enzymes had about 80% more cyanidin 3-glucosides and 20% less pelargonidin 3,5-glucosides than with the ethanol method. Most probably, the high content of cyanidin 3-glycosides in enzyme-extracted Acys of saffron tepals was the key factor for its high stability.
Eyewitness lineups: is the appearance-change instruction a good idea?
Charman, Steve D; Wells, Gary L
2007-02-01
The Department of Justice's Guide for lineups recommends warning eyewitnesses that the culprit's appearance might have changed since the time of the crime. This appearance-change instruction (ACI) has never been empirically tested. A video crime with four culprits was viewed by 289 participants who then attempted to identify the culprits from four 6-person arrays that either included or did not include the culprit. Participants either received the ACI or not and all were warned that the culprit might or might not be in the arrays. The culprits varied in how much their appearance changed from the video to their lineup arrays, but the ACI did not improve identification decisions for any of the lineups. Collapsed over the four culprits, the ACI increased false alarms and filler identifications but did not increase culprit identifications. The ACI reduced confidence and increased response latency. Two processes that could account for these results are discussed, namely a decision criterion shift and a general increase in ecphoric similarity.
Acidosis and Correction of Acidosis Does Not Affect rFVIIa Function in Swine
2012-12-15
acidosis ) with a decrease in respiration ( respiratory aci- dosis) successfully lowered arterial pH to 7.1 (Table 2). Bicarbonate infusion with...in normal, aci- dosis and acidosis -corrected swine for both HCl- and hemorrhage/ respiratory -induced aci- dosis (Figure 2). Infusions of rFVIIa led to...2). Infusion of FVIIa caused no change in aPTT in the Hemorrhage/ Respiratory Model, but deceased ACT in the control, acidosis and acidosis
Nottingham, Sara; Henning, Jolene
2014-01-01
Context: Approved Clinical Instructors (ACIs; now known as preceptors) are expected to provide feedback to athletic training students (ATSs) during clinical education experiences. Researchers in other fields have found that clinical instructors and students often have different perceptions of actual and ideal feedback and that several factors may influence the feedback exchanges between instructors and students. However, understanding of these issues in athletic training education is minimal. Objective: To investigate the current characteristics and perceptions of and the influences on feedback exchanges between ATSs and ACIs. Design: Qualitative study. Setting: One entry-level master's degree program accredited by the Commission on Accreditation of Athletic Training Education. Patients or Other Participants: Four ACIs and 4 second-year ATSs. Data Collection and Analysis: Individual, semistructured interviews were conducted with participants and integrated with field notes and observations for analysis. We used the constant comparative approach to inductively analyze data and develop codes and categories. Member checking, triangulation, and peer debriefing were used to promote trustworthiness of the study. Results: Participants described that feedback plays an important role in clinical education and has several purposes related to improving performance. The ACIs and ATSs also discussed several preferred characteristics of feedback. Participants identified 4 main influences on their feedback exchanges, including the ACI, the ATS, personalities, and the learning environment. Conclusions: The ACIs and ATSs had similar perceptions of ideal feedback in addition to the actual feedback that was provided during their clinical education experiences. Most of the preferences for feedback were aligned with recommendations in the literature, suggesting that existing research findings are applicable to athletic training clinical education. Several factors influenced the
Preliminary follow-up study of military pilots with asymptomatic cerebral infarction
Directory of Open Access Journals (Sweden)
Xiao-min ZHANG
2016-10-01
Full Text Available Objective To observe pilots with asymptomatic cerebral infarction (ACI for their short-term prognosis. Methods Twenty-two pilots who were diagnosed having ACI by magnetic resonance imaging were enrolled in this study. When they returned to the hospital for regular reexamination, the number of ACI foci , the incidents of acute cerebrovascular disease and grounding of aircraft for any reasons were recorded. According to whether the ACI lesions increased, the patients were divided into two groups. The risk factors for cerebral vascular disease were compared between the two groups. Results All the patients were followed for 6-42 months (mean 14.18±8.55 months, and 6(18.18% patients were found to have increase of lesions. No neurological deficit was seen in the two groups, although 3 flight crews were grounded for non-ACI reason. Age and flight time showed statistically significant differences between the lesions increased group and no lesion increased group. Conclusions The number of ACI foci of some pilots may increase, which is affected by age and flight time. Further investigations on the long-term prognosis and the impacts on flight are needed. DOI: 10.11855/j.issn.0577-7402.2016.09.16
Jones, Andrew P; Hoffmann, Jeffrey W; Smith, Dennis N; Feeley, Thomas J; Murphy, James T
2007-02-15
Based on results of field testing conducted by the U.S. Department of Energy's National Energy Technology Laboratory (DOE/NETL), this article provides preliminary costs for mercury control via conventional activated carbon injection (ACI), brominated ACI, and conventional ACI coupled with the application of a sorbent enhancement additive (SEA) to coal prior to combustion. The economic analyses are reported on a plant-specific basis in terms of the cost required to achieve low (50%), mid (70%), and high (90%) levels of mercury removal "above and beyond" the baseline mercury removal achieved by existing emission control equipment. In other words, the levels of mercury control are directly attributable to ACI. Mercury control costs via ACI have been amortized on a current dollar basis. Using a 20-year book life, levelized costs for the incremental increase in cost of electricity (COE), expressed in mills per kilowatt-hour (mills/kWh), and the incremental cost of mercury control, expressed in dollars per pound of mercury removed ($/lb Hg removed), have been calculated for each level of ACI mercury control. For this analysis, the increase in COE varied from 0.14 mills/kWh to 3.92 mills/kWh. Meanwhile, the incremental cost of mercury control ranged from $3810/lb Hg removed to $166000/lb Hg removed.
Isomerizations of the Nitromethane Radical Cation in the Gas Phase
DEFF Research Database (Denmark)
Egsgaard, Helge; Carlsen, Lars; Elbel, Susanne
1986-01-01
The concurrent isomerizations of the nitromethane radical cation to its aci-nitromethane and methylnitrite isomers, respectively, has been established based on metastable ion studies and collision activation mass spectrometry. The energy diagram for the ionized nitromethane/aci-nitromethane tauto......The concurrent isomerizations of the nitromethane radical cation to its aci-nitromethane and methylnitrite isomers, respectively, has been established based on metastable ion studies and collision activation mass spectrometry. The energy diagram for the ionized nitromethane...
Demange, Marco Kawamura; Minas, Tom; von Keudell, Arvind; Sodha, Sonal; Bryant, Tim; Gomoll, Andreas H
2017-04-01
Objective Bone marrow stimulation surgeries are frequent in the treatment of cartilage lesions. Autologous chondrocyte implantation (ACI) may be performed after failed microfracture surgery. Alterations to subchondral bone as intralesional osteophytes are commonly seen after previous microfracture and removed during ACI. There have been no reports on potential recurrence. Our purpose was to evaluate the incidence of intralesional osteophyte development in 2 cohorts: existing intralesional osteophytes and without intralesional osteophytes at the time of ACI. Study Design We identified 87 patients (157 lesions) with intralesional osteophytes among a cohort of 497 ACI patients. Osteophyte regrowth was analyzed on magnetic resonance imaging and categorized as small or large (less or more than 50% of the cartilage thickness). Twenty patients (24 defects) without intralesional osteophytes at the time of ACI acted as control. Results Osteophyte regrowth was observed in 39.5% of lesions (34.4% of small osteophytes and 5.1% of large osteophytes). In subgroup analyses, regrowth was observed in 45.8% of periosteal-covered defects and in 18.9% of collagen membrane-covered defects. Large osteophyte regrowth occurred in less than 5% in either group. Periosteal defects showed a significantly higher incidence for regrowth of small osteophytes. In the control group, intralesional osteophytes developed in 16.7% of the lesions. Conclusions Even though intralesional osteophytes may regrow after removal during ACI, most of them are small. Small osteophyte regrowth occurs almost twice in periosteum-covered ACI. Large osteophytes occur only in 5% of patients. Intralesional osteophyte formation is not significantly different in preexisting intralesional osteophytes and control groups.
Nottingham, Sara; Henning, Jolene
2014-01-01
Context Providing students with feedback is an important component of athletic training clinical education; however, little information is known about the feedback that Approved Clinical Instructors (ACIs; now known as preceptors) currently provide to athletic training students (ATSs). Objective To characterize the feedback provided by ACIs to ATSs during clinical education experiences. Design Qualitative study. Setting One National Collegiate Athletic Association Division I athletic training facility and 1 outpatient rehabilitation clinic that were clinical sites for 1 entry-level master's degree program accredited by the Commission on Accreditation of Athletic Training Education. Patients or Other Participants A total of 4 ACIs with various experience levels and 4 second-year ATSs. Data Collection and Analysis Extensive field observations were audio recorded, transcribed, and integrated with field notes for analysis. The constant comparative approach of open, axial, and selective coding was used to inductively analyze data and develop codes and categories. Member checking, triangulation, and peer debriefing were used to promote trustworthiness of the study. Results The ACIs gave 88 feedback statements in 45 hours and 10 minutes of observation. Characteristics of feedback categories included purpose, timing, specificity, content, form, and privacy. Conclusions Feedback that ACIs provided included several components that made each feedback exchange unique. The ACIs in our study provided feedback that is supported by the literature, suggesting that ACIs are using current recommendations for providing feedback. Feedback needs to be investigated across multiple athletic training education programs to gain more understanding of certain areas of feedback, including frequency, privacy, and form. PMID:24143902
Roidoung, Sunisa; Dolan, Kirk D; Siddiq, Muhammad
2016-11-01
The objective of this study was to evaluate different antioxidants for anthocyanin (ACY) retention in vitamin C fortified cranberry juice and assess its quality. Cranberry juice was fortified with 40-80mg/100mL vitamin C and added hesperidin, catechin, and gallic acid at different concentrations. Juice was pasteurized at 85°C for 1min and stored at 23°C for 16days. ACYs, vitamin C, color intensity, and browning index (BI) were evaluated at 2-day intervals. Gallic acid was found to be the most effective antioxidant against ACYs degradation and significantly (p<0.05) increased red color intensity by 37% and ACY concentration by 41%, compared to the control. After 16-day storage, the BI of gallic acid-added juice was significantly lower (0.80 vs 1.00) than the control juice. The outcome of this research provided a potential solution of using gallic acid to preserve a health-beneficial component (ACYs), and endogenous red color in cranberry juice. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Wang Junfeng; Fabbiano, Giuseppina; Risaliti, Guido; Elvis, Martin; Karovska, Margarita; Zezas, Andreas; Mundell, Carole G.; Dumas, Gaelle; Schinnerer, Eva
2011-01-01
We report on the imaging analysis of ∼200 ks sub-arcsecond resolution Chandra Advanced CCD Imaging Spectrometer (ACIS-S) observations of the nearby Seyfert 1 galaxy NGC 4151. Bright, structured soft X-ray emission is observed to extend from 30 pc to 1.3 kpc in the southwest from the nucleus, much farther than seen in earlier X-ray studies. The terminus of the northeastern X-ray emission is spatially coincident with a CO gas lane, where the outflow likely encounters dense gas in the host galactic disk. X-ray emission is also detected outside the boundaries of the ionization cone, which indicates that the gas there is not completely shielded from the nuclear continuum, as would be the case for a molecular torus collimating the bicone. In the central r 2 emission and dusty spirals we find in an Hubble Space Telescope V - H color image. The agreement between the observed H 2 line flux and the value predicted from X-ray-irradiated molecular cloud models supports photo-excitation by X-rays from the active nucleus as the origin of the H 2 line, although contribution from UV fluorescence or collisional excitation cannot be ruled out with current data. The discrepancy between the mass of cold molecular gas inferred from recent CO and near-infrared H 2 observations may be explained by the anomalous CO abundance in this X-ray-dominated region. The total H 2 mass derived from the X-ray observation agrees with the recent measurement by Storchi-Bergmann et al.
Santos, Sara; Brugal, M Teresa; Barrio, Gregorio; Castellano, Yolanda; Domingo-Salvany, Antonia; Espelt, Albert; Bravo, M Jose; de la Fuente, Luis
2012-06-01
Although, in the laboratory, most acute adverse effects of cocaine are dose-dependent and alcohol potentiates some of these effects, there are few observational studies, and scarce awareness that the risk of acute cocaine intoxication (ACI) can increase as the amounts of cocaine and alcohol consumed increase. Our objectives were to assess if the risk of ACI increases with the level cocaine use, both in chronic and binge use; and also to determine whether it increases when a cocaine binge is combined with binge drinking or with regular excessive drinking. Hypotheses were evaluated using logistic regression and case-crossover analyses in a sample of 720 young regular cocaine users who did not regularly use heroin, recruited at drug scenes in 2004-2006. All data on ACI, predictor and confounding variables were obtained through a computer-assisted personal interview. The annual prevalence of ACI was 21%. In the last year 10.3% of the participants reported cocaine binges (≥ 0.5 g in 4 h). ACI risk increased considerably in the 4 h following a cocaine binge (odds ratio = 34.6; 95% confidence interval 11.5-170.8). Also, it increased with increases in the average level of cocaine used over a long period and when users regularly drank excessively. Finally, the results suggest that the high risk of ACI associated with cocaine binge may increase even more when combined with binge drinking. Awareness of the dose-dependent effect of cocaine on ACI risk, as well as the possible synergistic effect of alcohol, ought to be incorporated into preventive and care strategies. © 2012 Australasian Professional Society on Alcohol and other Drugs.
Modeling Contamination Migration on the Chandra X-ray Observatory II
O'Dell, Steve; Swartz, Doug; Tice, Neil; Plucinsky, Paul; Grant, Catherine; Marshall, Herman; Vikhlinin, Alexey
2013-01-01
During its first 14 years of operation, the cold (about -60degC) optical blocking filter of the Advanced CCD Imaging Spectrometer (ACIS), aboard the Chandra X-ray Observatory, has accumulated a growing layer of molecular contamination that attenuates low-energy x rays. Over the past few years, the accumulation rate, spatial distribution, and composition may have changed, perhaps partially related to changes in the operating temperature of the ACIS housing. This evolution of the accumulation of the molecular contamination has motivated further analysis of contamination migration on the Chandra X-ray Observatory, particularly within and near the ACIS cavity. To this end, the current study employs a higher-fidelity geometric model of the ACIS cavity, detailed thermal modeling based upon monitored temperature data, and an accordingly refined model of the molecular transport.
Ethical, political, and social aspects of high-technology medicine: Eos and care.
Zamperetti, Nereo; Bellomo, Rinaldo; Dan, Maurizio; Ronco, Claudio
2006-06-01
We discuss biosocial aspects of high-technology medicine (HTM) to provide a global view of the current model of medicine in the developed world and its consequences. We analyze changes in the concept of death and in the use and cost of HTM. The consequences of HTM on the delivery of basic medical care within and among countries are discussed. Concepts derived from Greek mythology are used to illustrate the problems associated with HTM. HTM can be extremely effective in individual cases, but it poses important bioethical and biosocial problems. A major problem is related to the possibility of manipulating the process of dying and the consequent alteration in the social concept of death, which, if not carefully regulated, risks transforming medicine into an expensive way of pursuing pointless dreams of immortality (myth of Eos). Another problem is related to the extraordinary amount of resources necessary for HTM. This model of medicine (which is practiced daily) has limited sustainability, can work only in highly developed countries, may contribute to unequal access to health care, and has negligible positive impact on global health and survival. HTM poses very important biosocial questions that need to be addressed in a wider and transparent debate, in the best interest of society and HTM as well.
NCBI nr-aa BLAST: CBRC-GGOR-01-1354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1354 ref|YP_003328481.1| hypothetical protein ACIS_00561 [Anaplasma centrale str. Israel...] gb|ACZ49167.1| hypothetical protein ACIS_00561 [Anaplasma centrale str. Israel] YP_003328481.1 0.002 28% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1354 ref|YP_003328565.1| hypothetical protein ACIS_00677 [Anaplasma centrale str. Israel...] gb|ACZ49251.1| hypothetical protein ACIS_00677 [Anaplasma centrale str. Israel] YP_003328565.1 0.002 28% ...
absfeb2015.htm | jess | Indian Academy of Sciences
Indian Academy of Sciences (India)
Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.
sld007.htm | epub DCs | presentations | epubworkshop | Indian ...
Indian Academy of Sciences (India)
Toggle navigation. Logo of the Indian Academy of Sciences. Indian Academy of Sciences. Home · About IASc · History · Memorandum of Association · Role of the Academy · Statutes · Council · Raman Chair · Jubilee Chair · Academy – Springer Nature chair · Academy Trust · Contact details · Office Staff · Office complaint ...
Directory of Open Access Journals (Sweden)
Ilyena Hirskyj-Douglas
2018-06-01
Full Text Available As technologies diversify and become embedded in everyday lives, the technologies we expose to animals, and the new technologies being developed for animals within the field of Animal Computer Interaction (ACI are increasing. As we approach seven years since the ACI manifesto, which grounded the field within Human Computer Interaction and Computer Science, this thematic literature review looks at the technologies developed for (non-human animals. Technologies that are analysed include tangible and physical, haptic and wearable, olfactory, screen technology and tracking systems. The conversation explores what exactly ACI is whilst questioning what it means to be animal by considering the impact and loop between machine and animal interactivity. The findings of this review are expected to form the first grounding foundation of ACI technologies informing future research in animal computing as well as suggesting future areas for exploration.
DEFF Research Database (Denmark)
Niemeyer, Philipp; Salzmann, Gian; Steinwachs, Matthias
2010-01-01
INTRODUCTION: Since introduction of autologous chondrocyte implantation (ACI), various factors have been described that influence the clinical outcome. The present paper investigates the influence of bone marrow edema at time of treatment on clinical function before and in the early clinical course...... after ACI. METHODS: 67 patients treated with ACI for cartilage defects of the knee joint were included. Presence of subchondral bone marrow edema was graded as absent (1), mild (2), moderate (3) or severe (4) using magnetic resonance (MR) imaging before surgery. All patients were assessed in terms...... of clinical function before surgery and 6 as well as 12 months after ACI using IKDC and Lysholm scores. Presence of subchondral edema was correlated with functional outcome. RESULTS: In 18 patients edema on initial MRI was graded as "absent", while 17 patients had grade 2 edema, 19 patients had grade 3 edema...
MODELOS REALISTAS EN LA VERIFICACIÓN DEL ESFUERZO CORTANTE EN ELEMENTOS DE HORMIGÓN ARMADO
Directory of Open Access Journals (Sweden)
Francisco Aguirre
2015-07-01
En este artículo se proponen modelos basados en la TCCM y TCCMS y se muestra resultados de ejemplos aplicando estos modelos comparándolos con las normas ACI 318-11 y CAN23.3-04. En el cálculo de la armadura transversal, la variación entre la TCCM y las normas ACI 318-11 y CAN23.3-04 fue de 33% y 64% respectivamente y la variación entre la TCCMS y las normas ACI 318-11 y CAN23.3-04 fue de 2% y 25% respectivamente.
Pestka, Jan M; Bode, Gerrit; Salzmann, Gian; Steinwachs, Mathias; Schmal, Hagen; Südkamp, Norbert P; Niemeyer, Philipp
2014-01-01
Autologous chondrocyte implantation (ACI) has been associated with satisfying results. Still, it remains unclear when success or failure after ACI can be estimated. To evaluate the clinical outcomes of cell-seeded collagen matrix-supported ACI (ACI-Cs) for the treatment of cartilage defects of the knee at 36 months and to determine a time point after ACI-Cs at which success or failure can be estimated. Cohort study; Level of evidence, 3. A total of 80 patients with isolated full-thickness cartilage defects of the knee joint treated with ACI-Cs were prospectively assessed before surgery as well as postoperatively by use of the International Knee Documentation Committee (IKDC) score and Lysholm knee score. Preoperative IKDC and Lysholm scores increased from 49.6 and 59.5, respectively, to 79.1 and 83.5, respectively, at 36 months. Only half the patients (46.6%) with poor IKDC scores (ie, <70) at 6 months postoperatively showed continued poor or fair scores at 36 months' follow-up. The probability of poor scores at 36 months after surgery further increased to 0.61 and 0.81, respectively, when scores were persistent at 12 and 24 months. All 3 patients (100%) with good IKDC scores (ie, 81-90) at 6 months after surgery showed constant or even improved scores at 36 months' follow-up. Ninety-one percent of patients with good and excellent scores at 12 months and 83% of patients with good and excellent scores at 24 months (a total of 23 and 37 patients, respectively) were able to maintain these scores at 36 months' follow-up. Similar results were obtained for the Lysholm score. With regard to the improvements in functional outcomes after ACI-Cs at 36 months after surgery, the technique described here appears to lead to satisfying and stable clinical results. This study helps the treating physician to predict the likeliness of further clinical improvements or constant unsatisfactory results after ACI. In patients with good/excellent scores shortly after surgery
Safety Commission
2008-01-01
The revision of CERN Safety rules is in progress and the following new Safety rules have been issued on 15-04-2008: Safety Procedure SP-R1 Establishing, Updating and Publishing CERN Safety rules: http://cern.ch/safety-rules/SP-R1.htm; Safety Regulation SR-S Smoking at CERN: http://cern.ch/safety-rules/SR-S.htm; Safety Regulation SR-M Mechanical Equipment: http://cern.ch/safety-rules/SR-M.htm; General Safety Instruction GSI-M1 Standard Lifting Equipment: http://cern.ch/safety-rules/GSI-M1.htm; General Safety Instruction GSI-M2 Standard Pressure Equipment: http://cern.ch/safety-rules/GSI-M2.htm; General Safety Instruction GSI-M3 Special Mechanical Equipment: http://cern.ch/safety-rules/GSI-M3.htm. These documents apply to all persons under the Director General’s authority. All Safety rules are available at the web page: http://www.cern.ch/safety-rules The Safety Commission
Omichi, Masaaki; Matsusaki, Michiya; Kato, Shinya; Maruyama, Ikuro; Akashi, Mitsuru
2010-11-01
ART-123 is a recombinant soluble human thrombomodulin (hTM) with excellent anticoagulant activity. We focused on improving the blood compatibility of the polysulfone-polyvinylpyrrolidone dialyzer surface by the physical adsorption of ART-123 onto the surface. The blood compatibility of the dialyzer with the hTM adsorbed membrane was evaluated by measuring the differential pressure between the arterial and the venous pressures and by blood parameters during blood circulation. The hTM adsorbed dialyzer membrane inhibited blood clot formation without heparin administration due to the anticoagulant activity of hTM for over 4 h. The physically adsorbed hTM was stable during blood circulation, and it did not affect activated clotting time, which is significant drawback of heparin administration, and blood cell counts of RBC, WBC, or platelets. The physical adsorption of hTM onto the dialyzer membrane will be a simple and safe method to prevent blood coagulation during dialysis instead of heparin administration. © 2010 Wiley Periodicals, Inc.
Bekkers, J.E.J.; Tsuchida, A.I.; van Rijen, M.H.P.; Vonk, L.A.; Dhert, W.J.A.; Saris, Daniël B.F.
2013-01-01
Background: Autologous chondrocyte implantation (ACI) is traditionally a 2-step procedure used to repair focal articular cartilage lesions. With use of a combination of chondrons (chondrocytes in their own territorial matrix) and mesenchymal stromal cells (MSCs), ACI could be innovated and performed
Is gender influencing the biomechanical results after autologous chondrocyte implantation?
Kreuz, Peter C; Müller, Sebastian; Erggelet, Christoph; von Keudell, Arvind; Tischer, Thomas; Kaps, Christian; Niemeyer, Philipp; Hirschmüller, Anja
2014-01-01
The influence of gender on the biomechanical outcome after autologous chondrocyte implantation (ACI) including isokinetic muscle strength measurements has not been investigated. The present prospective study was performed to evaluate gender-specific differences in the biomechanical function 48 months after ACI. Fifty-two patients (mean age 35.6 ± 8.5 years) that met our inclusion criteria, underwent ACI with Bioseed C(®) and were evaluated with the KOOS score preoperatively, 6, 12 and 48 months after surgery. At final follow-up, 44 out of the 52 patients underwent biomechanical evaluation with isokinetic strength measurements of both knees. All data were evaluated separately for men and women and compared for each time interval using the Mann-Whitney U test. Clinical scores improved significantly over the whole study period (p genders. Isokinetic muscle strength measures are significantly worse in women (p role for the explanation of gender-specific results after ACI.
Energy Technology Data Exchange (ETDEWEB)
Krishnakumar, Balaji; Naik, Chitralkumar V.; Niksa, Stephen [Niksa Energy Associates LLC, Belmont, CA (United States); Fujiwara, Naoki [Idemitsu Kosan Co., Ltd, Chiba (Japan). Coal and Environment Research Lab.
2013-07-01
This paper presents validations of the Hg speciation predicted by NEA's MercuRator trademark package with an American field test database for 28 full-scale utility gas cleaning systems. It emphasizes SCR/ESP/FGD combinations and activated carbon injection because these two applications present the best long- term prospects for Hg control by coal-burning utilities. Validations of the extents of Hg{sup 0} oxidation across SCRs and of Hg retention in wet FGDs gave correlation coefficients greater than 0.9 for both units. A transport-based FGD analysis correctly assessed the potential for Hg{sup 0} re-emission in one limestone wet FGD. Among the ten stations in the SCR/ESP/FGD validations, the simulations correctly identified 3 of 4 of the relatively high Hg emissions rates; all four of the sites with moderate emissions rates; and both sites with the lowest emission rates. The validations for ACI applications demonstrated that Hg removals can be accurately estimated for the full domain of coal quality, LOI, and ACI rates for both untreated and brominated carbon sorbents. The predictions for ACI depict the test-to-test variations in most cases, and accurately describe the impact of ACI configuration and sorbent type. ACI into FFs is the most effective configuration, although ACI into ESPs often removes 90% or more Hg, provided that there is sufficient residence time and Cl in the flue gas. Brominated sorbents perform better than untreated carbons, unless SO{sub 3} condensation inhibits Hg adsorption.
Novel dense membrane for hydrogen separation for energy applications
Energy Technology Data Exchange (ETDEWEB)
Bandopadhyay, Sukumar [Univ. of Alaska, Fairbanks, AL (United States); Balachandran, Uthamalingam [Argonne National Lab. (ANL), Argonne, IL (United States); Nag, Nagendra [Surmet Corp., Burlington, MA (United States)
2013-10-24
The main objectives of this project are: (1) Characterization of the thermo mechanical properties of the novel dense HTM bulk sample; (2) Development of a correlation among the intrinsic factors (such as grain size and phase distribution), and the extrinsic factors (such as temperature and atmosphere) and the thermo-mechanical properties (such as strengths and stress) to predict the performance of a HTM system (HTM membrane and porous substrate) ; and (3) Evaluation of the stability of the novel HTM membrane and its property correlations after thermal cycling. Based on all results and analysis of the thermo mechanical properties for the HTM cermet bulk samples, several important conclusions were made. The mean σfs at room temperature is approximately 356 MPa for the HTM cermet. The mean σfs value decreases to 284 MPa as the temperature increases to 850?C. The Difference difference in atmosphere, such as air or N2, had an insignificant effect on the flexural strength values at 850?C for the HTM cermet. The HTM cermet samples at room temperature and at 500?C fractured without any significant plastic deformation. Whereas, at 850?C, the HTM cermet samples fractured, preceded by an extensive plastic deformation. It seems that the HTM cermet behaves more like an elastic material such as a nonmetal ceramic at the room temperature, and more like a ductile material at increased temperature (850?C). The exothermic peak during the TG/DTA tests centered at 600?C is most likely associated with both the enthalpy change of transformation from the amorphous phase into crystalline zirconia and the oxidation of Pd phase in HTM cermet in air. The endothermic peak centered at 800?C is associated with the dissociation of PdO to Pd for the HTM cermet sample in both inert N2 environment and air. There is a corresponding weight gain as oxidation occurs for palladium (Pd) phase to form palladium oxide (PdO) and there is a weight loss as the unstable PdO is dissociated back to Pd and
Modeling Contamination Migration on the Chandra X-ray Observatory - II
O'Dell, Stephen L.; Swartz, Douglas A.; Tice, Neil W.; Plucinsky, Paul P.; Grant, Catherine E.; Marshall, Herman L.; Vikhlinin, Alexey A.; Tennant, Allyn F.
2013-01-01
During its first 14 years of operation, the cold (about -60C) optical blocking filter of the Advanced CCD Imaging Spectrometer (ACIS), aboard the Chandra X-ray Observatory, has accumulated a growing layer of molecular contamination that attenuates low-energy x rays. Over the past few years, the accumulation rate, spatial distribution, and composition have changed. This evolution has motivated further analysis of contamination migration within and near the ACIS cavity. To this end, the current study employs a higher-fidelity geometric model of the ACIS cavity, detailed thermal modeling based upon temperature data, and a refined model of the molecular transport.
Energy Technology Data Exchange (ETDEWEB)
Schriber, Jeffrey B.; Evangelista, Francesco A. [Department of Chemistry and Cherry L. Emerson Center for Scientific Computation, Emory University, Atlanta, Georgia 30322 (United States)
2016-04-28
We introduce a new procedure for iterative selection of determinant spaces capable of describing highly correlated systems. This adaptive configuration interaction (ACI) determines an optimal basis by an iterative procedure in which the determinant space is expanded and coarse grained until self-consistency. Two importance criteria control the selection process and tune the ACI to a user-defined level of accuracy. The ACI is shown to yield potential energy curves of N{sub 2} with nearly constant errors, and it predicts singlet-triplet splittings of acenes up to decacene that are in good agreement with the density matrix renormalization group.
The severity of retinal degeneration in Rp1h gene-targeted mice is dependent on genetic background.
Liu, Qin; Saveliev, Alexei; Pierce, Eric A
2009-04-01
The severity of disease in patients with retinitis pigmentosa (RP) can vary significantly, even among patients with the same primary mutations. It is hypothesized that modifier genes play important roles in determining the severity of RP, including the retinitis pigmentosa 1 (RP1) form of disease. To investigate the basis of variation in disease expression for RP1 disease, the authors generated congenic mice with a gene-targeted retinitis pigmentosa 1 homolog (Rp1h) allele (Rp1h(tm1Eap)) on several different genetic backgrounds and analyzed their retinal phenotypes. The Rp1h(tm1Eap) allele was placed onto the C57BL/6J, DBA1/J, and A/J backgrounds. Retinal function of the resultant congenic mice was evaluated using electroretinographic analyses. Retinal structure and ultrastructure were evaluated using light and electron microscopy. Rp1h protein location was determined with immunofluorescence microscopy. Analysis of the retinal phenotype of incipient congenic (N6) B6.129S-Rp1h(+/tm1Eap), DBA.129S(B6)-Rp1h(+/tm1Eap), and A.129S(B6)-Rp1h(+/tm1Eap) mice at 1 year of age showed retinal degeneration only in the A.129S(B6)-Rp1h(+/tm1Eap) mice. Further analyses revealed that the photoreceptors of the fully congenic A.129S(B6)-Rp1h(+/tm1Eap) mice show evidence of degeneration at 6 months of age and are almost completely lost by 18 months of age. In contrast, the photoreceptor cells in the fully congenic B6.129S-Rp1h(+/tm1Eap) mice remain healthy up to 18 months. The severity of the retinal degeneration caused by the Rp1h(tm1Eap) allele is notably dependent on genetic background. The development and characterization of the B6.129S-Rp1h(+/tm1Eap) and A.129S(B6)-Rp1h(+/tm1Eap) congenic mouse lines will facilitate identification of sequence alterations in genes that modify the severity of RP1 disease.
Structural and spectroscopic features of lutein/butanoyl-β-cyclodextrin nanoassemblies
DEFF Research Database (Denmark)
Stancanelli, R.; Løjkner, L.D.; Larsen, Kim Lambertsen
2012-01-01
Lutein, the primary carotenoid present in the central area of the retina of eye appears to be associated with the protection against age-related macular degeneration (the leading cause of blindness in older adults). Its lipophilicity and consequently its scarce water solubility (1.3 × 10−9 M......-cyclodextrins (C4:7) form in water nanoaggregates with a average size of 250 nm and a ζ-potential of about −6 mV. They are able to entrap lutein at 1:6 Lut/ACyD molar ratio by yielding nanoassemblies of vesicular aspect (320 nm and −8 mV) such as observed by static, dynamic and electrophoretic light-scattering. UV......–vis measurements revealed that electronic properties of lutein were maintained when interact with ACyD nanoaggregates. The monitoring of the entapped carotenoid leaking from ACyD nanostructures was investigated suggesting the potential of Lut/ACyD nanoassemblies in drug delivery....
Material Exchange Property of Organo Lead Halide Perovskite with Hole-Transporting Materials
Directory of Open Access Journals (Sweden)
Seigo Ito
2015-10-01
Full Text Available Using X-ray diffraction (XRD, it was confirmed that the deposition of hole-transporting materials (HTM on a CH3NH3PbI3 perovskite layer changed the CH3NH3PbI3 perovskite crystal, which was due to the material exchanging phenomena between the CH3NH3PbI3 perovskite and HTM layers. The solvent for HTM also changed the perovskite crystal. In order to suppress the crystal change, doping by chloride ion, bromide ion and 5-aminovaleric acid was attempted. However, the doping was unable to stabilize the perovskite crystal against HTM deposition. It can be concluded that the CH3NH3PbI3 perovskite crystal is too soft and flexible to stabilize against HTM deposition.
From bench to bed: bridging from informatics theory to practice. An exploratory analysis.
Lehmann, C U; Haux, R
2014-01-01
In 2009, the journal Applied Clinical Informatics (ACI) commenced publication. Focused on applications in clinical informatics, ACI was intended to be a companion journal to METHODS of Information in Medicine (MIM). Both journals are official journals of IMIA, the International Medical Informatics Association. To explore, after five years, which congruencies and interdependencies exist in publications of these journals and to determine if gaps exist. To achieve this goal, major topics discussed in ACI and in MIM had to be analysed. Finally, we wanted to explore, whether the intention of publishing these companion journals to provide an information bridge from informatics theory to informatics practice and from practice to theory could be supported by this model. In this manuscript we will report on congruencies and interdependencies from practise to theory and on major topis in ACI. Further results will be reported in a second paper. Retrospective, prolective observational study on recent publications of ACI and MIM. All publications of the years 2012 and 2013 from these journals were indexed and analysed. Hundred and ninety-six publications have been analysed (87 ACI, 109 MIM). In ACI publications addressed care coordination, shared decision support, and provider communication in its importance for complex patient care and safety and quality. Other major themes included improving clinical documentation quality and efficiency, effectiveness of clinical decision support and alerts, implementation of health information technology systems including discussion of failures and succeses. An emerging topic in the years analyzed was a focus on health information technology to predict and prevent hospital admissions and managing population health including the application of mobile health technology. Congruencies between journals could be found in themes, but with different focus in its contents. Interdependencies from practise to theory found in these publications, were
[Evidence-based therapy for cartilage lesions in the knee - regenerative treatment options].
Proffen, B; von Keudell, A; Vavken, P
2012-06-01
The treatment of cartilage defects has seen a shift from replacement to regeneration in the last few years. The rationale behind this development is the improvement in the quality-of-care for the growing segment of young patients who are prone to arthroplasty complications because of their specific characteristics - young age, high level of activity, high demand for functionality. These days, two of the most popular regenerative treatments are microfracture and autologous chondrocyte implantation (ACI). Although these new options show promising results, no final algorithm for the treatment of cartilage lesions has been established as yet. The objective of this review is to describe and compare these two treatment options and to present an evidence-based treatment algorithm for focal cartilage defects. Microfracture is a cost-effective, arthroscopic one-stage procedure, in which by drilling of the subchondral plate, mesenchymal stem cells from the bone marrow migrate into the defect and rebuild the cartilage. ACI is a two-stage procedure in which first chondrocytes are harvested, expanded in cell culture and in a second open procedure reimplanted into the cartilage defect. Microfracture is usually used for focal cartilage defects osteophyte, and for the ACI patient, periosteal hypertrophy and the need for two procedures in ACI. Only a few studies provide detailed and evidence-based information on a comparative assessment. These studies, however, are showing widely similar clinical outcomes but better histological results for ACI, which are likely to translate into better long-term outcomes. Although evidence-based studies comparing microfracture and ACI have not found significant differences in the clinical outcome, the literature does show that choosing the treatment based on the size and characteristics of the osteochondral lesion might be beneficial. The American Association of Orthopedic Surgeons suggest that contained lesions < 4 cm2 should be treated by
Crundall-Goode, Amanda; Goode, Kevin M; Clark, Andrew L
2017-04-01
Home tele-monitoring (HTM) is used to monitor the clinical signs and symptoms of patients with chronic heart failure (CHF) in order to reduce unplanned hospital admissions. However, not all patients who are referred will agree to use HTM, and some patients choose to withdraw early from its use. ADaPT-HF will investigate whether depression, anxiety, low perceived control, reduced technology capability, level of education, age or the severity or complexity of a patient's illness can predict refusal of, or early withdrawal from, HTM in patients with CHF. The study will recruit 288 patients who have been recently admitted to hospital with heart failure who have been referred for HTM. At the time of referral, patients will complete depression (nine-item Patient Health Questionnaire), anxiety (seven-item Generalised Anxiety Disorder questionnaire), perceived control (eight-item revised Controlled Attitudes Scale) and technology capability (ten-item Technology Readiness Index 2.0) screening questionnaires. In addition, data on demographics, diagnosis, clinical examination, socio-economic status, history of comorbidities, medication, biochemistry and haematology will be recorded. The primary outcome will be a composite of refusal of or early withdrawal from HTM. The principle analysis will be made using logistic regression. By establishing which factors influence a patient's decision to refuse or withdraw early from HTM, it may be possible to redesign HTM referral processes. It may be that patients with CHF who also have depression, anxiety, low control and poor technology skills should not be referred until they receive appropriate support or that they should be managed differently when they do receive HTM. The results of ADAPT-HF may provide a way of making more efficient and cost-effective use of HTM services.
Embrittlement and decrease of apparent strength in large-sized ...
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
In fact, the dimensional disparity between tensile stress σ([F][L]. −2) and ..... they work only in a limited range. This is the case of the ...... ACI 1992 American Concrete Institute: Building Code 318R-89 (Detroit: ACI Press). Ba˘zant Z P 1984 Size ...
The Chandra Source Catalog 2.0: Calibrations
Graessle, Dale E.; Evans, Ian N.; Rots, Arnold H.; Allen, Christopher E.; Anderson, Craig S.; Budynkiewicz, Jamie A.; Burke, Douglas; Chen, Judy C.; Civano, Francesca Maria; D'Abrusco, Raffaele; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Gibbs, Danny G., II; Glotfelty, Kenny J.; Grier, John D.; Hain, Roger; Hall, Diane M.; Harbo, Peter N.; Houck, John C.; Lauer, Jennifer L.; Laurino, Omar; Lee, Nicholas P.; Martínez-Galarza, Juan Rafael; McCollough, Michael L.; McDowell, Jonathan C.; Miller, Joseph; McLaughlin, Warren; Morgan, Douglas L.; Mossman, Amy E.; Nguyen, Dan T.; Nichols, Joy S.; Nowak, Michael A.; Paxson, Charles; Plummer, David A.; Primini, Francis Anthony; Siemiginowska, Aneta; Sundheim, Beth A.; Tibbetts, Michael; Van Stone, David W.; Zografou, Panagoula
2018-01-01
Among the many enhancements implemented for the release of Chandra Source Catalog (CSC) 2.0 are improvements in the processing calibration database (CalDB). We have included a thorough overhaul of the CalDB software used in the processing. The software system upgrade, called "CalDB version 4," allows for a more rational and consistent specification of flight configurations and calibration boundary conditions. Numerous improvements in the specific calibrations applied have also been added. Chandra's radiometric and detector response calibrations vary considerably with time, detector operating temperature, and position on the detector. The CalDB has been enhanced to provide the best calibrations possible to each observation over the fifteen-year period included in CSC 2.0. Calibration updates include an improved ACIS contamination model, as well as updated time-varying gain (i.e., photon energy) and quantum efficiency maps for ACIS and HRC-I. Additionally, improved corrections for the ACIS quantum efficiency losses due to CCD charge transfer inefficiency (CTI) have been added for each of the ten ACIS detectors. These CTI corrections are now time and temperature-dependent, allowing ACIS to maintain a 0.3% energy calibration accuracy over the 0.5-7.0 keV range for any ACIS source in the catalog. Radiometric calibration (effective area) accuracy is estimated at ~4% over that range. We include a few examples where improvements in the Chandra CalDB allow for improved data reduction and modeling for the new CSC.This work has been supported by NASA under contract NAS 8-03060 to the Smithsonian Astrophysical Observatory for operation of the Chandra X-ray Center.
Energy Technology Data Exchange (ETDEWEB)
Sinozaki, Hideko [Teikyo Univ., Tokyo (Japan). Faculty of Medicine
2001-03-01
Postural changes in cerebral blood flow in patients with coronary heart disease (CHD) were evaluated with SPECT to detect asymptomaic cerebral ischemia (ACI). {sup 99m}Tc-ECD was used as a tracer. We developed a new analysis system for the processing of multiple images, making it possible to avoid the spatial shift in ROIs in different positions. The severity of ACI was classified into 3 groups based on SPECT findings in the supine position: group 1 without any abnormalities in cerebral perfusion, group 2 with a single perfusion defect, and group 3 with a number of perfusion defects. No cerebral siteobserved in any group showed a significant difference between the supine and upright positions in cerebral perfusion. Each group in each position, however, revealed a consistent perfusion pattern characterized by a significant decrease in perfusion in the occipital, temporal and frontal lobes. Moreover, the decrease in the latter two sites was significantly greater than in the former site. Concerning clinical profiles, hypertension and the thickness of the intima and media complex (TIMC) of the common carotid artery significantly correlated with the severity of ACI. Furthermore, in multiple regression analysis, only TIMC was identified as a significant determinant of ACI. In conclusion, cerebral blood flow determined with {sup 99m}Tc-ECD SPECT could accurately detect ACI in patients with CHD. (author)
PAH emissions from coal combustion and waste incineration.
Hsu, Wei Ting; Liu, Mei Chen; Hung, Pao Chen; Chang, Shu Hao; Chang, Moo Been
2016-11-15
The characteristics of PAHs that are emitted by a municipal waste incinerator (MWI) and coal-fired power plant are examined via intensive sampling. Results of flue gas sampling reveal the potential for PAH formation within the selective catalytic reduction (SCR) system of a coal-fired power plant. In the large-scale MWI, the removal efficiency of PAHs achieved with the pilot-scaled catalytic filter (CF) exceeds that achieved by activated carbon injection with a bag filter (ACI+BF) owing to the effective destruction of gas-phase contaminants by a catalyst. A significantly lower PAH concentration (1640ng/g) was measured in fly ash from a CF module than from an ACI+BF system (5650ng/g). Replacing the ACI+BF system with CF technology would significantly reduce the discharge factor (including emission and fly ash) of PAHs from 251.6 to 77.8mg/ton-waste. The emission factors of PAHs that are obtained using ACI+BF and the CF system in the MWI are 8.05 and 7.13mg/ton, respectively. However, the emission factor of MWI is significantly higher than that of coal-fired power plant (1.56mg/ton). From the perspective of total environmental management to reduce PAH emissions, replacing the original ACI+BF process with a CF system is expected to reduce environmental impact thereof. Copyright © 2016 Elsevier B.V. All rights reserved.
The Role of Healthcare Technology Management in Facilitating Medical Device Cybersecurity.
Busdicker, Mike; Upendra, Priyanka
2017-09-02
This article discusses the role of healthcare technology management (HTM) in medical device cybersecurity and outlines concepts that are applicable to HTM professionals at a healthcare delivery organization or at an integrated delivery network, regardless of size. It provides direction for HTM professionals who are unfamiliar with the security aspects of managing healthcare technologies but are familiar with standards from The Joint Commission (TJC). It provides a useful set of recommendations, including relevant references for incorporating good security practices into HTM practice. Recommendations for policies, procedures, and processes referencing TJC standards are easily applicable to HTM departments with limited resources and to those with no resource concerns. The authors outline processes from their organization as well as best practices learned through information sharing at AAMI, National Health Information Sharing and Analysis Center (NH-ISAC), and Medical Device Innovation, Safety, and Security Consortium (MDISS) conferences and workshops.
Energy Technology Data Exchange (ETDEWEB)
Soe, Chan Myae Myae; Stoumpos, Constantinos C.; Kepenekian, Mikaël; Traoré, Boubacar; Tsai, Hsinhan; Nie, Wanyi; Wang, Binghao; Katan, Claudine; Seshadri, Ram; Mohite, Aditya D.; Even, Jacky; Marks, Tobin J.; Kanatzidis, Mercouri G. (UCSB); (NWU); (LANL); (CNRS-UMR)
2017-11-01
We present the new homologous series (C(NH2)3)(CH3NH3)nPbnI3n+1 (n = 1, 2, 3) of layered 2D perovskites. Structural characterization by single-crystal X-ray diffraction reveals that these compounds adopt an unprecedented structure type, which is stabilized by the alternating ordering of the guanidinium and methylammonium cations in the interlayer space (ACI). Compared to the more common Ruddlesden–Popper (RP) 2D perovskites, the ACI perovskites have a different stacking motif and adopt a higher crystal symmetry. The higher symmetry of the ACI perovskites is expressed in their physical properties, which show a characteristic decrease of the bandgap with respect to their RP perovskite counterparts with the same perovskite layer thickness (n). The compounds show a monotonic decrease in the optical gap as n increases: Eg = 2.27 eV for n = 1 to Eg = 1.99 eV for n = 2 and Eg = 1.73 eV for n = 3, which show slightly narrower gaps compared to the corresponding RP perovskites. First-principles theoretical electronic structure calculations confirm the experimental optical gap trends suggesting that the ACI perovskites are direct bandgap semiconductors with wide valence and conduction bandwidths. To assess the potential of the ACI perovskites toward solar cell applications, we studied the (C(NH2)3)(CH3NH3)3Pb3I10 (n = 3) compound. Compact thin films from the (C(NH2)3)(CH3NH3)3Pb3I10 compound with excellent surface coverage can be obtained from the antisolvent dripping method. Planar photovoltaic devices from optimized ACI perovskite films yield a power-conversion-efficiency of 7.26% with a high open-circuit voltage of ~1 V and a striking fill factor of ~80%.
Amengual, Jennifer E; Prabhu, Sathyen A; Lombardo, Maximilian; Zullo, Kelly; Johannet, Paul M; Gonzalez, Yulissa; Scotto, Luigi; Serrano, Xavier Jirau; Wei, Ying; Duong, Jimmy; Nandakumar, Renu; Cremers, Serge; Verma, Akanksha; Elemento, Olivier; O'Connor, Owen A
2017-06-15
Purpose: Pan-class I/II histone deacetylase (HDAC) inhibitors are effective treatments for select lymphomas. Isoform-selective HDAC inhibitors are emerging as potentially more targeted agents. ACY-1215 (ricolinostat) is a first-in-class selective HDAC6 inhibitor. To better understand the discrete function of HDAC6 and its role in lymphoma, we developed a lymphoma cell line resistant to ACY-1215. Experimental Design: The diffuse large B-cell lymphoma cell line OCI-Ly10 was exposed to increasing concentrations of ACY-1215 over an extended period of time, leading to the development of a resistant cell line. Gene expression profiling (GEP) was performed to investigate differentially expressed genes. Combination studies of ACY-1215 and ibrutinib were performed in cell lines, primary human lymphoma tissue, and a xenograft mouse model. Results: Systematic incremental increases in drug exposure led to the development of distinct resistant cell lines with IC 50 values 10- to 20-fold greater than that for parental lines. GEP revealed upregulation of MAPK10, HELIOS, HDAC9, and FYN, as well as downregulation of SH3BP5 and LCK. Gene-set enrichment analysis (GSEA) revealed modulation of the BTK pathway. Ibrutinib was found to be synergistic with ACY-1215 in cell lines as well as in 3 primary patient samples of lymphoma. In vivo confirmation of antitumor synergy was demonstrated with a xenograft of DLBCL. Conclusions: The development of this ACY-1215-resistant cell line has provided valuable insights into the mechanistic role of HDAC6 in lymphoma and offered a novel method to identify rational synergistic drug combinations. Translation of these findings to the clinic is underway. Clin Cancer Res; 23(12); 3084-96. ©2016 AACR . ©2016 American Association for Cancer Research.
International Nuclear Information System (INIS)
Oluwole, S.F.; Lau, H.T.; Reemtsma, K.; Hardy, M.A.
1988-01-01
We have previously demonstrated that pretreatment of ACI recipients with ultraviolet-irradiated donor-specific blood transfusion (UV-DST) leads to permanent cardiac allograft survival without further host immunosuppression (ACI rats are weak responders to Lewis lymphocytes in mixed-lymphocyte reaction). This study examines the effect of UV-DST and the timing of transfusions on ACI cardiac allograft survival in Lewis recipients with and without the addition of peritransplant cyclosporine (CsA) (20 mg/kg i.m.) given on days 0, +1, and +2 in relation to the time of transplantation. The mean survival time (MST) of ACI cardiac allografts in Lewis recipients was significantly increased to 33.6 +/- 5.7 days (P less than 0.001) by CsA treatment alone as compared to 6.5 +/- 0.5 days survival in control. When DST was given on day -3 combined with CsA, graft survival was increased to 42.0 +/- 9.3 days (P less than 0.01), as compared to 5.8 +/- 1.3 days when DST alone was used. When DST was irradiated with ultraviolet B (UV-DST) and administered on day -3 combined with peritransplant CsA, the MST was increased to 68.83 +/- 16.1 days as compared to an MST of 10.0 +/- 1.0 days in controls treated with UV-DST alone. When UV-DST was given on day -7 and combined with peritransplant CsA immunosuppression, the results were similar. However, when UV-DST was peritransplant CsA course, 4 of 6 recipients maintained their ACI heart allografts indefinitely (greater than 300 days) in contrast to the effect of UV-DST alone (MST of 13.5 days). Third-party (W/F) UV-irradiated blood transfusions were ineffective in prolonging ACI cardiac allografts in Lewis rats, regardless of whether the transfusions were given alone or in combination with peritransplant immunosuppression with CsA
contents.htm | jan102006 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
contents.htm | may102003 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page. New Fellows and Honorary Fellows. Posted on 4 January 2017. List of Fellows and Honorary ...
Review of the Air-Coupled Impact-Echo Method for Non-Destructive Testing
Nowotarski, Piotr; Dubas, Sebastian; Milwicz, Roman
2017-10-01
The article presents the general idea of Air-Coupled Impact-Echo (ACIE) method which is one of the non-destructive testing (NDT) techniques used in the construction industry. One of the main advantages of the general Impact Echo (IE) method is that it is sufficient to access from one side to that of the structure which greatly facilitate research in the road facilities or places which are difficult to access and diagnose. The main purpose of the article is to present state-of-the-art related to ACIE method based on the publications available at Thomson Reuters Web of Science Core Collection database (WOS) with the further analysis of the mentioned methods. Deeper analysis was also performed for the newest publications published within last 3 years related to ACIE for investigation on the subject of main focus of the researchers and scientists to try to define possible regions where additional examination and work is necessary. One of the main conclusions that comes from the performed analysis is that ACIE methods can be widely used for performing NDT of concrete structures and can be performed faster than standard IE method thanks to the Air-coupled sensors. What is more, 92.3% of the analysed recent research described in publications connected with ACIE was performed in laboratories, and only 23.1% in-situ on real structures. This indicates that method requires further research to prepare test stand ready to perform analysis on real objects outside laboratory conditions. Moreover, algorithms that are used for data processing and later presentation in ACIE method are still being developed and there is no universal solution available for all kinds of the existing and possible to find defects, which indicates possible research area for further works. Authors are of the opinion that emerging ACIE method could be good opportunity for ND testing especially for concrete structures. Development and refinement of test stands that will allow to perform in-situ tests could
One-stage vs two-stage cartilage repair: a current review
Directory of Open Access Journals (Sweden)
Daniel Meyerkort
2010-10-01
Full Text Available Daniel Meyerkort, David Wood, Ming-Hao ZhengCenter for Orthopaedic Research, School of Surgery and Pathology, University of Western Australia, Perth, AustraliaIntroduction: Articular cartilage has a poor capacity for regeneration if damaged. Various methods have been used to restore the articular surface, improve pain, function, and slow progression to osteoarthritis.Method: A PubMed review was performed on 18 March, 2010. Search terms included “autologous chondrocyte implantation (ACI” and “microfracture” or “mosaicplasty”. The aim of this review was to determine if 1-stage or 2-stage procedures for cartilage repair produced different functional outcomes.Results: The main procedures currently used are ACI and microfracture. Both first-generation ACI and microfracture result in clinical and functional improvement with no significant differences. A significant increase in functional outcome has been observed in second-generation procedures such as Hyalograft C, matrix-induced ACI, and ChondroCelect compared with microfracture. ACI results in a higher percentage of patients with clinical improvement than mosaicplasty; however, these results may take longer to achieve.Conclusion: Clinical and functional improvements have been demonstrated with ACI, microfracture, mosaicplasty, and synthetic cartilage constructs. Heterogeneous products and lack of good-quality randomized-control trials make product comparison difficult. Future developments involve scaffolds, gene therapy, growth factors, and stem cells to create a single-stage procedure that results in hyaline articular cartilage.Keywords: autologous chondrocyte implantation, microfracture, cartilage repair
Brazil’s Difficult Road to Greatness
2008-03-20
economia /2006/ not20060621p36210.htm; Internet; accessed 3 march 2008. 40 Brazilian Ministry of External Relations Home Page, available from http...December 2006 [newspaper on-line]; available from http://www.estadao.com.br/arquivo/ economia /2006/not2006062114p40470.htm; Internet; accessed 3 march...www.estadao.com.br/ economia /not_eco129669,0.htm; Internet; accessed 3 march 2008. 50 U.S. Army War College, National Security Policy and Strategy Course
2003-01-01
2003. http://cse.org/informed/issues_template.php/1250.htm [60] World Bank. E- Government , www1.worldbank.org/publicsector/ egov /definition.htm [61...Office of Management and Budget, E-Gov Related Legislation Overview. www.whitehouse.gov/omb/ egov /about_leg.htm [62] E- Government Act, December 17...s, the IT industry contributed 30% to U.S. GDP growth. Additionally, ev military service transformation relies heavily on IT. An IT advantage is
Langer, Arielle L; Ginzburg, Yelena Z
2017-06-01
Anemia of chronic inflammation (ACI) is a frequently diagnosed anemia and portends an independently increased morbidity and poor outcome associated with multiple underlying diseases. The pathophysiology of ACI is multifactorial, resulting from the effects of inflammatory cytokines which both directly and indirectly suppress erythropoiesis. Recent advances in molecular understanding of iron metabolism provide strong evidence that immune mediators, such as IL-6, lead to hepcidin-induced hypoferremia, iron sequestration, and decreased iron availability for erythropoiesis. The role of hepcidin-ferroportin axis in the pathophysiology of ACI is stimulating the development of new diagnostics and targeted therapies. In this review, we present an overview of and rationale for inflammation-, iron-, and erythropoiesis-related strategies currently in development. © 2017 International Society for Hemodialysis.
Study on creep of fiber reinforced ultra-high strength concrete based on strength
Peng, Wenjun; Wang, Tao
2018-04-01
To complement the creep performance of ultra-high strength concrete, the long creep process of fiber reinforced concrete was studied in this paper. The long-term creep process and regularity of ultra-high strength concrete with 0.5% PVA fiber under the same axial compression were analyzed by using concrete strength (C80/C100/C120) as a variable. The results show that the creep coefficient of ultra-high strength concrete decreases with the increase of concrete strength. Compared with ACI209R (92), GL2000 models, it is found that the predicted value of ACI209R (92) are close to the experimental value, and the creep prediction model suitable for this experiment is proposed based on ACI209R (92).
Directory of Open Access Journals (Sweden)
Muhammad H. Al-Malack
2016-07-01
Full Text Available Fuel oil flyash (FFA produced in power and water desalination plants firing crude oils in the Kingdom of Saudi Arabia is being disposed in landfills, which increases the burden on the environment, therefore, FFA utilization must be encouraged. In the current research, the effect of adding FFA on the engineering properties of two indigenous soils, namely sand and marl, was investigated. FFA was added at concentrations of 5%, 10% and 15% to both soils with and without the addition of Portland cement. Mixtures of the stabilized soils were thoroughly evaluated using compaction, California Bearing Ratio (CBR, unconfined compressive strength (USC and durability tests. Results of these tests indicated that stabilized sand mixtures could not attain the ACI strength requirements. However, marl was found to satisfy the ACI strength requirement when only 5% of FFA was added together with 5% of cement. When the FFA was increased to 10% and 15%, the mixture’s strength was found to decrease to values below the ACI requirements. Results of the Toxicity Characteristics Leaching Procedure (TCLP, which was performed on samples that passed the ACI requirements, indicated that FFA must be cautiously used in soil stabilization.
78 FR 35305 - Changes in Flood Hazard Determinations
2013-06-12
...). City of Westworth Road, Westworth lomrs.htm. Village, 311 Village, TX Burton Hill Road, 76114... Kanawha Kent Carper, Courthouse, team.com/ County, (13-03- President, Planning and lomrs.htm. 0645P...
Carbon intensity of electricity in ASEAN: Drivers, performance and outlook
International Nuclear Information System (INIS)
Ang, B.W.; Goh, Tian
2016-01-01
The Association of Southeast Asian Nations (ASEAN), with its ten member countries, has a total population exceeding 600 million. Its energy-related CO 2 emissions have been growing and in 2013 amounted to 3.6% of total global emissions. About 40% of ASEAN's energy-related CO 2 emissions are currently attributable to electricity production. In view of this high share, we study the CO 2 emissions of ASEAN's electricity production sector with a focus on the aggregate emission intensity (ACI) given by the level of CO 2 emissions for each unit of electricity produced. Drivers of ACI are analysed for individual countries and spatial analysis is conducted by comparing factors contributing to differences between the ACIs of individual countries and that of the ASEAN average. Arising from these analyses and in light of the current developments, it is concluded that drastic actions need to be taken both at the national and regional levels in order to reduce growth in the region's electricity-related CO 2 emissions. Two key policy issues, namely overcoming national circumstances to improve electricity generation mix and improving power generation efficiency, are further discussed. - Highlights: • Aggregate carbon intensities (ACIs) of ASEAN countries analysed temporally and spatially using index decomposition analysis. • Bleak future for emissions and ACI of ASEAN countries with increasing inclination towards coal for electricity production. • National circumstances impact ability of countries to improve electricity generation mix. • Significant unexploited potential for improvements in thermal efficiency of generation.
Energy Technology Data Exchange (ETDEWEB)
Burrows, John [Federal-Mogul Limited, Manchester (United Kingdom); Lykowski, Jim; Mixell, Kristapher [Federal-Mogul, Plymouth, MI (United States)
2013-06-01
Many future gasoline engines will require higher air/fuel ratios and higher mean effective pressures to further improve fuel efficiency. Federal-Mogul has taken up this challenge and has developed the Advanced Corona Ignition System (ACIS) as a new solution to reliably ignite a mix with high AFR/EGR and high MEP. During engine tests ACIS enabled a direct fuel economy improvement of up to 10 %. (orig.)
International Nuclear Information System (INIS)
Stals, M.; Verhoeven, S.; Bruggeman, M.; Pellens, V.; Schroeyers, W.; Schreurs, S.
2014-01-01
The Euratom BSS requires that in the near future (2015) the building materials for application in dwellings or buildings such as offices or workshops are screened for NORM nuclides. The screening tool is the activity concentration index (ACI). Therefore it is expected that a large number of building materials will be screened for NORM and thus require ACI determination. Nowadays, the proposed standard for determination of building material ACI is a laboratory analyses technique with high purity germanium spectrometry and 21 days equilibrium delay. In this paper, the B-NORM method for determination of building material ACI is assessed as a faster method that can be performed on-site, alternative to the aforementioned standard method. The B-NORM method utilizes a LaBr 3 (Ce) scintillation probe to obtain the spectral data. Commercially available software was applied to comprehensively take into account the factors determining the counting efficiency. The ACI was determined by interpreting the gamma spectrum from 226 Ra and its progeny; 232 Th progeny and 40 K. In order to assess the accuracy of the B-NORM method, a large selection of samples was analyzed by a certified laboratory and the results were compared with the B-NORM results. The results obtained with the B-NORM method were in good correlation with the results obtained by the certified laboratory, indicating that the B-NORM method is an appropriate screening method to assess building material ACI. The B-NORM method was applied to analyze more than 120 building materials on the Belgian market. No building materials that exceed the proposed reference level of 1 mSv/year were encountered. -- Highlights: • Many building materials will have to be tested for NORM activity concentrations. • An on-site NORM analysis method has been developed and validated. • Over 120 building materials on the Belgian market have been analyzed with this method. • The Euratom BSS reference level of 1 mSv/year excess dose will
Directory of Open Access Journals (Sweden)
Song YM
2014-12-01
Full Text Available Yanmin Song, Qunfang Li, Lili Long, Ning Zhang, Yunhai Liu Department of Neurology, Xiangya Hospital, Central South University, Changsha, Hunan Province, People’s Republic of China Background: CD31, also called platelet endothelial cell adhesion molecule-1 (PECAM-1, is thought to play a role in the pathological mechanisms of atherosclerosis. Leu125Val polymorphism and elevated plasma levels of soluble PECAM-1 (sPECAM-1 were found to be associated with cerebral infarction. Our aim was to investigate the association between the Asn563Ser polymorphism of CD31/PECAM-1, plasma level of sPECAM-1, and the risk of atherosclerotic cerebral infarction (ACI in the southern Han population of the People’s Republic of China.Subjects and methods: A total of 147 subjects with ACI and 114 controls were enrolled in the study. The Asn563Ser CD31/PECAM-1 polymorphism was detected using the polymerase chain reaction–restriction fragment length polymorphism method. The plasma spECAM-1 level was measured using the enzyme-linked immunosorbent assay method.Results: In this study, statistically significant differences in Asn563Ser genotype and allele distribution were found between the cases and controls (P<0.05. Furthermore, logistic regression analysis showed that the GG genotype is associated with increase in ACI risk (odds ratio =4.862, P<0.001. The plasma level of sPECAM-1 was associated with ACI (odds ratio =1.431, P=0.038. In both the ACI and the control groups, the plasma sPECAM-1 level in subjects with the GG genotype was higher than that in subjects carrying the AA or GA genotype (P<0.05.Conclusion: Our study showed that the Asn563Ser polymorphism of CD31/PECAM-1 gene and elevated plasma sPECAM-1 level are related to ACI risk in the southern Han population of People’s Republic of China. Keywords: genetic polymorphism, CD31, platelet endothelial cell adhesion molecule-1 (PECAM-1
Cho, Myoung-Ock; Kim, Jung Kyung; Han, Hwataik; Lee, Jeonghoon
2013-01-01
Asbestos that had been used widely as a construction material is a first-level carcinogen recognized by the World Health Organization. It can be accumulated in body by inhalation causing virulent respiratory diseases including lung cancer. In our previous study, we developed a high-throughput microscopy (HTM) system that can minimize human intervention accompanied by the conventional phase contrast microscopy (PCM) through automated counting of fibrous materials and thus significantly reduce analysis time and labor. Also, we attempted selective detection of chrysotile using DksA protein extracted from Escherichia coli through a recombinant protein production technique, and developed a dual-mode HTM (DM-HTM) by upgrading the HTM device. We demonstrated that fluorescently-labeled chrysotile asbestos fibers can be identified and enumerated automatically among other types of asbestos fibers or non-asbestos particles in a high-throughput manner through a newly modified HTM system for both reflection and fluorescence imaging. However there is a limitation to apply DM-HTM to airborne sample with current air collecting method due to the difficulty of applying the protein to dried asbestos sample. Here, we developed a technique for preparing liquid-phase asbestos sample using an impinger normally used to collect odor molecules in the air. It would be possible to improve the feasibility of the dual-mode HTM by integrating a sample preparation unit for making collected asbestos sample dispersed in a solution. The new technique developed for highly sensitive and automated asbestos detection can be a potential alternative to the conventional manual counting method, and it may be applied on site as a fast and reliable environmental monitoring tool.
Wongtriratanachai, Prasit; Pruksakorn, Dumnoensun; Pothacharoen, Peraphan; Nimkingratana, Puwapong; Pattamapaspong, Nuttaya; Phornphutkul, Chanakarn; Setsitthakun, Sasiwariya; Fongsatitkul, Ladda; Phrompaet, Sureeporn
2013-11-01
Autologous chondrocyte implantation (ACI) has become one of the standard procedures for articular cartilage defect treatment. This technique provides a promising result. However the procedural process requires an approach of several steps from multidisciplinary teams. Although the success of this procedure has been reported from Srinakharinvirot University since 2007, the application of ACI is still limited in Thailand due to the complexity of processes and stringent quality control. This report is to present the first case of the cartilage defect treatment using the first generation-ACI under Chiang Mai University's (CMU) own facility and Ethics Committee. This paper also reviews the process of biotechnology procedures, patient selection, surgical, and rehabilitation techniques. The success of the first case is an important milestone for the further development of the CMU Human Translational Research Laboratory in near future.
DEFF Research Database (Denmark)
Pestka, Jan M; Schmal, Hagen; Salzmann, Gian
2011-01-01
OBJECTIVE: Autologous chondrocyte implantation (ACI) is a well-established therapeutic option for the treatment of cartilage defects of the knee joint. Since information concerning the cellular aspects of ACI is still limited, the aim of the present study was to investigate relevant differences...... between chondrocyte quality after in vitro cultivation and possible correlations with patient-specific factors. DESIGN: Cell quality of 252 consecutive ACI patients was assessed after chondrocyte in vitro expansion by determination of the expression of cartilage relevant surface marker CD44 and cartilage......, aggrecan or collagen type II nor cell density or viability after proliferation seemed to correlate with the grade of joint degeneration, defect aetiology or patient gender. However, chondrocytes harvested from the knee joints of patients at less than 20 years of age showed significantly higher expression...
Erdle, Benjamin; Herrmann, Simon; Porichis, Stella; Uhl, Markus; Ghanem, Nadir; Schmal, Hagen; Suedkamp, Norbert; Niemeyer, Philipp; Salzmann, Gian M
2017-10-01
Little is known about long-term sporting activity after periosteal autologous chondrocyte implantation (ACI-P) and its correlation to clinical, morphological, and ultrastructural cartilage characteristics on magnetic resonance imaging (MRI). To evaluate long-term sporting activity after ACI-P and to correlate with clinical and MRI findings. Case series; Level of evidence, 4. Patients who underwent ACI-P for isolated cartilage defects of the knee joint between 1997 and 2001 were analyzed for sporting ability for 3 different time points: lifetime until the onset of pain, the year before ACI-P, and 11 years (range, 9.0-13.4 years) postoperatively. Sporting activity was assessed and patients' level of activity scaled using standardized questionnaires. MRI scans of the affected knee joint at follow-up were analyzed using the MOCART (magnetic resonance observation of cartilage repair tissue) score and T2 mapping. Seventy of 86 patients (81% follow-up rate) consisting of 25 female and 45 male patients, with a mean age of 33.3 ± 10.2 years at the time of surgery, mean defect size of 6.5 ± 4.0 cm 2 , and 1.17 treated defects per patient, agreed to participate in the study at a mean 10.9 ± 1.1 years after ACI-P. Fifty-nine patients (69% of total; 84% of follow-up) agreed to MRI, allowing the complete evaluation of 71 transplant sites. Before the onset of symptoms (lifetime), 95.7% of patients played a mean 6.0 sporting activities at a competitive level. In the year before ACI-P, 81.4% of patients played a mean 3.4 sporting activities in 2.4 sessions during 5.4 hours per week at a recreational level. At follow-up, 82.9% of the patients played a mean 3.0 sporting activities in 1.8 sessions during 3.0 hours per week at a recreational level. In contrast to objective factors, 65.6% of the patients felt that their subjective sporting ability had improved or strongly improved after ACI-P, whereas 12.9% felt that their situation had declined or strongly declined, and 21.4% stated
International Nuclear Information System (INIS)
Halkier, B.A.; Moller, B.L.
1990-01-01
N-Hydroxytyrosine, (E)- and (Z)-p-hydroxyphenyl-acetaldehyde oxime, p-hydroxyphenylacetonitrile, and p-hydroxymandelonitrile are established intermediates in the biosynthesis of the tyrosine-derived cyanogenic glucoside dhurrin. Simultaneous measurements of oxygen consumption and biosynthetic activity using a microsomal enzyme system isolated from etiolated sorghum seedlings demonstrate a requirement for three oxygen molecules in the conversion of tyrosine to p-hydroxymandelonitrile. Two oxygen molecules are consumed in the conversion of tyrosine to (E)-p-hydroxyphenylacetaldehyde oxime, indicating the existence of a previously undetected hydroxylation step in addition to that resulting in the formation of N-hydroxytyrosine. Radioactively labeled 1-nitro-2-(p-hydroxyphenyl)ethane was chemically synthesized and tested as a possible intermediate. Biosynthetic experiments demonstrate that the microsomal enzyme system metabolizes the nitro compound to the subsequent intermediates in dhurrin synthesis (Km = 0.05 mM; Vmax = 14 nmol/mg of protein/h). Low amounts of 1-nitro-2-(p-hydroxyphenyl)ethane are produced in the microsomal reaction mixtures when tyrosine is used as substrate. These data support the involvement of 1-nitro-2-(p-hydroxyphenyl)ethane or more likely its aci-nitro tautomer as an intermediate between N-hydroxytyrosine and p-hydroxyphenylacetaldehyde oxime. The conversion of (E)-p-hydroxyphenylacetaldehydeoxime to p-hydroxymandelonitrile requires a single oxygen molecule. The oxygen molecule is utilized for hydroxylation of p-hydroxyphenylacetonitrile into p-hydroxymandelonitrile. This indicates that the conversion of p-hydroxyphenylacetaldehyde oxime into p-hydroxyphenylacetonitrile proceeds by a simple dehydration reaction
The New START Treaty: Central Limits and Key Provisions
2014-08-27
article-by-article analysis can be found at http://www.state.gov/t/ avc /newstart/c44126.htm. 2 For a brief summary of the original START Treaty, as...2014, http://www.state.gov/t/ avc /rls/224236.htm . The fact sheet does not display warhead subtotals for each delivery system; it only includes an...of Strategic Offensive Forces, Fact Sheet, Washington, DC, April 1, 2014, http://www.state.gov/t/ avc /rls/228652.htm. The New START Treaty: Central
DiBartola, Alex C; Everhart, Joshua S; Magnussen, Robert A; Carey, James L; Brophy, Robert H; Schmitt, Laura C; Flanigan, David C
2016-06-01
Compare histological outcomes after microfracture (MF), autologous chondrocyte implantation (ACI), and osteochondral autograft transfer (OATS). Literature review using PubMed MEDLINE, SCOPUS, Cumulative Index for Nursing and Allied Health Literature (CINAHL), and Cochrane Collaboration Library. Inclusion criteria limited to English language studies International Cartilage Repair Society (ICRS) grading criteria for cartilage analysis after ACI (autologous chondrocyte implantation), MF (microfracture), or OATS (osteochondral autografting) repair techniques. Thirty-three studies investigating 1511 patients were identified. Thirty evaluated ACI or one of its subtypes, six evaluated MF, and seven evaluated OATS. There was no evidence of publication bias (Begg's p=0.48). No statistically significant correlation was found between percent change in clinical outcome and percent biopsies showing ICRS Excellent scores (R(2)=0.05, p=0.38). Percent change in clinical outcome and percent of biopsies showing only hyaline cartilage were significantly associated (R(2)=0.24, p=0.024). Mean lesion size and histological outcome were not correlated based either on percent ICRS Excellent (R(2)=0.03, p=0.50) or percent hyaline cartilage only (R(2)=0.01, p=0.67). Most common lesion location and histological outcome were not correlated based either on percent ICRS Excellent (R(2)=0.03, p=0.50) or percent hyaline cartilage only (R(2)=0.01, p=0.67). Microfracture has poorer histologic outcomes than other cartilage repair techniques. OATS repairs primarily are comprised of hyaline cartilage, followed closely by cell-based techniques, but no significant difference was found cartilage quality using ICRS grading criteria among OATS, ACI-C, MACI, and ACI-P. IV, meta-analysis. Copyright © 2016 Elsevier B.V. All rights reserved.
Molinaro, Peter F; Arndorfer, Andrea; Charman, Steve D
2013-12-01
Instructing witnesses that a criminal may have changed appearance prior to showing them a lineup has been shown to increase false identifications without increasing correct identifications (S. D. Charman & G. L. Wells, 2007, Is the appearance-change instruction a good idea? Law and Human Behavior, Vol. 31, pp. 3-22). However, the generalizability of the effects of this appearance-change instruction (ACI) is unknown, and there are reasons to believe that the instruction's effects may be moderated by the amount of appearance change the criminal has actually undergone. The current study tested this hypothesis. Undergraduate students (N = 315) were exposed to a series of target faces and lineups, some of which contained the target and some of which did not, and made identification decisions. Half of the participants received a standard ACI prior to each lineup; the other half did not. The targets varied with respect to the amount to which their appearance had changed. Results indicated that the ACI inflated false identifications without inflating correct identifications, and that these effects did not depend on the amount of appearance change the target had undergone. Current recommendations to administer the ACI seem to be unfounded and may be harmful to the reliability of identification evidence. (c) 2013 APA, all rights reserved
Liu, Zhe-Peng; Cui, Lei; Yu, Deng-Guang; Zhao, Zhuan-Xia; Chen, Lan
2014-01-01
A novel structural solid dispersion (SD) taking the form of core–shell microparticles for poorly water-soluble drugs is reported for the first time. Using polyvinylpyrrolidone (PVP) as a hydrophilic polymer matrix, the SDs were fabricated using coaxial electrospraying (characterized by an epoxy-coated concentric spray head), although the core fluids were unprocessable using one-fluid electrospraying. Through manipulating the flow rates of the core drug-loaded solutions, two types of core–shell microparticles with tunable drug contents were prepared. They had average diameters of 1.36±0.67 and 1.74±0.58 μm, and were essentially a combination of nanocomposites with the active ingredient acyclovir (ACY) distributed in the inner core, and the sweeter sucralose and transmembrane enhancer sodium dodecyl sulfate localized in the outer shell. Differential scanning calorimetry and X-ray diffraction results demonstrated that ACY, sodium dodecyl sulfate, and sucralose were well distributed in the PVP matrix in an amorphous state because of favorable second-order interactions. In vitro dissolution and permeation studies showed that the core–shell microparticle SDs rapidly freed ACY within 1 minute and promoted nearly eightfold increases in permeation rate across the sublingual mucosa compared with raw ACY powders. PMID:24790437
Affect Consciousness in children with internalizing problems: Assessment of affect integration.
Taarvig, Eva; Solbakken, Ole André; Grova, Bjørg; Monsen, Jon T
2015-10-01
Affect integration was operationalized through the Affect Consciousness (AC) construct as degrees of awareness, tolerance, nonverbal expression and conceptual expression of 11 affects. These aspects are assessed through a semi-structured Affect Consciousness Interview (ACI) and separate rating scales (Affect Consciousness Scales (ACSs)) developed for use in research and clinical work with adults with psychopathological disorders. Age-adjusted changes were made in the interview and rating system. This study explored the applicability of the adjusted ACI to a sample of 11-year-old children with internalizing problems through examining inter-rater reliability of the adjusted ACI, along with relationships between the AC aspects and aspects of mental health as symptoms of depression, symptoms of anxiety, social competence, besides general intelligence. Satisfactory inter-rater reliability was found, as well as consistent relationships between the AC aspects and the various aspects of mental health, a finding which coincides with previous research. The finding indicates that the attainment of the capacity to deal adaptively with affect is probably an important contributor to the development of adequate social competence and maybe in the prevention of psychopathology in children. The results indicate that the adjusted ACI and rating scales are useful tools in treatment planning with children at least from the age of 11 years. © The Author(s) 2014.
The Assessment of Comunication and Interaction Skills in Psychotic Patiens
Directory of Open Access Journals (Sweden)
Katayoun Khoushabi
2002-10-01
Full Text Available Objective: The main objective at study was to assess the communication and interaction of psychotic patient above age of 18 in 2000. Materials & Methods: The study sample consist of 80 psychotic patients (38 female and 42 male from Razi and Imam Hossein Hospital and Raad and Sina outpatient clinic, selected based on occupational therapist using the Assessment of Communication and Interaction Skills Questionnaire (ACIS. Statistical analyses of information have done by spearman coefficient correlation, Mann Whitney and Wilcoxon tests. Results: Spearman of correlation, mann-and wilcoxon Findings indicate: 1-The average grade of ACIS test in the group of schizophrenic patients were significantly lower than the group schizoaffective patients (P<0.00l. 2-The average of ACIS test in the group of inpatient was lower than the group of outpatient (p<0.00l. 3-No significant difference was found for the average grade of ACIS test in the group of male & female. Conclusion: The obtained results show the weakness of communication and interaction skills in schizophrenic patient and also inpatients. The obtained results of this investigation give useful information about the communication and interaction skill of patient to the occupational therapists but application of this instrument needs more studies.
Evolution of Autologous Chondrocyte Repair and Comparison to Other Cartilage Repair Techniques
Directory of Open Access Journals (Sweden)
Ashvin K. Dewan
2014-01-01
Full Text Available Articular cartilage defects have been addressed using microfracture, abrasion chondroplasty, or osteochondral grafting, but these strategies do not generate tissue that adequately recapitulates native cartilage. During the past 25 years, promising new strategies using assorted scaffolds and cell sources to induce chondrocyte expansion have emerged. We reviewed the evolution of autologous chondrocyte implantation and compared it to other cartilage repair techniques. Methods. We searched PubMed from 1949 to 2014 for the keywords “autologous chondrocyte implantation” (ACI and “cartilage repair” in clinical trials, meta-analyses, and review articles. We analyzed these articles, their bibliographies, our experience, and cartilage regeneration textbooks. Results. Microfracture, abrasion chondroplasty, osteochondral grafting, ACI, and autologous matrix-induced chondrogenesis are distinguishable by cell source (including chondrocytes and stem cells and associated scaffolds (natural or synthetic, hydrogels or membranes. ACI seems to be as good as, if not better than, microfracture for repairing large chondral defects in a young patient’s knee as evaluated by multiple clinical indices and the quality of regenerated tissue. Conclusion. Although there is not enough evidence to determine the best repair technique, ACI is the most established cell-based treatment for full-thickness chondral defects in young patients.
Mechanism of donor to host tolerance in rat bone marrow chimeras
International Nuclear Information System (INIS)
Tutschka, P.; Schwerdtfeger, R.; Slavin, R.; Santos, G.
1977-01-01
Lewis rats were conditioned with cyclophosphamide and grafted with AgB incompatible bone marrow. They were examined 250 days after transplantation and demonstrated to be healthy complete chimeras. Marrow cells from these chimeras were infused into lethally irradiated ACI, Lewis and BN recipients. Graft-versus-host disease occurred only in the BN rats. Other chimeric rats were given no treatment, busulfan, CY, or total body irradiation prior to the infusion of normal ACI BM. GvHD occurred only in animals given CY or TBI. Normal Lewis rats were conditioned with TBI and given ACI BM. In addition, they received whole blood, irradiated blood, or serum from chimeric rats. GvHD developed in all animals except those given unirradiated chimeric blood. These studies suggest that suppressor cell populations, sensitive to immunosuppression, are likely the fundamental mechanism of recovery from GvHD
MR imaging of autologous chondrocyte implantation of the knee
Energy Technology Data Exchange (ETDEWEB)
James, S.L.J.; Connell, D.A.; Saifuddin, A.; Skinner, J.A.; Briggs, T.W.R. [RNOH Stanmore, Department of Radiology, Stanmore, Middlesex (United Kingdom)
2006-05-15
Autologous chondrocyte implantation (ACI) is a surgical technique that is increasingly being used in the treatment of full-thickness defects of articular cartilage in the knee. It involves the arthroscopic harvesting and in vitro culture of chondrocytes that are subsequently implanted into a previously identified chondral defect. The aim is to produce a repair tissue that closely resembles hyaline articular cartilage that gradually becomes incorporated, restoring joint congruity. Over the long term, it is hoped that this will prevent the progression of full-thickness articular cartilage defects to osteoarthritis. This article reviews the indications and operative procedure performed in ACI. Magnetic resonance imaging (MRI) sequences that provide optimal visualization of articular cartilage in the post-operative period are discussed. Normal appearances of ACI on MRI are presented along with common complications that are encountered with this technique. (orig.)
Spirobifluorene Core-Based Novel Hole Transporting Materials for Red Phosphorescence OLEDs
Directory of Open Access Journals (Sweden)
Ramanaskanda Braveenth
2017-03-01
Full Text Available Two new hole transporting materials, named HTM 1A and HTM 1B, were designed and synthesized in significant yields using the well-known Buchwald Hartwig and Suzuki cross- coupling reactions. Both materials showed higher decomposition temperatures (over 450 °C at 5% weight reduction and HTM 1B exhibited a higher glass transition temperature of 180 °C. Red phosphorescence-based OLED devices were fabricated to analyze the device performances compared to Spiro-NPB and NPB as reference hole transporting materials. Devices consist of hole transporting material as HTM 1B showed better maximum current and power efficiencies of 16.16 cd/A and 11.17 lm/W, at the same time it revealed an improved external quantum efficiency of 13.64%. This efficiency is considerably higher than that of Spiro-NPB and NPB-based reference devices.
Sélection de sites web sur genre et économie
2017-01-01
http://www.afedonline.com http://www.unog.ch/frames/library/bibliography/women.htm Les Femmes, bibliographie sélective 1988-1999, Bibliothèque des Nations Unies, Genève. http://www.africabib.org/womendb.html http://www.eclacpos.org Commission Economique pour l’Amérique Latine y les Caraïbes. Propose un système d’indicateurs prenant le genre en compte, “SISESIM 2001”. http://www.fao.org/Gender/en/agri-e.htm http://www.genderarena.com/genderarena/homepage.htm http://www.gn.apc.org/homenet H...
articles 13.htm | mar25 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines ...
Healthcare Technology Management (HTM) of mechanical ventilators by clinical engineers
Yoshioka, Jun; Nakane, Masaki; Kawamae, Kaneyuki
2014-01-01
Mechanical ventilator failures expose patients to unacceptable risks, and maintaining mechanical ventilator safety is an important issue. We examined the usefulness of maintaining mechanical ventilators by clinical engineers (CEs) using a specialized calibrator. These evaluations and the ability to make in-house repairs proved useful for obviating the need to rent ventilators which, in turn, might prove faulty themselves. The CEs' involvement in maintaining mechanical ventilators is desirable...
Healthcare Technology Management (HTM) of mechanical ventilators by clinical engineers.
Yoshioka, Jun; Nakane, Masaki; Kawamae, Kaneyuki
2014-01-01
Mechanical ventilator failures expose patients to unacceptable risks, and maintaining mechanical ventilator safety is an important issue. We examined the usefulness of maintaining mechanical ventilators by clinical engineers (CEs) using a specialized calibrator. These evaluations and the ability to make in-house repairs proved useful for obviating the need to rent ventilators which, in turn, might prove faulty themselves. The CEs' involvement in maintaining mechanical ventilators is desirable, ensures prompt service, and, most importantly, enhances safe management of mechanical ventilators.
articles30.htm | may25 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.
articles27.htm | apr25 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
2018-03-13
Lists of selected candidates. Interaction Meeting on Women In Science. Posted on 12 March 2018. Meeting will be on March 13, 2018 in Multimedia Room, Physics Department, IISc. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, ...
Access control and interlock system at the Advanced Photon Source
International Nuclear Information System (INIS)
Forrestal, J.; Hogrefe, R.; Knott, M.; McDowell, W.; Reigle, D.; Solita, L.; Koldenhoven, R.; Haid, D.
1997-01-01
The Advanced Photon Source (APS) consists of a linac, position accumulator ring (PAR), booster synchrotron, storage ring, and up to 70 experimental beamlines. The Access Control and Interlock System (ACIS) utilizes redundant programmable logic controllers (PLCs) and a third hard-wired chain to protect personnel from prompt radiation generated by the linac, PAR, synchrotron, and storage ring. This paper describes the ACIS's design philosophy, configuration, hardware, functionality, validation requirements, and operational experience
Anomalous Insulator-Metal Transition in Boron Nitride-Graphene Hybrid Atomic Layers
2012-08-13
Juan de la Cierva” pro- gram (JCI-2010-08156), Spanish MICINN (FIS2010-21282- C02-01 and PIB2010US-00652), ACI-Promociona (ACI2009- 1036), “ Grupos ...percolation through metallic graphene networks and hopping conduction between edge states on randomly distributed insulating h-BN domains. REPORT...Tallahassee, Florida 32310, USA 3Nano-Bio Spectroscopy Group and ETSF Scientific Development Centre, Departamento de Fı́sica de Materiales, Centro de Fı́sica
2016-07-04
required analysis, and further testing. 15. SUBJECT TERMS Adjacent Channel Interference, ACI, LTE -A, LTE , PCM/FM, SOQPSK-TG, ARTM CPM, AWS-3, User...Interference, ACI, LTE -A, LTE , PCM/FM, SOQPSK-TG, ARTM CPM, AWS-3, User Equipment, UE, Evolved Node B, eNodeB, Resource Blocks INTRODUCTION “On...these questions make necessary an improved understanding of the interferers that can be obtained only by hands-on measurements . This work will
2011-05-02
... INFORMATION CONTACT: Dianna B. Smith, Environmental Scientist, U.S. Environmental Protection Agency, Region 4.../transp.htm (once there, click on the ``Transportation Conformity'' text icon, then look for ``Adequacy.../stateresources/index.htm , (once there, click ``Transportation Conformity'' text icon, then look for ``Adequacy...
Enhancement of PM2.5 Concentrations by Aerosol-Meteorology Interactions Over China
Zhang, Xin; Zhang, Qiang; Hong, Chaopeng; Zheng, Yixuan; Geng, Guannan; Tong, Dan; Zhang, Yuxuan; Zhang, Xiaoye
2018-01-01
Aerosol-meteorology interactions can change surface aerosol concentrations via different mechanisms such as altering radiation budget or cloud microphysics. However, few studies investigated the impacts of different mechanisms on temporal and spatial distribution of PM2.5 concentrations over China. Here we used the fully coupled Weather Research and Forecasting model with online chemistry (WRF-Chem) to quantify the enhancement of PM2.5 concentrations by aerosol-meteorology feedback in China in 2014 for different seasons and separate the relative impacts of aerosol radiation interactions (ARIs) and aerosol-cloud interactions (ACIs). We found that ARIs and ACIs could increase population-weighted annual mean PM2.5 concentration over China by 4.0 μg/m3 and 1.6 μg/m3, respectively. We found that ARIs play a dominant role in aerosol-meteorology interactions in winter, while the enhancement of PM2.5 concentration by ARIs and ACIs is comparable in other three seasons. ARIs reduced the wintertime monthly mean wind speed and planetary boundary layer (PBL) height by up to 0.1 m/s and 160 m, respectively, but increased the relative humidity by up to 4%, leading to accumulation of pollutants within PBL. Also, ARIs reduced dry deposition velocity of aerosols by up to 20%, resulting in an increase in PM2.5 lifetime and concentrations. ARIs can increase wintertime monthly mean surface PM2.5 concentration by a maximum of 30 μg/m3 in Sichuan Basin. ACIs can also increase PM2.5 concentration with more significant impacts in wet seasons via reduced wet scavenging and enhanced in-cloud chemistry. Dominant processes in PM2.5 enhancement are also clarified in different seasons. Results show that physical process is more important than chemical processes in winter in ARIs, while chemical process of secondary inorganic aerosols production may be crucial in wet seasons via ACIs.
Clinical application of the three-dimensional reconstruction of spiral CT pneumocolon
International Nuclear Information System (INIS)
Yu Shenping; Li Ziping; Xu Dasheng; Lin Erjian; Lin Peizhang; Xu Qiaolan
2000-01-01
Objective: To evaluate the clinical role of the 3 types of reconstruction of the spiral CT pneumocolon in the diagnosis of colon lesions. Methods: Three types of reconstruction with spiral CT pneumocolon including air cast imaging (ACI), CT virtual endoscopy (CTVE), and multiple planner reconstruction (MPR) in 34 patients with colorectal cancer or polyps were correlated with surgical pathology respectively. Results: Among the 34 patients, 30 was colorectal cancer and 6 was polyps (2 of which in the proximal lumen of 2 colon cancer). (1) Comparison between the 3 types of the spiral CT pneumocolon reconstruction and pathology in colorectal cancer. 1) ACI: tumor patterns: coincide (n =22), anti-coincide (n = 8); tumor extension: coincide (n = 24), anti-coincide (n = 6); tumor size: coincide (n = 28), anti-coincide (n = 2). 2) CTVE: tumor patterns: coincide (n = 26), anti-coincide (n = 4); tumor extension: coincide (n = 25), anti-coincide ( n 5); tumor size: coincide (n = 23), anti-coincide (n = 7). 3) MPR: tumor patterns: coincide (n = 24), anti-coincide (n = 6); tumor extension: coincide (n = 30), anti-coincide (n = 0); tumor size: coincide (n = 26), anti-coincide (n = 4). (2) Comparison between the 3 types of the spiral CT pneumocolon reconstruction and pathology in colorectal polyps: the lesions were displayed in 4 (ACI) and in 6 (CTVE and MPR). Conclusion: (1) For the diagnosis of colorectal cancers: CTVE was the best means to display the tumor patterns, MPR most correct to judge the tumor extension, and ACI most suitable to measure the tumor size. (2) For the diagnosis of colorectal polyps, ACI can be used for oriented diagnosis, CTVE can well display the intra-luminal three-dimensional structure and can be used for characteristic diagnosis, MPR can be used for differential diagnosis
Roidoung, Sunisa; Dolan, Kirk D; Siddiq, Muhammad
2017-04-01
Color degradation in cranberry juice during storage is the most common consumer complaint. To enhance nutritional quality, juice is typically fortified with vitamin C. This study determined effect of gallic acid, a natural antioxidant, for the preservation of anthocyanins (ACYs) and color, and estimated kinetics of ACYs and color degradation. Juice, fortified with 40-80mg/100mL vitamin C and 0-320mg/100mL gallic acid, was pasteurized at 85°C for 1min and stored at 23°C for 16days. Total monomeric anthocyanins and red color intensity were evaluated spectrophotometrically and data were used to determine degradation rate constants (k values) and order of reaction (n) of ACYs and color. Due to high correlation, k and n could not be estimated simultaneously. To overcome this difficulty, both n and k were held at different constant values in separate analyses to allow accurate estimation of each. Parameters n and k were modeled empirically as functions of vitamin C, and of vitamin C and gallic acid, respectively. Reaction order n ranged from 1.2 to 4.4, and decreased with increasing vitamin C concentration. The final model offers an effective tool that could be used for predicting ACYs and color retention in cranberry juice during storage. Copyright © 2017. Published by Elsevier Ltd.
Nicoloro-SantaBarbara, Jennifer M; Lobel, Marci; Bocca, Silvina; Stelling, James R; Pastore, Lisa M
2017-07-01
To examine the magnitude and predictors of emotional reactions to an infertility diagnosis in two groups of women: those with diminished ovarian reserve (DOR), and those clinically diagnosed with an anatomical cause of infertility (ACI). Cross-sectional study. Academic and private fertility clinics. Women diagnosed with DOR (n = 51) and women diagnosed with ACI (n = 51). Not applicable. Fertility Problem Inventory (infertility distress), Rosenberg Self-Esteem Scale, Health Orientation Scale (emotional reactions to receiving a diagnosis). Women with DOR had statistically significantly higher infertility distress scores than women with ACI and higher scores on subscales assessing distress from social concerns, sexual concerns, and a need for parenthood. In both groups, higher self-esteem was associated with lower infertility distress. Hierarchical multiple regression analyses revealed that for women with DOR and those with ACI lower infertility distress but not self-esteem predicted a more positive emotional reaction toward receiving a fertility diagnosis. Women diagnosed with DOR have greater infertility distress but similar self-esteem and emotional reactions to their diagnosis compared with women who have an anatomical cause of infertility. These results suggest that for both groups distress surrounding infertility itself may influence the way women respond to learning the cause of their infertility. Copyright © 2017 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.
78 FR 63224 - Endocrinologic and Metabolic Drugs Advisory Committee; Notice of Meeting
2013-10-23
... treatment of Mucopolysaccharidosis Type IVA (Morquio A syndrome). Morquio A syndrome is a rare congenital... Agency's Web site at http://www.fda.gov/AdvisoryCommittees/default.htm and scroll down to the appropriate...Committees/Calendar/default.htm . Scroll down to the appropriate advisory committee meeting link. Procedure...
75 FR 47605 - Vaccines and Related Biological Products Advisory Committee; Notice of Meeting
2010-08-06
... information about transportation and directions to the NIH campus, parking, and security procedures is available on the Internet at http://www.nih.gov/about/visitor/index.htm . (FDA has verified the Web site.../visitorsecurity.htm . Due to the limited available parking, visitors are encouraged to use public transportation...
75 FR 65640 - Cellular, Tissue and Gene Therapies Advisory Committee; Notice of Meeting
2010-10-26
... information about transportation and directions to the NIH campus, parking and security procedures is available on the Internet at http://www.nih.gov/about/visitor/index.htm . (FDA has verified the Web site.../visitorsecurity.htm . Due to the limited available parking, visitors are encouraged to use public transportation...
2010-04-23
slightly higher figure of 389,967 displaced persons for 2008. See http://www.accionsocial.gov.co/ Estadisticas /publicacion%20junio%20de%202009.htm...persons for 2008. See: http://www.accionsocial.gov.co/ Estadisticas /publicacion%20junio%20de%202009.htm. 69 CODHES bases its estimates on fieldwork, and
2013-08-26
... for Medical Science (CIOMS) and the International Council for Laboratory Animal Science (ICLAS). PHS.../references/hrea1985.htm ) and the PHS Policy on Humane Care and Use of Laboratory Animals (PHS Policy; http://grants.nih.gov/grants/olaw/references/phspol.htm ). The PHS Policy requires that institutions have an...
ANÁLISIS DE LA ONTOLOGÍA DE LA MÚSICA EN LA OBRA LA POÉTICA DE LA ENSOÑACIÓN DE GASTON BACHELARD
Directory of Open Access Journals (Sweden)
Juan Ramón Búa Soneira
2015-12-01
Full Text Available En este estudio nos dirigimos a realizar un análisis de la obra La poética de la ensoñación, para lo cual tomaremos como hilo temático la cuestión del tiempo y la música. La dificultad que ello supone nos obliga a leer determinadas partes de la obra con más énfasis que otras, pudiendo así esbozar una comprensión implícita de los rasgos de esa “poética de la ensoñación” de la que nos habla Bachelard. En el mismo sentido hablaremos de una ontología de la música que se revela en esta dialéctica del sueño y la ensoñación, esto es, un análisis del tiempo y su rastro musical que tiene aparición en el devenir poético.
Kamaruzaman, Dayana; Ahmad, Nurfadzilah; Annuar, Ishak; Rusop, Mohamad
2013-11-01
Nanostructured iodine-post doped amorphous carbon (a-C:I) thin films were prepared from camphor oil using a thermal chemical vapor deposition (TCVD) technique at different doping temperatures. The structural properties of the films were studied by field-emission scanning electron microscopy (FESEM), energy-dispersive spectroscopy (EDS), Raman, and Fourier transform infrared (FTIR) studies. FESEM and EDS studies showed successful iodine doping. FTIR and Raman studies showed that the a-C:I thin films consisted of a mixture of sp2- and sp3-bonded carbon atoms. The optical and electrical properties of a-C:I thin films were determined by UV-vis-NIR spectroscopy and current-voltage (I-V) measurement respectively. The optical band gap of a-C thin films decreased upon iodine doping. The highest electrical conductivity was found at 400 °C doping. Heterojunctions are confirmed by rectifying the I-V characteristics of an a-C:I/n-Si junction.
Structure and photoelectrochemistry of silver-copper-indium-diselenide ((AgCu)InSe2) thin film
Zhang, Lin Rui; Li, Tong; Wang, Hao; Pang, Wei; Chen, Yi Chuan; Song, Xue Mei; Zhang, Yong Zhe; Yan, Hui
2018-02-01
In this work, silver (Ag) precursors with different thicknesses were sputtered on the surfaces of CuIn alloys, and (AgCu)InSe2 (ACIS) films were formed after selenization at 550 °C under nitrogen condition using a rapid thermal process furnace. The structure and electrical properties of the ACIS films were investigated. The result showed that the distribution of Ag+ ion was more uniform with increasing the thickness of Ag precursor, and the surface of the thin-film became more homogeneous and denser. When Ag/Cu ratio ≥0.249, the small grain particles disappeared. The band gap can be rationally controlled by adjusting Ag content. When (Ag + Cu)/In ratio ≥ 1.15, the surface of the ACIS thin-film mainly exhibited n-type semiconductor. Through the photoelectrochemistry measurement, it was observed that the incorporation of Ag+ ions could improve photocurrent by adjusting the band gap. With the Ag precursor thickness increased, the dark current decreased at the more negative potential.
A DECADE-BASELINE STUDY OF THE PLASMA STATES OF EJECTA KNOTS IN CASSIOPEIA A
Energy Technology Data Exchange (ETDEWEB)
Rutherford, John; Dewey, Daniel; Figueroa-Feliciano, Enectali; Heine, Sarah N. T.; Canizares, C. R.; Bastien, Fabienne A.; Sato, Kosuke, E-mail: enectali@mit.edu, E-mail: jmrv@mit.edu [Department of Physics and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)
2013-05-20
We present the analysis of 21 bright X-ray knots in the Cassiopeia A supernova remnant from observations spanning 10 yr. We performed a comprehensive set of measurements to reveal the kinematic and thermal state of the plasma in each knot, using a combined analysis of two high energy resolution High Energy Transmission Grating (HETG) and four medium energy resolution Advanced CCD Imaging Spectrometer (ACIS) sets of spectra. The ACIS electron temperature estimates agree with the HETG-derived values for approximately half of the knots studied, yielding one of the first comparisons between high resolution temperature estimates and ACIS-derived temperatures. We did not observe the expected spectral evolution-predicted from the ionization age and density estimates for each knot-in all but three of the knots studied. The incompatibility of these measurements with our assumptions has led us to propose a dissociated ejecta model, with the metals unmixed inside the knots, which could place strong constraints on supernova mixing models.
Setareh, Mehdi
2017-01-01
This revised, fully updated second edition covers the analysis, design, and construction of reinforced concrete structures from a real-world perspective. It examines different reinforced concrete elements such as slabs, beams, columns, foundations, basement and retaining walls and pre-stressed concrete incorporating the most up-to-date edition of the American Concrete Institute Code (ACI 318-14) requirements for the design of concrete structures. It includes a chapter on metric system in reinforced concrete design and construction. A new chapter on the design of formworks has been added which is of great value to students in the construction engineering programs along with practicing engineers and architects. This second edition also includes a new appendix with color images illustrating various concrete construction practices, and well-designed buildings. The ACI 318-14 constitutes the most extensive reorganization of the code in the past 40 years. References to the various sections of the ACI 318-14 are pro...
Institute of Scientific and Technical Information of China (English)
En-Dong Jia; Xi Lou; Chun-Lan Zhou; Wei-Chang Hao; Wen-Jing Wang
2017-01-01
We demonstrate a simple and fast post-deposition treatment with high process compatibility on the hole transport material (HTM) Spiro-MeOTAD in vapor-assisted solution processed methylammonium lead triiodide (CH3NH3PbI3)-based solar cells.The prepared Co-doped p-type Spiro-MeOTAD films are treated by O3 at room temperature for 5 min,10 min,and 20 min,respectively,prior to the deposition of the metal electrodes.Compared with the traditional oxidation of Spiro-MeOTAD films overnight in dry air,our fast O3 treatment of HTM at room temperature only needs just 10 min,and a relative 40.3% increment in the power conversion efficiency is observed with respect to the result of without-treated perovskite solar cells.This improvement of efficiency is mainly attributed to the obvious increase of the fill factor and short-circuit current density,despite a slight decrease in the open-circuit voltage.Ultraviolet photoelectron spectroscopy (UPS) and Hall effect measurement method are employed in our study to determine the changes of properties after O3 treatment in HTM.It is found that after the HTM is exposed to O3,its p-type doping level is enhanced.The enhancement of conductivity and Hall mobility of the film,resulting from the improvement in p-doping level of HTM,leads to better performances of perovskite solar cells.Best power conversion efficiencies (PCEs) of 13.05% and 16.39% are achieved with most properly optimized HTM via CH3NH3I vapor-assisted method and traditional single-step method respectively.
European Missile Defense and Russia
2014-07-01
Moskovskiy Komsomolets, September 18, 2009. 27. U.S. Department of State website, available from www. state.gov/t/ avc /rls/162447.htm. 28. BBC Monitoring (BBCM...see www.state.gov/t/ avc /c52028.htm and www. slideshare.net/rusemblon/russian-mod-views-on-nato-missile-defence- in-europe, respectively. 67
2012-01-13
.../otaq/climate/regulations.htm or by searching the public dockets (NHTSA-2010-0131 (for the proposed rule... EPA's Web site at http://www.epa.gov/otaq/climate/regulations.htm . NHTSA and EPA will consider all... vehicles for model years 2017-2025. On May 21, 2010, President Obama issued a Presidential Memorandum...
Jack, Kristen
2011-01-01
Previous research has revealed that industry professionals and educators in the field of Hospitality and Tourism Management (HTM) agree that classroom theory and experience in the field are essential components of undergraduate HTM education. Yet there is some disagreement on internship hour requirements, and limited data on actual outcomes. This…
Autologous Chondrocyte Implantation in Osteoarthritic Surroundings
DEFF Research Database (Denmark)
Ossendorff, Robert; Grad, Sibylle; Stoddart, Martin J
2018-01-01
BACKGROUND: Autologous chondrocyte implantation (ACI) fails in up to 20% of cases. Advanced intra-articular degeneration paired with an inflammatory environment may be closely related to implantation failure. Certain cytokines have been identified to play a major role during early osteoarthritis....... PURPOSE: To investigate the effects of tumor necrosis factor α (TNFα) and its potential inhibition by adalimumab on cartilage regeneration in an in vitro model of ACI. STUDY DESIGN: Controlled laboratory study. METHODS: Bovine articular chondrocytes were cultivated and transferred at passage 3 to fibrin...
DEFF Research Database (Denmark)
Kubosch, Eva Johanna; Heidt, Emanuel; Niemeyer, Philipp
2017-01-01
Purpose: The use of passaged chondrocytes is the current standard for autologous chondrocyte implantation (ACI). De-differentiation due to amplification and donor site morbidity are known drawbacks highlighting the need for alternative cell sources. Methods: Via clinically validated flow cytometry...... analysis, we compared the expression of human stem cell and cartilage markers (collagen type 2 (Col2), aggrecan (ACAN), CD44) of chondrocytes (CHDR), passaged chondrocytes for ACI (CellGenix™), bone marrow derived mesenchymal stem cells (BMSC), and synovial derived stem cells (SDSC). Results: Primary...
Informe Tebeosfera. La industria de la historieta en España en 2016
Directory of Open Access Journals (Sweden)
Manuel Barrero
2017-03-01
Full Text Available Informe anual de la Asociación Cultural Tebeosfera (ACyT sobre la industria española del cómic, realizado con los datos del Gran catálogo de la historieta, sobre los tebeos distribuidos en España en 2016. / Anual report of the Tebeosfera Cultural Association (ACyT about the Spanish comics industry, based on the data from the Gran Catálogo de la Historieta (Spanish greatest comics catalog for all the titles distributed in Spain in 2016.
Informe Tebeosfera 2014. La industria de la historieta en España en 2014
Directory of Open Access Journals (Sweden)
Manuel Barrero
2015-02-01
Full Text Available Informe anual de la Asociación Cultural Tebeosfera (ACyT sobre la industria española del cómic, realizado con los datos del Gran catálogo de la historieta, sobre los tebeos distribuidos en España en 2014. Anual report of the Tebeosfera Cultural Association (ACyT about the Spanish comics industry, based on the data from the Gran Catálogo de la Historieta (Spanish greatest comics catalog for all the titles distributed in Spain in 2014.
Informe Tebeosfera. La industria de la historieta en España en 2017
Directory of Open Access Journals (Sweden)
Manuel Barrero
2018-04-01
Full Text Available Informe anual de la Asociación Cultural Tebeosfera (ACyT sobre la industria española del cómic, realizado con los datos del Gran catálogo de la historieta, sobre los tebeos distribuidos en España en 2017. / Anual report of the Tebeosfera Cultural Association (ACyT about the Spanish comics industry, based on the data from the Gran Catálogo de la Historieta (Spanish greatest comics catalog for all the titles distributed in Spain in 2017.
Impact of Trace Minerals on Wound Healing of Footpad Dermatitis in Broilers.
Chen, Juxing; Tellez, Guillermo; Escobar, Jeffery; Vazquez-Anon, Mercedes
2017-05-15
Footpad dermatitis (FPD) is used in the poultry industry as an animal welfare criterion to determine stocking density. Trace minerals (TM) play a role in skin integrity and wound healing. This study evaluated the impact of TM on FPD and consisted of 3 treatments supplemented with 0 (NTM), low (LTM) and high (HTM) TM levels in the same basal diet. On d21, 71% birds in all treatments developed mild FPD and pens were top-dressed with dry litter to promote FPD healing. Compared to NTM, LTM reduced area under the curve (AUC) of FPD lesion scores during d21-42, HTM reduced the AUC of FPD lesion scores during d7-21 and d21-42. LTM improved growth performance on d14, HTM improved growth performance on d14 and d28. LTM and/or HTM increased gene expression of VEGF, TIMP3, TIMP4, MMP13, ITGA2, ITGA3 and CD40, which promoted collagen synthesis, deposition and organization; cell migration, matrix remodeling, and angiogenesis. LTM and/or HTM increased inflammation by upregulating TNFα and IL-1β during the early wound healing phase and reduced inflammation by downregulating IL-1β during the late wound healing phase. Our findings showed that TM not only improved growth performance but also reduced FPD development by promoting FPD wound healing.
Online credit card fraud prediction based on hierarchical temporal ...
African Journals Online (AJOL)
This understanding gave birth to the Hierarchical Temporal Memory (HTM) which holds a lot of promises in the area of time-series prediction and anomaly detection problems. This paper demonstrates the behaviour of an HTM model with respect to its learning and prediction of online credit card fraud. The model was ...
Perry, Nicola H; Kim, Jae Jin; Tuller, Harry L
2018-01-01
We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi 0.65 Fe 0.35 O 3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe 4+ ) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The k chem values obtained by OTR were significantly lower than the AC-IS derived k chem values and k q values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in k chem and k q values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived k chem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ , and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films.
Perry, Nicola H.; Kim, Jae Jin; Tuller, Harry L.
2018-01-01
Abstract We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi0.65Fe0.35O3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe4+) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The kchem values obtained by OTR were significantly lower than the AC-IS derived kchem values and kq values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in kchem and kq values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived kchem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ, and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films. PMID:29511391
Numerical Study on Deflection Behaviour of Concrete Beams Reinforced with GFRP Bars
Mohamed, Osama A.; Khattab, Rania; Hawat, Waddah Al
2017-10-01
Fiber-Reinforced Polymer (FRP) bars are gaining popularity as sustainable alternatives to conventional reinforcing steel bars in reinforced concrete applications. The production of FRP bars has lower environmental impact compared to steel reinforcing bars. In addition, the non-corroding FRP materials can potentially decrease the cost or need for maintenance of reinforced concrete structural elements, especially in harsh environmental conditions that can impact both concrete and reinforcement. FRP bars offer additional favourable properties including high tensile strength and low unit weight. However, the mechanical properties of FRP bars can lead to large crack widths and deflections. The objective of this study is to investigate the deflection behaviour of concrete beams reinforced with Glass FRP (GFRP) bars as a longitudinal main reinforcement. Six concrete beams reinforced with GFRP bars were modelled using the finite element computer program ANSYS. The main variable considered in the study is the reinforcement ratio. The deflection equations in current North American codes including ACI 440.1R-06, ACI 440.1R-15 and CSA S806-12 are used to compute deflections, and these are compared to numerical results. It was concluded in this paper that deflections predicted by ACI 440.1R-06 equations are lower than the numerical analysis results while ACI 440.1R-15 is in agreement with numerical analysis with tendency to be conservative. The values of deflections estimated by CSA S806-12 formulas are consistent with results of numerical analysis.
Lifescience Database Archive (English)
Full Text Available CGKLSYEIQKAPKKEKIQPYPIIQRV VPELSKAEILKIVPLVTDWINKSNTTANIEKIAKIY*ciilmilkt**ksatcntynik* Translated Amino Aci...PSVCFVTLPLDLYETNGLTLSGEIVECGKLSYEIQKAPKKEKIQPYPIIQRV VPELSKAEILKIVPLVTDWINKSNTTANIEKIAKIY*ciilmilkt**ksatcnt
Nuclear Hell On Wheels Examining The Need For A Mobile ICBM
2015-02-17
ICBMs," Dec 1980, 65. 13 Department of State, "The New START Treaty," 22 Oct 2013. http://www.state.gov/t/ avc /rls/215726.htm (accessed 21 Nov 2014...http://www.state.gov/t/ avc /rls/215726.htm (accessed 21 Nov 2014) Feickert, Andrew. "Missile Survey; Ballistic and Cruise Missiles of Foreign
2010-05-10
... available on the NICEATM-ICCVAM Web site at http://iccvam.niehs.nih.gov/methods/immunotox/rLLNA.htm and http... ICCVAM Test Method Evaluation Reports, which are available on the NICEATM-ICCVAM Web site at http://iccvam.niehs.nih.gov/methods/immunotox/LLNA-LD/TMER.htm and http://iccvam.niehs.nih.gov/methods/immunotox...
Informe Tebeosfera 2015. La industria de la historieta en España en 2015
Directory of Open Access Journals (Sweden)
Manuel Barrero
2016-05-01
Full Text Available Informe anual de la Asociación Cultural Tebeosfera (ACyT sobre la industria española del cómic, realizado con los datos del Gran catálogo de la historieta, sobre los tebeos distribuidos en España en 2015. Anual report of the Tebeosfera Cultural Association (ACyT about the Spanish comics industry, based on the data from the Gran catálogo de la historieta (the main comics catalog in Spain for all the titles distributed in Spain in 2015.
Towards a mathematical theory of cortical micro-circuits.
Directory of Open Access Journals (Sweden)
Dileep George
2009-10-01
Full Text Available The theoretical setting of hierarchical Bayesian inference is gaining acceptance as a framework for understanding cortical computation. In this paper, we describe how Bayesian belief propagation in a spatio-temporal hierarchical model, called Hierarchical Temporal Memory (HTM, can lead to a mathematical model for cortical circuits. An HTM node is abstracted using a coincidence detector and a mixture of Markov chains. Bayesian belief propagation equations for such an HTM node define a set of functional constraints for a neuronal implementation. Anatomical data provide a contrasting set of organizational constraints. The combination of these two constraints suggests a theoretically derived interpretation for many anatomical and physiological features and predicts several others. We describe the pattern recognition capabilities of HTM networks and demonstrate the application of the derived circuits for modeling the subjective contour effect. We also discuss how the theory and the circuit can be extended to explain cortical features that are not explained by the current model and describe testable predictions that can be derived from the model.
Official News relating to CERN Safety Rules
HSE Unit
2015-01-01
The CERN Safety Rules listed below have been published on the HSE website (see here) and entered into force on the 9 June 2015: Safety Regulation SR-M “Mechanical equipment”: http://cern.ch/safety-rules/SR-M_ENv2.htm; this SR-M (version 2) cancels and replaces SR-M (version 1) and the corresponding provisions of General Safety Instruction GSI-M3 “Special Equipment” (version 1). General Safety Instruction GSI-M-1 “Lifting equipment and accessories”: http://cern.ch/safety-rules/GSI-M-1_ENv2.htm; this GSI-M-1 (version 2) cancels and replaces GSI-M1 (version 1). Specific Safety Instruction SSI-M-1-1 “Slings and lifting chains”: http://cern.ch/safety-rules/SSI-M-1-1_EN.htm; Specific Safety Instruction SSI-M-1-2 “Cranes, bridge cranes, gantry cranes and power-driven hoists”: http://cern.ch/safety-rules/SSI-M-1-2_EN.htm; Specific Safety Instruction SSI-M-1-3 “Non-f...
Directory of Open Access Journals (Sweden)
Dao P-L.
2012-09-01
Full Text Available Les laitiers d’aciérie de conversion (LAC sont les résidus de la transformation de la fonte en acier. Ces produits abondants (plus de 2 millions de tonnes/an en France sont peu valorisés en génie civil car ils contiennent de la chaux libre qui, en s’hydratant, cause des expansions souvent conséquentes. Un outil pour leur utilisation dans les mélanges granulaires routiers a été développé. Il est basé sur deux modèles paramétriques décrivant, l’un le taux de grains dégradés en milieu aqueux à température et à âge donnés en fonction de la teneur en chaux libre, de la taille et de la structure des grains, l’autre l’expansion volumique d’empilements granulaires, purs ou mélangés à des granulats inertes, soumis à un flux de vapeur. La combinaison de ces deux modèles avec le Modèle d’Empilement Compressible du LCPC permet alors de prédire la cinétique de l’expansion d’un mélange granulaire quelconque, et de désigner des mélanges optimisés en termes de granularité et de proportions, incorporant des LAC, pour un usage spécifié par une expansion tolérée à une échéance et dans un environnement donnés. BOF Slags are residues of the transformation of melting steel. These abundant products (more than 2 million tonnes per year in France are little valued in civil engineering because they contain free lime which, by hydrating, cause often substantial expansions. A tool for use in road granular mixtures has been developed. It is based on two parametric models describing; i the rate of grain degraded in water at temperature and age given, in function of the content of free lime, the size and the structure of the grain, ii the expansion of the packing granular, pure or mixed with inert aggregates, exposed to a flow of steam. The combination of these two models with the Compressible Packing Model of LCPC allows then the prediction of the kinetics of expansion of a granular mixture, and the designation of
International Nuclear Information System (INIS)
Tsushima, Motoo; Fujii, Shigeki; Yutani, Chikao; Yamamoto, Akira; Naitoh, Hiroaki.
1990-01-01
We evaluated the wall thickening and stenosis rate (ASI), the calcification rate (ACI), and the wall thickening and calcification stenosis rate (SCI) of the lower abdominal aorta calculated by the 12 sector method from simple or enhanced computed tomography. The intra-observer variation of the calculation of ASI was 5.7% and that of ACI was 2.4%. In 9 patients who underwent an autopsy examination, ACI was significantly correlated with the rate of the calcification dimension to the whole objective area of the abdominal aorta (r=0.856, p<0.01). However, there were no correlations between ASI and the surface involvement or the atherosclerotic index obtained by the point-counting method of the autopsy materials. In the analysis of 40 patients with atherosclerotic vascular diseases, ASI and ACI were also highly correlated with the percentage volume of the arterial wall in relation to the whole volume of the observed artery (r=0.852, p<0.0001) and also the percentage calcification volume (r=0.913, p<0.0001) calculated by the computed method, respectively. The percentage of atherosclerotic vascular diseases increased in the group of both high ASI (over 10%) and high ACI (over 20%). We used SCI as a reliable index when the progression and regression of atherosclerosis was considered. Among patients of hypercholesterolemia consisting of 15 with familial hypercholesterolemia (FH) and 6 non-FH patients, the change of SCI (d-SCI) was significantly correlated with the change of total cholesterol concentration (d-TC) after the treatment (r=0.466, p<0.05) and the change of the right Achilles' tendon thickening (d-ATT) was also correlated with d-TC (r=0.634, p<0.005). However, no correlation between d-SCI and d-ATT was observed. In conclusion, CT indices of atherosclerosis were useful as a noninvasive quantitative diagnostic method and we were able to use them to assess the progression and regression of atherosclerosis. (author)
International Nuclear Information System (INIS)
Ding, Lina; Zhao, Yang; Warren, Christopher L; Sullivan, Ruth; Eliceiri, Kevin W; Shull, James D
2013-01-01
We are using ACI and BN rats, which differ markedly in their susceptibility to 17β-estradiol (E2)-induced mammary cancer, to identify genetic variants and environmental factors that determine mammary cancer susceptibility. The objective of this study was to characterize the cellular and molecular responses to E2 in the mammary glands of ACI and BN rats to identify qualitative and quantitative phenotypes that associate with and/or may confer differences in susceptibility to mammary cancer. Female ACI and BN rats were treated with E2 for 1, 3 or 12 weeks. Mammary gland morphology and histology were examined by whole mount and hematoxylin and eosin (H&E) staining. Cell proliferation and epithelial density were evaluated by quantitative immunohistochemistry. Apoptosis was evaluated by quantitative western blotting and flow cytometry. Mammary gland differentiation was examined by immunohistochemistry. Gene expression was evaluated by microarray, qRT-PCR and quantitative western blotting assays. Extracellular matrix (ECM) associated collagen was evaluated by Picrosirius Red staining and Second Harmonic Generation (SHG) microscopy. The luminal epithelium of ACI rats exhibited a rapid and sustained proliferative response to E2. By contrast, the proliferative response exhibited by the mammary epithelium of BN rats was restrained and transitory. Moreover, the epithelium of BN rats appeared to undergo differentiation in response to E2, as evidenced by production of milk proteins as well as luminal ectasia and associated changes in the ECM. Marked differences in expression of genes that encode proteins with well-defined roles in mammary gland development (Pgr, Wnt4, Tnfsf11, Prlr, Stat5a, Areg, Gata3), differentiation and milk production (Lcn2, Spp1), regulation of extracellular environment (Mmp7, Mmp9), and cell-cell or cell-ECM interactions (Cd44, Cd24, Cd52) were observed. We propose that these cellular and molecular phenotypes are heritable and may underlie, at least in
Zhang, Jinbao; Xu, Bo; Johansson, Malin B; Vlachopoulos, Nick; Boschloo, Gerrit; Sun, Licheng; Johansson, Erik M J; Hagfeldt, Anders
2016-07-26
The hole transporting material (HTM) is an essential component in perovskite solar cells (PSCs) for efficient extraction and collection of the photoinduced charges. Triphenylamine- and carbazole-based derivatives have extensively been explored as alternative and economical HTMs for PSCs. However, the improvement of their power conversion efficiency (PCE), as well as further investigation of the relationship between the chemical structure of the HTMs and the photovoltaic performance, is imperatively needed. In this respect, a simple carbazole-based HTM X25 was designed on the basis of a reference HTM, triphenylamine-based X2, by simply linking two neighboring phenyl groups in a triphenylamine unit through a carbon-carbon single bond. It was found that a lowered highest occupied molecular orbital (HOMO) energy level was obtained for X25 compared to that of X2. Besides, the carbazole moiety in X25 improved the molecular planarity as well as conductivity property in comparison with the triphenylamine unit in X2. Utilizing the HTM X25 in a solar cell with mixed-ion perovskite [HC(NH2)2]0.85(CH3NH3)0.15Pb(I0.85Br0.15)3, a highest reported PCE of 17.4% at 1 sun (18.9% under 0.46 sun) for carbazole-based HTM in PSCs was achieved, in comparison of a PCE of 14.7% for triphenylamine-based HTM X2. From the steady-state photoluminescence and transient photocurrent/photovoltage measurements, we conclude that (1) the lowered HOMO level for X25 compared to X2 favored a higher open-circuit voltage (Voc) in PSCs; (2) a more uniform formation of X25 capping layer than X2 on the surface of perovskite resulted in more efficient hole transport and charge extraction in the devices. In addition, the long-term stability of PSCs with X25 is significantly enhanced compared to X2 due to its good uniformity of HTM layer and thus complete coverage on the perovskite. The results provide important information to further develop simple and efficient small molecular HTMs applied in solar cells.
Karthikeyan, Obulisamy Parthiba; Selvam, Ammaiyappan; Wong, Jonathan W C
2016-01-01
The use of conventional continuous stirred tank reactor (CSTR) can affect the methane (CH4) recovery in a two-stage anaerobic digestion of food waste (FW) due to carbon short circuiting in the hydrolysis-acidogenesis (Hy-Aci) stage. In this research, we have designed and tested a solid-liquid-separating CSTR (SLS-CSTR) for effective Hy-Aci of FW. The working conditions were pH 6 and 9 (SLS-CSTR-1 and -2, respectively); temperature-37°C; agitation-300rpm; and organic loading rate (OLR)-2gVSL(-1)day(-1). The volatile fatty acids (VFA), enzyme activities and bacterial population (by qPCR) were determined as test parameters. Results showed that the Hy-Aci of FW at pH 9 produced ∼35% excess VFA as compared to that at pH 6, with acetic and butyric acids as major precursors, which correlated with the high enzyme activities and low lactic acid bacteria. The design provided efficient solid-liquid separation there by improved the organic acid yields from FW. Copyright © 2015 Elsevier Ltd. All rights reserved.
Strut elaboration in strut-and-tie model
Directory of Open Access Journals (Sweden)
Mohammad PANJEHPOUR
2012-12-01
Full Text Available The Strut-and-Tie Model (STM has been incorporated into the codes and standards because of its consistency and rationality since last decade. However, it has encountered few challenges whilst its implementation. The effective compressive strength of strut has been a complex issue among researchers since emergence of STM. This review serves as a base for future developments of STM. It addresses several ways towards enhancing our understanding of strut performance in the STM. It also throws up questions for further investigation of effective compressive strength of strut in the STM. This review is confined to the evaluation of strut effectiveness factor based on the available codes and standards particularly AASHTO LRFD and ACI 318-08. According to the example given in this paper, there is sometimes a marked difference of approximately 50% between strut effectiveness factor recommended by AASHTO LRFD and ACI 318-08. More broadly, research is needed to determine which of the complicated strut effectiveness factor recommended by AASHTO LRFD and the simple one recommended by ACI 318-08 is optimum.
Kreuz, Peter Cornelius; Kalkreuth, Richard Horst; Niemeyer, Philipp; Uhl, Markus; Erggelet, Christoph
Autologous chondrocyte implantation (ACI) is a first-line treatment option for large articular cartilage defects. Although well-established for cartilage defects in the knee, studies of the long-term outcomes of matrix-assisted ACI to treat cartilage defects in the ankle are rare. In the present report, we describe for the first time the long-term clinical and radiologic results 12 years after polymer-based matrix-assisted ACI treat a full-thickness talar cartilage defect in a 25-year-old male patient. The clinical outcome was assessed using the visual analog scale and Freiburg ankle score, magnetic resonance imaging evaluation using the Henderson-Kreuz scoring system and T2 mapping. Clinical assessment revealed improved visual analog scale and Freiburg ankle scores. The radiologic analysis and T2 relaxation time values indicated the formation of hyaline-like repair tissue. Polymer-based autologous chondrocytes has been shown to be a safe and clinically effective long-term treatment of articular cartilage defects in the talus. Copyright © 2017 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.
Zhou, Quan; Liu, Lijun; Hu, Jiashun
2018-05-01
In the version of this Article originally published, data points representing mafic eruptions were missing from Fig. 4b, the corrected version is shown below. Furthermore, the authors omitted to include the following acknowledgements to the provider of the computational resources: "This research is part of the Blue Waters sustained-petascale computing project, which is supported by the National Science Foundation (awards OCI-0725070 and ACI-1238993) and the state of Illinois. Blue Waters is a joint effort of the University of Illinois at Urbana-Champaign and its National Center for Supercomputing Applications. This work is also part of the `PRAC Title 4-D Geodynamic Modeling With Data Assimilation: Origin Of Intra-Plate Volcanism In The Pacific Northwest' PRAC allocation support by the National Science Foundation (award number ACI 1516586). This work also used the Extreme Science and Engineering Discovery Environment (XSEDE), which is supported by National Science Foundation grant number ACI-1548562." Figure 4 and the Acknowledgements section have been updated in the online version of the Article.
A District Approach to Countering Afghanistan’s Insurgency
2009-12-01
actualization. Abraham Maslow , A Theory of Human Motivation, 1943, http://psychclassics.yorku.ca/ Maslow /motivation.htm (accessed October 29, 2009...Lyon Press, 2002. Maslow , Abraham . A Theory of Human Motivation, 1943. http://psychclassics.yorku.ca/ Maslow /motivation.htm (accessed October 29...established village and district political hierarchies may effectively deny insurgents sanctuary, critical resources, and serve to isolate and separate the
Blending social and economic goal in career guidance
DEFF Research Database (Denmark)
Plant, Peter
Økonomiske og sociale mål i vejledning: Sufficient Economy og Gross National Happiness. Se under Papers, Theme Syntheses http://www.is2007scotland.org.uk/prepare.htm......Økonomiske og sociale mål i vejledning: Sufficient Economy og Gross National Happiness. Se under Papers, Theme Syntheses http://www.is2007scotland.org.uk/prepare.htm...
Performance of planar heterojunction perovskite solar cells under light concentration
Directory of Open Access Journals (Sweden)
Aaesha Alnuaimi
2016-11-01
Full Text Available In this work, we present 2D simulation of planar heterojunction perovskite solar cells under high concentration using physics-based TCAD. The performance of planar perovskite heterojunction solar cells is examined up to 1000 suns. We analyze the effect of HTM mobility and band structure, surface recombination velocities at interfaces and the effect of series resistance under concentrated light. The simulation results revealed that the low mobility of HTM material limits the improvement in power conversation efficiency of perovskite solar cells under concentration. In addition, large band offset at perovskite/HTM interface contributes to the high series resistance. Moreover, losses due to high surface recombination at interfaces and the high series resistance deteriorate significantly the performance of perovskite solar cells under concentration.
Coronary blood flow and thallium 201 uptake in rejecting rat heart transplantations
International Nuclear Information System (INIS)
Bergsland, J.; Hwang, K.; Driscoll, R.; Carr, E.A.; Wright, J.R.; Curran-Everett, D.C.; Carroll, M.; Krasney, E.; Krasney, J.A.
1989-01-01
The effects of rejection on coronary flow (CAF) in heart allografts are unclear, although previous evidence with cardiac imaging agents indicates impaired flow during advanced rejection. The purpose of this study was to measure CAF in heterotopically placed heart grafts. Lewis rats (LEW) received grafts from either syngeneic Lewis rats (LEW/LEW group) or allogeneic ACI rats (ACI/LEW group). CAF was measured in both the transplanted and native hearts with radiolabeled microspheres. Rejection was measured histologically (grades 0 [absent] to 4+ [severe]). In addition systemic blood pressure and cardiac outputs of the native hearts were determined with microspheres. Different animals were studied during relatively early (4 days) and late (6 days) rejection. Among the 4-day animals a cyclosporine-treated group was included (ACI/LEW CyA). In 6-day rats CAF in allografts was lower (0.56 +/- .06 ml/gm/min) compared with syngeneic grafts (1.72 +/- 0.4 ml/gm/min) (p less than 0.05). The CAF in the native hearts did not differ significantly but was higher than in the grafts in both groups. Heart rates were reduced in allografts (p less than 0.05). It is interesting that arterial pressure and cardiac output were significantly lower in animals bearing allogeneic than syngeneic grafts. In rats studied at 4 days graft CAF was lower than in the native heart in both the LEW/LEW and ACI/LEW groups, but there was no significant difference in behavior between groups. The same was true for a cyclosporine-treated group. Graft heart rates were similar in all 4-day rats
Directory of Open Access Journals (Sweden)
Jeffrey R Shearstone
Full Text Available Therapeutic intervention aimed at reactivation of fetal hemoglobin protein (HbF is a promising approach for ameliorating sickle cell disease (SCD and β-thalassemia. Previous studies showed genetic knockdown of histone deacetylase (HDAC 1 or 2 is sufficient to induce HbF. Here we show that ACY-957, a selective chemical inhibitor of HDAC1 and 2 (HDAC1/2, elicits a dose and time dependent induction of γ-globin mRNA (HBG and HbF in cultured primary cells derived from healthy individuals and sickle cell patients. Gene expression profiling of erythroid progenitors treated with ACY-957 identified global changes in gene expression that were significantly enriched in genes previously shown to be affected by HDAC1 or 2 knockdown. These genes included GATA2, which was induced greater than 3-fold. Lentiviral overexpression of GATA2 in primary erythroid progenitors increased HBG, and reduced adult β-globin mRNA (HBB. Furthermore, knockdown of GATA2 attenuated HBG induction by ACY-957. Chromatin immunoprecipitation and sequencing (ChIP-Seq of primary erythroid progenitors demonstrated that HDAC1 and 2 occupancy was highly correlated throughout the GATA2 locus and that HDAC1/2 inhibition led to elevated histone acetylation at well-known GATA2 autoregulatory regions. The GATA2 protein itself also showed increased binding at these regions in response to ACY-957 treatment. These data show that chemical inhibition of HDAC1/2 induces HBG and suggest that this effect is mediated, at least in part, by histone acetylation-induced activation of the GATA2 gene.
Modeling Contamination Migration on the Chandra X-Ray Observatory - III
O'Dell, Stephen L.; Swartz, Douglas A.; Tice, Neil W.; Plucinsky, Paul P.; Grant, Catherine E.; Marshall, Herman L.; Vikhlinin, Alexy A.; Tennant, Allyn F.; Dahmer, Matthew T.
2015-01-01
During its first 16 years of operation, the cold (about -60 C) optical blocking filter of the Advanced CCD Imaging Spectrometer (ACIS), aboard the Chandra X-ray Observatory, has accumulated a growing layer of molecular contamination that attenuates low-energy x rays. Over the past few years, the accumulation rate, spatial distribution, and composition have changed. This evolution has motivated further analysis of contamination migration within and near the ACIS cavity, in part to evaluate potential bake-out scenarios intended to reduce the level of contamination. Keywords: X-ray astronomy, CCDs, contamination, modeling and simulation, spacecraft operations
I Sistemi Intelligenti di Trasporto per una mobilità più sicura e sostenibile
Directory of Open Access Journals (Sweden)
Francesco Mazzone
2008-03-01
Full Text Available Intelligent Transportation Systems for a safer and more sustainable mobilityACI's (Automobile Club d'Italia work on the development of solutions to enhance road security and promote sustainable mobility has been going on for decades, and it still is. The contribution of ACI to this GEOmedia special issue is vital in terms of experience and know-how: the different application fields in which the association operates are useful to synthesize the actual difficulties in the world of mobility, and to underline the important role of new technologies in order to solve these issues.
Sindromi prenaprezanja u šaci, podlaktici i laktu
Bilić, Ranko; Kolundžić, Robert; Jelić, Mislav
2002-01-01
Primarna uloga čitavoga gornjeg ekstremiteta, tj. ramena, nadlaktice, lakta, podlaktice i ručnog zgloba jest postavljanje šake u prikladan položaj za obavljanje nekog rada, a kao krajnji dio ruke istodobno je i osjetni organ. Kompleksna anatomija šake izražava obje funkcije koje su temeljne u čovjekovoj komunikaciji s okolinom. Zbog toga vrlo su učestale akutne ozljede i kronična oštećenja (hrskavica, mišić, tetiva, kost ili živac), odnosno sindromi prenaprezanja u području šake i drugih dije...
Addressing the Big-Earth-Data Variety Challenge with the Hierarchical Triangular Mesh
Rilee, Michael L.; Kuo, Kwo-Sen; Clune, Thomas; Oloso, Amidu; Brown, Paul G.; Yu, Honfeng
2016-01-01
We have implemented an updated Hierarchical Triangular Mesh (HTM) as the basis for a unified data model and an indexing scheme for geoscience data to address the variety challenge of Big Earth Data. We observe that, in the absence of variety, the volume challenge of Big Data is relatively easily addressable with parallel processing. The more important challenge in achieving optimal value with a Big Data solution for Earth Science (ES) data analysis, however, is being able to achieve good scalability with variety. With HTM unifying at least the three popular data models, i.e. Grid, Swath, and Point, used by current ES data products, data preparation time for integrative analysis of diverse datasets can be drastically reduced and better variety scaling can be achieved. In addition, since HTM is also an indexing scheme, when it is used to index all ES datasets, data placement alignment (or co-location) on the shared nothing architecture, which most Big Data systems are based on, is guaranteed and better performance is ensured. Moreover, our updated HTM encoding turns most geospatial set operations into integer interval operations, gaining further performance advantages.
Continuous Online Sequence Learning with an Unsupervised Neural Network Model.
Cui, Yuwei; Ahmad, Subutar; Hawkins, Jeff
2016-09-14
The ability to recognize and predict temporal sequences of sensory inputs is vital for survival in natural environments. Based on many known properties of cortical neurons, hierarchical temporal memory (HTM) sequence memory recently has been proposed as a theoretical framework for sequence learning in the cortex. In this letter, we analyze properties of HTM sequence memory and apply it to sequence learning and prediction problems with streaming data. We show the model is able to continuously learn a large number of variableorder temporal sequences using an unsupervised Hebbian-like learning rule. The sparse temporal codes formed by the model can robustly handle branching temporal sequences by maintaining multiple predictions until there is sufficient disambiguating evidence. We compare the HTM sequence memory with other sequence learning algorithms, including statistical methods: autoregressive integrated moving average; feedforward neural networks-time delay neural network and online sequential extreme learning machine; and recurrent neural networks-long short-term memory and echo-state networks on sequence prediction problems with both artificial and real-world data. The HTM model achieves comparable accuracy to other state-of-the-art algorithms. The model also exhibits properties that are critical for sequence learning, including continuous online learning, the ability to handle multiple predictions and branching sequences with high-order statistics, robustness to sensor noise and fault tolerance, and good performance without task-specific hyperparameter tuning. Therefore, the HTM sequence memory not only advances our understanding of how the brain may solve the sequence learning problem but is also applicable to real-world sequence learning problems from continuous data streams.
Adding Nonlinear Tools to the Strategist’s Toolbox
2001-06-01
between interests. Idealists base their arguments on the pioneers like Hugo Grotius (1583-1645) and Immanuel Kant (1724-1804). The Idealist school based...12Blupete, [website]: available from http://www.blupete.com/Literature/ Biographies / Philosophy/Popper.htm; Internet. 13Glesne and Peshkin, 24. 39...www.blupete.com/Literature/ Biographies / Philosophy/Popper.htm. Internet. Dean Robbins, Brent. Mythos and Logos. Available from http://www.geocities.com/ Athens
Institute of Scientific and Technical Information of China (English)
宋志浩; 王世荣; 肖殷; 李祥高
2015-01-01
钙钛矿太阳能电池是一种全新的全固态薄膜电池.报道的能量转换效率已提高到19.3%,成为可再生能源领域的热点研究方向.空穴传输材料是构成高效钙钛矿太阳能电池的重要组分之一.本文介绍了钙钛矿太阳能电池的基本结构,对空穴传输材料的分子结构、能级水平和迁移率等对电池性能的影响进行了详细的总结和评述.%Perovskite solar cells with a solid-state thin film structure have attracted great attention in recent years due to their simple structure, low production cost and superb photovoltaic performance. Because of the boost in power conversion efficiency (PCE) in short intervals from 3.8% to 19.3% at present, this hybrid cells have been considered as the next generation photovoltaic devices. It is expected that the efficiencies of individual devices could ultimately achieve 25%, which is comparable to the single-crystal silicon solar cell. In this article, the perovskite absorber, its basic device structure, and operating principles are briefly introduced. Since most of the high efficiency perovskite solar cells employ hole transporting materials (HTM), they could benefit the hole transport and improve the metal-semiconductor interface in the cells. This perspective gives analyses of some effective hole transporting materials for perovskite solar cell application. The hole transporting materials used in perovskite solar cell are classified into six categories according to their structures, including triphenylamine-based small molecule HTM, small molecule HTM containing N atom, sulfur-based small molecule HTM, sulfur-based polymer HTM, polymer HTM containing N atom and inorganic HTM. Emphasis is placed on the interplay of molecular structures, energy levels, and charge carrier mobility as well as device parameters. A critial look at various approaches applied to achieve desired materials and device performance is provided to assist in the identification of
Boyer, Stéphane; Ikeda, Takayoshi; Lefort, Marie-Caroline; Malumbres-Olarte, Jagoba; Schmidt, Jason M
2017-01-01
Deciphering the amount of work provided by different co-authors of a scientific paper has been a recurrent problem in science. Despite the myriad of metrics available, the scientific community still largely relies on the position in the list of authors to evaluate contributions, a metric that attributes subjective and unfounded credit to co-authors. We propose an easy to apply, universally comparable and fair metric to measure and report co-authors contribution in the scientific literature. The proposed Author Contribution Index (ACI) is based on contribution percentages provided by the authors, preferably at the time of submission. Researchers can use ACI to compare the contributions of different authors, describe the contribution profile of a particular researcher or analyse how contribution changes through time. We provide such an analysis based on contribution percentages provided by 97 scientists from the field of ecology who voluntarily responded to an online anonymous survey. ACI is simple to understand and to implement because it is based solely on percentage contributions and the number of co-authors. It provides a continuous score that reflects the contribution of one author as compared to the average contribution of all other authors. For example, ACI(i) = 3, means that author i contributed three times more than what the other authors contributed on average. Our analysis comprised 836 papers published in 2014-2016 and revealed patterns of ACI values that relate to career advancement. There are many examples of author contribution indices that have been proposed but none has really been adopted by scientific journals. Many of the proposed solutions are either too complicated, not accurate enough or not comparable across articles, authors and disciplines. The author contribution index presented here addresses these three major issues and has the potential to contribute to more transparency in the science literature. If adopted by scientific journals, it
International Nuclear Information System (INIS)
Jin, Guang-Zhi; Cong, Wen-Ming; Wu, Meng-Chao; Dong, Hui; Yu, Wen-Long; Li, Yan; Lu, Xin-Yuan; Yu, Hua; Xian, Zhi-Hong; Dong, Wei; Liu, Yin-Kun
2013-01-01
Differential diagnosis of high-grade dysplastic nodules (HGDN) and well-differentiated hepatocellular carcinoma (WDHCC) represents a challenge to experienced hepatic clinicians, radiologists and hepatopathologists. The expression profiles of aminoacylase-1 (ACY1), sequestosome-1 (SQSTM1) and glypican-3 (GPC3) in low-grade dysplastic nodules (LGDN), HGDN and WDHCC were assessed by immunohistochemistry. The differential diagnostic performances of these three markers alone and in combination for HGDN and WDHCC were investigated by logistic regression models (HGDN = 21; WDHCC = 32) and validated in an independent test set (HGDN, n = 21; WDHCC n = 24). Postoperative overall survival and time to recurrence were evaluated by univariate and multivariate analyses in an independent set of 500 patients. ACY1, SQSTM1 and GPC3 were differentially expressed in each group. For the differential diagnosis of WDHCC from HGDN, the sensitivity and specificity of the combination of ACY1 + SQSTM1 + GPC3 for detecting WDHCC were 93.8% and 95.2% respectively in the training set, which were higher than any of the three two-marker combinations. The validities of the four diagnostic models were further confirmed in an independent test set, and corresponding good sensitivity and specificity were observed. Interestingly, GPC3 expression in HCC tissues combined with serum α-fetoprotein (AFP) was found to be an independent predictor for overall survival and time to recurrence. ACY1 + SQSTM1 + GPC3 combination represents a potentially valuable biomarker for distinguishing between WDHCC and HGDN using immunohistochemistry. Meanwhile, low GPC3 staining combined with positive serum AFP may play a practical role in predicting poor postoperative outcome and high tumor recurrence risk
Schuster, André; Tisch, Doris; Seidl-Seiboth, Verena; Kubicek, Christian P.
2012-01-01
The cyclic AMP (cAMP) pathway represents a central signaling cascade with crucial functions in all organisms. Previous studies of Trichoderma reesei (anamorph of Hypocrea jecorina) suggested a function of cAMP signaling in regulation of cellulase gene expression. We were therefore interested in how the crucial components of this pathway, adenylate cyclase (ACY1) and cAMP-dependent protein kinase A (PKA), would affect cellulase gene expression. We found that both ACY1 and PKA catalytic subunit 1 (PKAC1) are involved in regulation of vegetative growth but are not essential for sexual development. Interestingly, our results showed considerably increased transcript abundance of cellulase genes in darkness compared to light (light responsiveness) upon growth on lactose. This effect is strongly enhanced in mutant strains lacking PKAC1 or ACY1. Comparison to the wild type showed that ACY1 has a consistently positive effect on cellulase gene expression in light and darkness, while PKAC1 influences transcript levels of cellulase genes positively in light but negatively in darkness. A function of PKAC1 in light-modulated cellulase gene regulation is also reflected by altered complex formation within the cel6a/cbh2 promoter in light and darkness and in the absence of pkac1. Analysis of transcript levels of cellulase regulator genes indicates that the regulatory output of the cAMP pathway may be established via adjustment of XYR1 abundance. Consequently, both adenylate cyclase and protein kinase A are involved in light-modulated cellulase gene expression in T. reesei and have a dampening effect on the light responsiveness of this process. PMID:22286997
Stein, Spencer; Strauss, Eric; Bosco, Joseph
2013-01-01
The purpose of this review is to gain insight into the latest methods of articular cartilage implantation (ACI) and to detail where they are in the Food and Drug Administration approval and regulatory process. A PubMed search was performed using the phrase "Autologous Chondrocyte Implantation" alone and with the words second generation and third generation. Additionally, clinicaltrials.gov was searched for the names of the seven specific procedures and the parent company websites were referenced. Two-Stage Techniques: BioCart II uses a FGF2v1 culture and a fibrinogen, thrombin matrix, whereas Hyalograft-C uses a Hyaff 11 matrix. MACI uses a collagen I/III matrix. Cartipatch consists of an agarose-alginate hydrogel. Neocart uses a high-pressure bioreactor for culturing with a type I collagen matrix. ChondroCelect makes use of a gene expression analysis to predict chondrocyte proliferation and has demonstrated significant clinical improvement, but failed to show superiority to microfracture in a phase III trial. One Step Technique: CAIS is an ACI procedure where harvested cartilage is minced and implanted into a matrix for defect filling. As full thickness defects in articular cartilage continue to pose a challenge to treat, new methods of repair are being researched. Later generation ACI has been developed to address the prevalence of fibrocartilage with microfracture and the complications associated with the periosteal flap of first generation ACI such as periosteal hypertrophy. The procedures and products reviewed here represent advances in tissue engineering, scaffolds and autologous chondrocyte culturing that may hold promise in our quest to alter the natural history of symptomatic chondral disease.
2015-12-01
Sherman Kent Center, Central Intelligence Agency 3, no. 2 (October 2004), https://www.cia.gov/ library /kent-center-occasional-papers/vol3no2.htm...Naval Intelligence (Norfolk, VA: Naval Warfare Development Command, 2008), http://www.nwdc.navy.mil/content/ Library /Documents/NDPs/ ndp2/ndp20007.htm...Fathali M. Moghaddam, “ Multiculturalism and Intergroup Relations,” American Psychological Association, November 2011, 95. 114 Matherly, The Red Teaming
Veisani, Yousef; Delpisheh, Ali; Sayehmiri, Kourosh; Moradi, Ghobad; Hassanzadeh, Jafar
2017-05-01
It is recognized that socioeconomic status (SES) has a significant impact on health and wellbeing; however, the effect of SES on suicide is contested. This study explored the effect of SES in suicide deaths and decomposed inequality into its determinants to calculate relative contributions. Through a cross-sectional study, 546 suicide deaths and 6,818 suicide attempts from January 1, 2010 to December 31, 2014 in Ilam Province, Western Iran were explored. Inequality was measured by the absolute concentration index (ACI) and decomposed contributions were identified. All analyses were performed using STATA ver. 11.2 (Stata Corp., College Station, TX, USA). The overall ACI for suicide deaths was -0.352 (95% confidence interval, -0.389 to -0.301). According to the results, 9.8% of socioeconomic inequality in suicide deaths was due to addiction in attempters. ACI ranged from -0.34 to -0.03 in 2010-2014, showing that inequality in suicide deaths declined over time. Findings showed suicide deaths were distributed among the study population unequally, and our results confirmed a gap between advantaged and disadvantaged attempters in terms of death. Socioeconomic inequalities in suicide deaths tended to diminish over time, as suicide attempts progressed in Ilam Province.
Aerosols and their Impact on Radiation, Clouds, Precipitation & Severe Weather Events
Energy Technology Data Exchange (ETDEWEB)
Li, Zhanqing; Rosenfeld, Daniel; Fan, Jiwen
2017-09-22
Aerosols, the tiny particles suspended in the atmosphere, have been in the forefront of environmental and climate change sciences as the primary atmospheric pollutant and external force affecting Earth’s weather and climate. There are two dominant mechanisms by which aerosols affect weather and climate: aerosol-radiation interactions (ARI) and aerosol-cloud interactions (ACI). ARI arises from aerosol scattering and absorption, which alters the radiation budgets of the atmosphere and surface, while ACI is rooted to the fact that aerosols serve as cloud condensation nuclei and ice nuclei. Both ARI and ACI are coupled with atmospheric dynamics to produce a chain of complex interactions with a large range of meteorological variables that influence both weather and climate. Elaborated here are the impacts of aerosols on the radiation budget, clouds (microphysics, structure, and lifetime), precipitation, and severe weather events (lightning, thunderstorms, hail, and tornados). Depending on environmental variables and aerosol properties, the effects can be both positive and negative, posing the largest uncertainties in the external forcing of the climate system. This has considerably hindered our ability in projecting future climate changes and in doing accurate numerical weather predictions.
International Nuclear Information System (INIS)
Mikulicic, V.; Simic, Z.
1992-01-01
The analysis evaluates the consequences of the removal of the auto closure interlock (ACI) on the Residual Heat Removal System (RHRS) suction/isolation valves at the nuclear power plant. The deletion of the RHRS ACI is in part based on a probabilistic safety analysis (PSA) which justifies the removal based on a criterion of increased availability and reliability. Three different areas to be examined in PSA: the likelihood of an interfacing system LOCA; RHRS availability and reliability; and low temperature overpressurization control. The paper emphasizes particularly the RHRS unavailability and reliability evaluation utilizing the current control circuitry configuration and then with the proposed modification to the control circuitry. (author)
An object-oriented feature-based design system face-based detection of feature interactions
International Nuclear Information System (INIS)
Ariffin Abdul Razak
1999-01-01
This paper presents an object-oriented, feature-based design system which supports the integration of design and manufacture by ensuring that part descriptions fully account for any feature interactions. Manufacturing information is extracted from the feature descriptions in the form of volumes and Tool Access Directions, TADs. When features interact, both volumes and TADs are updated. This methodology has been demonstrated by developing a prototype system in which ACIS attributes are used to record feature information within the data structure of the solid model. The system implemented in the C++ programming language and embedded in a menu-driven X-windows user interface to the ACIS 3D Toolkit. (author)
Dynamic electronic institutions in agent oriented cloud robotic systems.
Nagrath, Vineet; Morel, Olivier; Malik, Aamir; Saad, Naufal; Meriaudeau, Fabrice
2015-01-01
The dot-com bubble bursted in the year 2000 followed by a swift movement towards resource virtualization and cloud computing business model. Cloud computing emerged not as new form of computing or network technology but a mere remoulding of existing technologies to suit a new business model. Cloud robotics is understood as adaptation of cloud computing ideas for robotic applications. Current efforts in cloud robotics stress upon developing robots that utilize computing and service infrastructure of the cloud, without debating on the underlying business model. HTM5 is an OMG's MDA based Meta-model for agent oriented development of cloud robotic systems. The trade-view of HTM5 promotes peer-to-peer trade amongst software agents. HTM5 agents represent various cloud entities and implement their business logic on cloud interactions. Trade in a peer-to-peer cloud robotic system is based on relationships and contracts amongst several agent subsets. Electronic Institutions are associations of heterogeneous intelligent agents which interact with each other following predefined norms. In Dynamic Electronic Institutions, the process of formation, reformation and dissolution of institutions is automated leading to run time adaptations in groups of agents. DEIs in agent oriented cloud robotic ecosystems bring order and group intellect. This article presents DEI implementations through HTM5 methodology.
Thomas, Linda S; Stephenson, Nancy; Swanson, Mel; Jesse, D Elizabeth; Brown, Sylvia
2013-12-01
This pilot study was conducted to determine the effectiveness of Healing Touch on anxiety, stress, pain, pain medication usage, and selected physiological measures of hospitalized adults with sickle cell disease experiencing a vaso-occlusive pain episode. Healing Touch sessions were administered for 30 minutes on four consecutive days, and the self-reported data on anxiety, stress, pain, and the selected physiological data were collected while controlling for music and presence. A parallel-group randomized control trial comparing the effects of Healing Touch with Music (HTM) to Attention Control with Music (ACM). Due to the small sample size, there were no statistically significant changes in any between-group comparisons, except for present pain on Day 4 for the ACM group. For both groups, the within-group comparison showed a nonsignificant reduction in physiological parameters, a statistically significant reduction in anxiety and stress for the ACM group after Day 4, and a statistically significant reduction in stress in the HTM group after Days 2 and 4. The pre- to postintervention reductions in present pain were greater in the HTM group across all 4 days, but the only statistically significant within groups findings were in the HTM group (p < .01) on Day 1. Further research is needed.
Improving the Long-Term Stability of Perovskite Solar Cells with a Porous Al 2 O 3 Buffer Layer
Guarnera, Simone; Abate, Antonio; Zhang, Wei; Foster, Jamie M.; Richardson, Giles; Petrozza, Annamaria; Snaith, Henry J.
2015-01-01
© 2015 American Chemical Society. Hybrid perovskites represent a new paradigm for photovoltaics, which have the potential to overcome the performance limits of current technologies and achieve low cost and high versatility. However, an efficiency drop is often observed within the first few hundred hours of device operation, which could become an important issue. Here, we demonstrate that the electrode's metal migrating through the hole transporting material (HTM) layer and eventually contacting the perovskite is in part responsible for this early device degradation. We show that depositing the HTM within an insulating mesoporous "buffer layer" comprised of Al2O3 nanoparticles prevents the metal electrode migration while allowing for precise control of the HTM thickness. This enables an improvement in the solar cell fill factor and prevents degradation of the device after 350 h of operation. (Graph Presented).
Improving the Long-Term Stability of Perovskite Solar Cells with a Porous Al 2 O 3 Buffer Layer
Guarnera, Simone
2015-02-05
© 2015 American Chemical Society. Hybrid perovskites represent a new paradigm for photovoltaics, which have the potential to overcome the performance limits of current technologies and achieve low cost and high versatility. However, an efficiency drop is often observed within the first few hundred hours of device operation, which could become an important issue. Here, we demonstrate that the electrode\\'s metal migrating through the hole transporting material (HTM) layer and eventually contacting the perovskite is in part responsible for this early device degradation. We show that depositing the HTM within an insulating mesoporous "buffer layer" comprised of Al2O3 nanoparticles prevents the metal electrode migration while allowing for precise control of the HTM thickness. This enables an improvement in the solar cell fill factor and prevents degradation of the device after 350 h of operation. (Graph Presented).
Exploiting Privacy Leaks in Mobile Advertising Networks
Terkki, Eeva
2016-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
Household water supply and sanitation development in rural Tanzania - Evaluating gendered spaces
Hyövälti, Maria
2016-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
CPTED malli osana turvallisia kaupunkiympäristöjä – Leppävaaran turvallisuus CPTED näkökulmasta
Pihlajakangas, Laura
2015-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
Measurement and Analysis of Social Networking Services: a Case Study of YouTube
Song, Xin
2013-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
Reimi, Petra
2015-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
Geometrian kaksi suurta konstruktio-ongelmaa ja niiden ratkaisut
Harju, Miija
2015-01-01
Vain tiivistelmä. Opinnäytteiden arkistokappaleet ovat luettavissa Helsingin yliopiston kirjastossa. Hae HELKA-tietokannasta (http://www.helsinki.fi/helka/index.htm). Abstract only. The paper copy of the whole thesis is available for reading room use at the Helsinki University Library. Search HELKA online catalog (http://www.helsinki.fi/helka/index.htm). Endast avhandlingens sammandrag. Pappersexemplaret av hela avhandlingen finns för läsesalsbruk i Helsingfors universitets bibliotek. S...
Substance Testing in the Fire Service: Making Public Safety a Matter of National Policy
2014-03-01
prevalence rate of certain knee, ankle , and back ailments or disabilities than office workers, no information is available to confirm they are at...archive/adastat91.htm# Anchor -6296 Title 42—The public health and welfare. Chapter 126—Equal opportunity for individuals with disabilities: Section...www.ada.gov/archive/adastat91.htm# Anchor -Sec-23240 Title 42—The public health and welfare. Chapter 126—Equal opportunity for individuals with
Changes in the Arctic: Background and Issues for Congress
2016-05-12
Representative for the Arctic,” Press Statement, John Kerry, Secretary of State, Washington, DC , July 16, 2014, accessed July 17, 2014, at http...Shared Opportunities, Challenges, and Responsibilities,” accessed September 29, 2015, at http://www.state.gov/e/oes/ocns/opa/ arc /uschair/index.htm...25, 2015, at http://www.state.gov/e/oes/ocns/opa/ arc /uschair/248957.htm. —Statement of Admiral Robert J. Papp, Jr., Special Representative for the
Autologous Chondrocyte Implantation for Bipolar Chondral Lesions in the Tibiofemoral Compartment.
Ogura, Takahiro; Bryant, Tim; Mosier, Brian A; Minas, Tom
2018-05-01
Treating bipolar chondral lesions in the tibiofemoral (TF) compartment with cartilage repair procedures is challenging, and a suitable treatment remains unclear. To evaluate clinical outcomes after autologous chondrocyte implantation (ACI) for the treatment of bipolar chondral lesions in the TF compartment. Case series; Level of evidence, 4. We evaluated 57 patients who underwent ACI for the treatment of symptomatic bipolar chondral lesions in the TF compartment by a single surgeon between October 1995 and June 2014. One patient did not return for follow-up. Thus, 56 patients (58 knees) were included with a minimum of 2 years' follow-up. A mean of 3.1 lesions per knee were treated, representing a mean total surface area of 16.1 cm 2 (range, 3.2-44.5 cm 2 ) per knee. Bipolar lesions were present in the medial compartment (32 knees) and in the lateral compartment (26 knees). Patients were evaluated with the modified Cincinnati Knee Rating Scale, visual analog scale for pain, Western Ontario and McMaster Universities Osteoarthritis Index, and Short Form-36. Patients also answered questions regarding self-rated knee function and satisfaction with the procedure. Standard radiographs were evaluated with the Kellgren-Lawrence grading system. The survival rate was 80% at 5 years and 76% at 10 years. A significantly better survival rate was found in patients with the use of a collagen membrane than periosteum (97% vs 61% at 5 years, respectively; P = .0014). Of 46 knees with retained grafts, all functional scores significantly improved postoperatively, with a very high satisfaction rate (91%) at a mean of 8.3 ± 5.1 years (range, 2-20 years) after ACI. At last follow-up, 24 of 46 successful knees were radiographically assessed (mean, 5.5 ± 4.0 years [range, 2.0-18.7 years]) and showed no significant osteoarthritis progression ( P = .3173). Outcomes for 12 patients were considered as failures at a mean of 4.1 years. Of these, 9 patients were converted to partial or total
Energy Technology Data Exchange (ETDEWEB)
Tadenuma, Taku; Uchio, Yuji; Kumahashi, Nobuyuki; Iwasa, Junji [Shimane University School of Medicine, Department of Orthopaedic Surgery, Izumo-shi, Shimane-ken (Japan); Fukuba, Eiji; Kitagaki, Hajime [Shimane University School of Medicine, Department of Radiology, Izumo-shi, Shimane-ken (Japan); Ochi, Mitsuo [Hiroshima University, Department of Orthopaedic Surgery, Integrated Health Sciences, Institute of Biomedical and Health Sciences, Minami-ku, Hiroshima (Japan)
2016-10-15
To elucidate the quality of tissue-engineered cartilage after an autologous chondrocyte implantation (ACI) technique with Atelocollagen gel as a scaffold in the knee in the short- to midterm postoperatively, we assessed delayed gadolinium-enhanced magnetic resonance imaging (MRI) of cartilage (dGEMRIC) and T2 mapping and clarified the relationship between T1 and T2 values and clinical results. In this cross-sectional study, T1 and T2 mapping were performed on 11 knees of 8 patients (mean age at ACI, 37.2 years) with a 3.0-T MRI scanner. T1{sub implant} and T2{sub implant} values were compared with those of the control cartilage region (T1{sub control} and T2{sub control}). Lysholm scores were also assessed for clinical evaluation. The relationships between the T1 and T2 values and the clinical Lysholm score were also assessed. There were no significant differences in the T1 values between the T1{sub implant} (386.64 ± 101.78 ms) and T1{sub control} (375.82 ± 62.89 ms) at the final follow-up. The implants showed significantly longer T2 values compared to the control cartilage (53.83 ± 13.89 vs. 38.21 ± 4.43 ms). The postoperative Lysholm scores were significantly higher than the preoperative scores. A significant correlation was observed between T1{sub implant} and clinical outcomes, but not between T2{sub implant} and clinical outcomes. Third-generation ACI implants might have obtained an almost equivalent glycosaminoglycan concentration compared to the normal cartilage, but they had lower collagen density at least 3 years after transplantation. The T1{sub implant} value, but not the T2 value, might be a predictor of clinical outcome after ACI. (orig.)
Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S
2009-01-01
Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less
Magnetization transfer analysis of cartilage repair tissue: a preliminary study
International Nuclear Information System (INIS)
Palmieri, F.; Keyzer, F. de; Maes, F.; Breuseghem, I. van
2006-01-01
To evaluate the magnetization transfer ratio (MTR) after two different cartilage repair procedures, and to compare these data with the MTR of normal cartilage. Twenty-seven patients with a proven cartilage defect were recruited: 13 were treated with autologous chondrocyte implantation (ACI) and 14 were treated with the microfracture technique (MFR). All patients underwent MRI examinations with MT-sequences before the surgical treatment, after 12 months (26 patients) and after 24 months (11 patients). Eleven patients received a complete follow-up study at all three time points (five of the ACI group and six of the MFR group). All images were transferred to a workstation to calculate MTR images. For every MT image set, different ROIs were delineated by two radiologists. Means were calculated per ROI type in the different time frames and in both groups of cartilage repair. The data were analyzed with unpaired t- and ANOVA tests, and by calculating Pearson's correlation coefficient. No significant differences were found in the MTR of fatty bone marrow, muscle and normal cartilage in the different time frames. There was a significant but small difference between the MTR of normal cartilage and the cartilage repair area after 12 months for both procedures. After 24 months, the MTR of ACI repaired cartilage (0.31±0.07) was not significantly different from normal cartilage MTR (0.34±0.05). The MTR of MFR repaired cartilage (0.28±0.02), still showed a significant difference from normal cartilage. The differences between damaged and repaired cartilage MTR are too small to enable MT-imaging to be a useful tool for postoperative follow-up of cartilage repair procedures. There is, however, an evolution towards normal MTR-values in the cartilage repair tissue (especially after ACI repair). (orig.)
Resuspension studies at Bikini Atoll
International Nuclear Information System (INIS)
Shinn, J.H.; Homan, D.N.; Robison, W.L.
1980-02-01
The following experiments were conducted on Bikini Atoll to provide key parameters for an assessment of inhalation exposure from plutonium-contaminated dust aerosols: (1) a characterization of background (plutonium activity, dust, plutonium, sea spray, and organic aerosol concentrations); (2) a study of plutonium resuspension from a bare field; (3) a study of plutonium resuspension by traffic; and (4) a study of personal inhalation exposure. Dust concentrations of 21 μg m -3 and sea spray of 34 μg m -3 were the background throughout the Bikini Island except within 50 m of the windward beach. Background concentrations of 239+240 Pu were 60 aCi m -3 in the coconut grove and 264 aCi m -3 over rain-stabilized bare soil. The ratio of plutonium activity in aerosols relative to the activity in underlying soil, defined as the enhancement factor, EF, was typically less than one. Enhancement factors increased about 3.8 as a result of tilling. Plutonium resuspension flux was estimated at 0.49 pCi m -2 year -1 over most of Bikini Island. Aerosol size distributions associated with mass and with plutonium activity were typically log-normal with median aerodynamic diameter 2.44 μm, which decreased to 2.0 μm above freshly tilled soil. The Pu concentration in aerosols collected over disturbed soil increased by a factor of 19.1. Vehicular traffic produced dust pulses typically of 10 s duration, 28 μg m -3 average concentration, and plutonium enhancement factor 2.5. Personal dosimetry showed that enhancement of dust by a worker was a factor of 2.64 for heavy work outdoors and 1.86 for light work in and around houses. Pulmonary deposition of plutonium was calculated for various exposure conditions. The pulmonary deposition ranged from 1476 aCi h -1 to 12 aCi h -1
International Nuclear Information System (INIS)
Tadenuma, Taku; Uchio, Yuji; Kumahashi, Nobuyuki; Iwasa, Junji; Fukuba, Eiji; Kitagaki, Hajime; Ochi, Mitsuo
2016-01-01
To elucidate the quality of tissue-engineered cartilage after an autologous chondrocyte implantation (ACI) technique with Atelocollagen gel as a scaffold in the knee in the short- to midterm postoperatively, we assessed delayed gadolinium-enhanced magnetic resonance imaging (MRI) of cartilage (dGEMRIC) and T2 mapping and clarified the relationship between T1 and T2 values and clinical results. In this cross-sectional study, T1 and T2 mapping were performed on 11 knees of 8 patients (mean age at ACI, 37.2 years) with a 3.0-T MRI scanner. T1 implant and T2 implant values were compared with those of the control cartilage region (T1 control and T2 control ). Lysholm scores were also assessed for clinical evaluation. The relationships between the T1 and T2 values and the clinical Lysholm score were also assessed. There were no significant differences in the T1 values between the T1 implant (386.64 ± 101.78 ms) and T1 control (375.82 ± 62.89 ms) at the final follow-up. The implants showed significantly longer T2 values compared to the control cartilage (53.83 ± 13.89 vs. 38.21 ± 4.43 ms). The postoperative Lysholm scores were significantly higher than the preoperative scores. A significant correlation was observed between T1 implant and clinical outcomes, but not between T2 implant and clinical outcomes. Third-generation ACI implants might have obtained an almost equivalent glycosaminoglycan concentration compared to the normal cartilage, but they had lower collagen density at least 3 years after transplantation. The T1 implant value, but not the T2 value, might be a predictor of clinical outcome after ACI. (orig.)
Tadenuma, Taku; Uchio, Yuji; Kumahashi, Nobuyuki; Fukuba, Eiji; Kitagaki, Hajime; Iwasa, Junji; Ochi, Mitsuo
2016-10-01
To elucidate the quality of tissue-engineered cartilage after an autologous chondrocyte implantation (ACI) technique with Atelocollagen gel as a scaffold in the knee in the short- to midterm postoperatively, we assessed delayed gadolinium-enhanced magnetic resonance imaging (MRI) of cartilage (dGEMRIC) and T2 mapping and clarified the relationship between T1 and T2 values and clinical results. In this cross-sectional study, T1 and T2 mapping were performed on 11 knees of 8 patients (mean age at ACI, 37.2 years) with a 3.0-T MRI scanner. T1implant and T2implant values were compared with those of the control cartilage region (T1control and T2control). Lysholm scores were also assessed for clinical evaluation. The relationships between the T1 and T2 values and the clinical Lysholm score were also assessed. There were no significant differences in the T1 values between the T1implant (386.64 ± 101.78 ms) and T1control (375.82 ± 62.89 ms) at the final follow-up. The implants showed significantly longer T2 values compared to the control cartilage (53.83 ± 13.89 vs. 38.21 ± 4.43 ms). The postoperative Lysholm scores were significantly higher than the preoperative scores. A significant correlation was observed between T1implant and clinical outcomes, but not between T2implant and clinical outcomes. Third-generation ACI implants might have obtained an almost equivalent glycosaminoglycan concentration compared to the normal cartilage, but they had lower collagen density at least 3 years after transplantation. The T1implant value, but not the T2 value, might be a predictor of clinical outcome after ACI.
From bed to bench: bridging from informatics practice to theory: an exploratory analysis.
Haux, R; Lehmann, C U
2014-01-01
In 2009, Applied Clinical Informatics (ACI)--focused on applications in clinical informatics--was launched as a companion journal to Methods of Information in Medicine (MIM). Both journals are official journals of the International Medical Informatics Association. To explore which congruencies and interdependencies exist in publications from theory to practice and from practice to theory and to determine existing gaps. Major topics discussed in ACI and MIM were analyzed. We explored if the intention of publishing companion journals to provide an information bridge from informatics theory to informatics practice and vice versa could be supported by this model. In this manuscript we will report on congruencies and interdependences from practice to theory and on major topics in MIM. Retrospective, prolective observational study on recent publications of ACI and MIM. All publications of the years 2012 and 2013 were indexed and analyzed. Hundred and ninety-six publications were analyzed (ACI 87, MIM 109). In MIM publications, modelling aspects as well as methodological and evaluation approaches for the analysis of data, information, and knowledge in biomedicine and health care were frequently raised - and often discussed from an interdisciplinary point of view. Important themes were ambient-assisted living, anatomic spatial relations, biomedical informatics as scientific discipline, boosting, coding, computerized physician order entry, data analysis, grid and cloud computing, health care systems and services, health-enabling technologies, health information search, health information systems, imaging, knowledge-based decision support, patient records, signal analysis, and web science. Congruencies between journals could be found in themes, but with a different focus on content. Interdependencies from practice to theory, found in these publications, were only limited. Bridging from informatics theory to practice and vice versa remains a major component of successful
Nature and forensic investigation of crime in Second Life
CSIR Research Space (South Africa)
Rakitianskaia, AS
2011-08-01
Full Text Available ] Types of Harassment and Bullying. Available: http://www.lboro.ac.uk/admin/personnel/harassmentandb/types.htm. Accessed: July 7, 2011. [17] Diagnostic and Statistical Manual of Mental Disorders DSM-IV TR (Text Revision). Arlington, VA, USA: American... of Manchester, UK, 2008. Available: http://www.sed.manchester.ac.uk/idpm/research/publications/wp/di/in dex.htm. Accessed 9 July 2011. [21] P. Heaven, Personality predictors of self-reported delinquency. Personality and Indiridual Differences, 1993...
CSIR Research Space (South Africa)
Holtmann, B
2007-07-01
Full Text Available . Journal of research in crime and delinquency, 21, 233-50. Metropolitan Transportation Authority, 2007. What is Bus Rapid Transit? [O]. Available: http://www.mta.info/mta/planning/brt/whatis.htm Accessed on 28/05/2007 Mijanovich, T., and Weitzman..., 2006. South African Police Service Statistics. [O]. Available: http://www.saps.gov.za/statistics/reports/crimestats/2006/crime_stats.htm Accessed on 29/03/2007 Security.co.za., 2007. Window washers beat up motorist. [O]. Available: http...
Papadomanolaki, Nina; Dijkstra, Nikki; van Helmond, Niels; Sangiorgi, Francesca; Hagens, Mathilde; Kotthoff, Ulrich; Slomp, Caroline
2016-04-01
During the past ~8000 years the Baltic Sea has experienced three distinct intervals of hypoxia, of which the last one is still ongoing. These intervals are characterized by enhanced sedimentary organic matter burial and enrichment of redox-sensitive metals, such as molybdenum and iron. The first two of these intervals occurred during the Holocene Thermal Maximum (HTM) and the Medieval Climate Anomaly (MCA), two phases with high temperatures and changed precipitation patterns. Studies focussing on the Holocene sedimentary record of the Baltic Sea aim at clarifying the causes of the initiation, evolution and termination of these hypoxic intervals, as well as their consequences. This information could help to potentially aid in finding solutions for the mitigation of present-day hypoxia in the Baltic Sea. The factors contributing to hypoxia development during the HTM and MCA are still debated. Here we present data from a core retrieved during Integrated Ocean Drilling Program (IODP) Expedition 347 in the Landsort Deep basin, the deepest basin of the Baltic Sea at 463m water depth. Sediments were analysed at a high resolution using inorganic geochemical and (mainly marine) palynological proxies. Dinoflagellate cyst (dinocyst) assemblages and total elemental compositions provide clues on the role of salinity in enhancing stratification, ultimately causing hypoxia. During the onset of the HTM changes in salinity, as indicated by the palynology, closely follow changes in sedimentary organic carbon burial and trace metal concentrations. This suggests that stratification was an important cause of hypoxia during the HTM. In contrast, the palynology suggests that reduced stratification did not contribute to re-oxygenation during the termination of the HTM. We did not observe major changes in the palynology throughout the hypoxic interval of the MCA. Our results thus suggest that changes in salinity did not cause the onset and termination of hypoxia during the MCA.
¿Qué piensan los niños brasileños sobre lo que aprenden con la televisión?
Duarte, Rosalia; Migliora, Rita
2005-01-01
La televisión no es solo diversión, sino también información y «enseñación». Enseñación es un neologismo que fue adoptado por los niños inspirados en la idea de aprendizaje, que expresa la actividad de la enseñanza. Ésa es la opinión que se escucha entre los niños cuando les preguntamos lo que piensan sobre la televisión. En Brasil, los niños forman parte del segmento más significativo de televidentes: permanecen delante de la pequeña pantalla por lo menos 3 horas todos los días; ...
Anchorage in concrete construction
Eligehausen, Rolf; Silva, John F
2013-01-01
A comprehensive treatment of current fastening technology using inserts (anchor channels, headed stud), anchors (metal expansion anchor, undercut anchor, bonded anchor, concrete screw and plastic anchor) as well as power actuated fasteners in concrete. It describes in detail the fastening elements as well as their effects and load-bearing capacities in cracked and non-cracked concrete. It further focuses on corrosion behaviour, fire resistance and characteristics with earthquakes and shocks. It finishes off with the design of fastenings according to the European Technical Approval Guideline (ETAG 001), the Final Draft of the CEN Technical Specification 'Design of fastenings for use in concrete' and the American Standards ACI 318-05, Appendix D and ACI 349-01, Appendix B.
International Nuclear Information System (INIS)
Takahashi, Wakoh; Takagi, Shigeharu; Shinohara, Yukito; Ide, Michiru; Shohtsu, Akira
2000-01-01
To clarify the hemodynamic changes in lacunar infarction, we evaluated cerebral glucose metabolism by using positron emission tomography with 18 F-fluorodeoxyglucose (FDG-PET) in patients with asymptomatic and symptomatic lacunar infarction and in persons without cerebral infarction on MRI. Subjects in this study were 27 patients with symptomatic lacunar infarction (SCI group), 73 subjects with asymptomatic lacunar infarction (ACI group), and 134 persons without infarction (NC group). CMRgI in the ACI group was significantly lower than that in the NC group in the cerebral cortex (P<0.05) and thalamus (P<0.05). CMRgI in the SCI group was significantly reduced from that in the NC group in the cerebral cortex (P<0.005), basal ganglia (P<0.001), thalamus (P<0.05) and white matter (P<0.005). The reduction in CMRgI in the SCI group was more severe than that in the ACI group in basal ganglia (P<0.05) and thalamus (P<0.05). Our results indicated that glucose metabolism in patients with asymptomatic lacunar infarction is reduced throughout the whole brain as compared with non-infarcted elderly persons. Follow-up and treatment of risk factors if present, may be necessary in such patients. (author)
Directory of Open Access Journals (Sweden)
Jorge García-Martínez
Full Text Available The ascomycete fungus Fusarium fujikuroi (Gibberella fujikuroi MP-C produces secondary metabolites of biotechnological interest, such as gibberellins, bikaverin, and carotenoids. Production of these metabolites is regulated by nitrogen availability and, in a specific manner, by other environmental signals, such as light in the case of the carotenoid pathway. A complex regulatory network controlling these processes is recently emerging from the alterations of metabolite production found through the mutation of different regulatory genes. Here we show the effect of the targeted mutation of the acyA gene of F. fujikuroi, coding for adenylyl cyclase. Mutants lacking the catalytic domain of the AcyA protein showed different phenotypic alterations, including reduced growth, enhanced production of unidentified red pigments, reduced production of gibberellins and partially derepressed carotenoid biosynthesis in the dark. The phenotype differs in some aspects from that of similar mutants of the close relatives F. proliferatum and F. verticillioides: contrary to what was observed in these species, ΔacyA mutants of F. fujikuroi showed enhanced sensitivity to oxidative stress (H(2O(2, but no change in heavy metal resistance or in the ability to colonize tomato tissue, indicating a high versatility in the regulatory roles played by cAMP in this fungal group.
Teng, Hui; Lee, Won Young; Choi, Yong Hee
2013-09-01
Anthocyanins (Acys), polyphenols, and antioxidants were extracted from raspberry (Rubus Coreanus Miq.) using a highly efficient microwave-assisted extraction technique. Different solvents, including methanol, ethanol, and acetone, were tested. The colors of the extracts varied from light yellow to purple red or dark red. SEM and other nutrient analyses verified that ethanol was the most favorable medium for the microwave-assisted extraction of raspberry due to its high output and low toxicity. Effects of process parameters, including microwave power, irradiation time, and solvent concentration, were investigated through response surface methodology. Canonical analysis estimated that the highest total Acys content, total polyphenols content, and antioxidant activity of raspberry were 17.93 mg cyanidin-3-O-glucoside equivalents per gram dry weight, 38.57 mg gallic acid equivalents per gram dry weight, and 81.24%, respectively. The polyphenol compositions of raspberry extract were identified by HPLC with diode array detection, and nine kinds of polyphenols were identified and quantified, revealing that chlorogenic acid, syringic acid, and rutin are the major polyphenols contained in raspberry fruits. Compared with other fruits and vegetables, raspberry contains higher Acy and polyphenol contents with stronger antioxidant activity, suggesting that raspberry fruits are a good source of natural food colorants and antioxidants. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Microdiversification in genome-streamlined ubiquitous freshwater Actinobacteria.
Neuenschwander, Stefan M; Ghai, Rohit; Pernthaler, Jakob; Salcher, Michaela M
2018-01-01
Actinobacteria of the acI lineage are the most abundant microbes in freshwater systems, but there are so far no pure living cultures of these organisms, possibly because of metabolic dependencies on other microbes. This, in turn, has hampered an in-depth assessment of the genomic basis for their success in the environment. Here we present genomes from 16 axenic cultures of acI Actinobacteria. The isolates were not only of minute cell size, but also among the most streamlined free-living microbes, with extremely small genome sizes (1.2-1.4 Mbp) and low genomic GC content. Genome reduction in these bacteria might have led to auxotrophy for various vitamins, amino acids and reduced sulphur sources, thus creating dependencies to co-occurring organisms (the 'Black Queen' hypothesis). Genome analyses, moreover, revealed a surprising degree of inter- and intraspecific diversity in metabolic pathways, especially of carbohydrate transport and metabolism, and mainly encoded in genomic islands. The striking genotype microdiversification of acI Actinobacteria might explain their global success in highly dynamic freshwater environments with complex seasonal patterns of allochthonous and autochthonous carbon sources. We propose a new order within Actinobacteria ('Candidatus Nanopelagicales') with two new genera ('Candidatus Nanopelagicus' and 'Candidatus Planktophila') and nine new species.
International Nuclear Information System (INIS)
Seymour, R.G.
1995-01-01
High-level waste (HLW) feed preparation flowsheet development was initiated in fiscal year (FY) 1994 to evaluate alternative flowsheets for preparing melter feed for high-temperature melter (HTM) vitrification testing. Three flowsheets were proposed that might lead to increased processing capacity relative to the Hanford Waste Vitrification Plant (HWVP) and that were flexible enough to use with other HLW melter technologies. This document describes the decision path that led to the selection of flowsheets to be tested in the FY 1994 small-scale HTM tests. Feed preparation flowsheet development for the HLW HTM was based on the feed preparation flowsheet that was developed for the HWVP. This approach allowed the HLW program to build upon the extensive feed preparation flowsheet database developed under the HWVP Project. Primary adjustments to the HWVP flowsheet were to the acid adjustment and glass component additions. Developmental background regarding the individual features of the HLW feed preparation flowsheets is provided. Applicability of the HWVP flowsheet features to the new HLW vitrification mission is discussed. The proposed flowsheets were tested at the laboratory-scale at Pacific Northwest Laboratory. Based on the results of this testing and previously established criteria, a reductant-based flowsheet using glycolic acid and a nitric acid-based flowsheet were selected for the FY 1994 small-scale HTM testing
Molasses crisis in the Puerto Rico rum industry
Energy Technology Data Exchange (ETDEWEB)
Samuels, G
1980-01-01
In 1978 the Puerto Rico rum industry provided 85% of the US rum market, returning to the PR treasury $200 million in Federal excise taxes. The diminishing P.R. sugar industry is not able to supply sufficient blackstrap molasses (BSM) to the expanding P.R. rum industry, and at present imports from foreign suppliers amount to 88% of its needs. These imports place the rum industry in jeopardy, as these suppliers can boycott Puerto Rico to protect their own rum production, or they can insist by treaty that all rums claiming geographic origin (i.e., Puerto Rico rum) must be distilled from molasses produced in that country. Possible solutions to improve domestic molasses production are presented to eliminate these threats. The use of high-test molasses (HTM) would answer the present and future needs of the rum industry if produced by the energy cane (or biomass) concept. This is a management concept stressing total growth potential rather than sugar. It would permit doubling cane production per acre and produce sufficient HTM on 70,000 acres for the projected rum industry requirements. Considerations of HTM production show that problems exist with the marketing price rather than in the field or factory. The economics of HTM pricing will have to be worked out by the interested parties: the rum industry, the sugar industry, and the government.
Investigation of Large Scale Cortical Models on Clustered Multi-Core Processors
2013-02-01
Playstation 3 with 6 available SPU cores outperforms the Intel Xeon processor (with 4 cores) by about 1.9 times for the HTM model and by 2.4 times...runtime breakdowns of the HTM and Dean models respectively on the Cell processor (on the Playstation 3) and the Intel Xeon processor ( 4 thread...YOUR FORM TO THE ABOVE ORGANIZATION. 1. REPORT DATE (DD-MM-YYYY) 2. REPORT TYPE 3. DATES COVERED (From - To) 4 . TITLE AND SUBTITLE 5a. CONTRACT NUMBER
Animal computer interaction (ACI) & designing for animal interaction (AXD)
DEFF Research Database (Denmark)
Morrison, Ann Judith; Turner, Jane; Farley, Helen
2017-01-01
This workshop invites researchers and practitioners from HCI and related fields who work in some capacity with animals and who recognise the sentient nature of their being. We call for those who want to better understand how to work with animals and learn from them. We are a small team looking...... to build an Australian chapter of the Animal Computer Interaction Community. The workshop will elicit discussion, forge new partnerships and head up a new group on the state of the art within this field in Australia, including comparative international studies. For more information see http://www.ozaci.org/...
THE SOLUBILITY OF MILAS BAUXITE ORE IN SULPHURIC ACI
Directory of Open Access Journals (Sweden)
Mustafa GULFEN
2001-06-01
Full Text Available The effects of calcination conditions,sulphuric acid concentrations and dissolvingtemperature and period as parameters to thesolubility of the bauxite ore from Gobekdagı reservesin Mugla-Milas region were investigated. The bauxitesamples were calcined in different periods at differenttemperatures. Then the solubility of the calcinedbauxite samples in sulphuric acid solution wasexamined. Dissolving activation energy (Ea wascalculated using the optimum kinetics equation andthe results obtained from the solubility studiesexamined dissolving temperatures and periods
40 CFR 264.1101 - Design and operating standards.
2010-07-01
... the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM) in judging... they are exposed; climatic conditions; and the stresses of daily operation, including the movement of...
Using an operating cost model to analyse the selection of aircraft type on short-haul routes
CSIR Research Space (South Africa)
Ssamula, B
2006-08-01
Full Text Available 1998 (Act No 2 of 1998). http://www. gov.za/gazette/acts/1998/a2-98.pdf (30/4/2004). Pyramid Media Group 2003. Commercial aircraft prices. http://www.pyramid.ch/aircr_prices.htm (4/10/2003). Rolls–Royce 2003. Civil aerospace turbofan range. http...:// www.rolls-royce.com/civil/products/turbofans/Default.htm (4/24/2003). Ssamula, B 2004. Developing a cost model for running an airline service. MEng dissertation, University of Pretoria, Pretoria. Stratford, A H1973. Air transport economics...
Marie N seisis pea peal / Helen Urbanik
Urbanik, Helen
2002-01-01
Tänavuse Eurovisiooni võitjast Marija Naumovast, tema heliplaatidest "Do svetlõh sljoz" ("Magusate pisarateni"), "Leskaties acis" ("Vaata mu silmadesse"), "Ma voix, ma vie" ("Minu hääl, minu tee")
Grisorio, Roberto; Iacobellis, Rosabianca; Listorti, Andrea; De Marco, Luisa; Cipolla, Maria Pia; Manca, Michele; Rizzo, Aurora; Abate, Antonio; Gigli, Giuseppe; Suranna, Gian Paolo
2017-07-26
Due to a still limited understanding of the reasons making 2,2',7,7'-tetrakis(N,N-di-p-methoxyphenylamine)-9,9'-spirobifluorene (Spiro-OMeTAD) the state-of-the-art hole-transporting material (HTM) for emerging photovoltaic applications, the molecular tailoring of organic components for perovskite solar cells (PSCs) lacks in solid design criteria. Charge delocalization in radical cationic states can undoubtedly be considered as one of the essential prerequisites for an HTM, but this aspect has been investigated to a relatively minor extent. In marked contrast with the 3-D structure of Spiro-OMeTAD, truxene-based HTMs Trux1 and Trux2 have been employed for the first time in PSCs fabricated with a direct (n-i-p) or inverted (p-i-n) architecture, exhibiting a peculiar behavior with respect to the referential HTM. Notwithstanding the efficient hole extraction from the perovskite layer exhibited by Trux1 and Trux2 in direct configuration devices, their photovoltaic performances were detrimentally affected by their poor hole transport. Conversely, an outstanding improvement of the photovoltaic performances in dopant-free inverted configuration devices compared to Spiro-OMeTAD was recorded, ascribable to the use of thinner HTM layers. The rationalization of the photovoltaic performances exhibited by different configuration devices discussed in this paper can provide new and unexpected prospects for engineering the interface between the active layer of perovskite-based solar cells and the hole transporters.
Reference: 372 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available types indicated that the css1 mutation influenced various fundamental metabolic pathways including amino aci...efect in the function of mitochondria influences various aspects of fundamental cellular metabolism includin
40 CFR 265.1101 - Design and operating standards.
2010-07-01
... industry such as the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM... wastes to which they are exposed; climatic conditions; and the stresses of daily operation, including the...
Information on radionuclides on the Internet. http://www.tue.nl/sbd/nvsnucleair.htm
International Nuclear Information System (INIS)
Franken, Y.
1997-01-01
A selection from Internet information sources on the subjects of radiation protection, dosimetry and medical radiation applications are discussed. The article is also available through the Internet (see title) including links to the discussed sites
A transformada de Fourier em basic The Fourier transform (FFT in basic
Directory of Open Access Journals (Sweden)
Mauricio Gomes Constantino
2000-06-01
Full Text Available In this paper we describe three computer programs in Basic language about the Fourier transform (FFT which are available in the Internet site http://artemis.ffclrp.usp.br/SoftwareE.htm (in English or http://artemis.ffclrp.usp.br/softwareP.htm (in Portuguese since October 1998. Those are addresses to the Web Page of our Laboratory of Organic Synthesis. The programs can be downloaded and used by anyone who is interested on the subject. The texts, menus and captions in the programs are written in English.
Simulation of perovskite solar cells with inorganic hole transporting materials
DEFF Research Database (Denmark)
Wang, Yan; Xia, Zhonggao; Liu, Yiming
2015-01-01
Device modeling organolead halide perovskite solar cells with planar architecture based on inorganic hole transporting materials (HTMs) were performed. A thorough understanding of the role of the inorganic HTMs and the effect of band offset between HTM/absorber layers is indispensable for further...... improvement in power conversion efficiency (PCE). Here, we investigated the effect of band offset between inorganic HTM/absorber layers. The solar cell simulation program adopted in this work is named wxAMPS, an updated version of the AMPS tool (Analysis of Microelectronic and Photonic Structure)....
Uplink scheduling and adjacent-channel coupling loss analysis for TD-LTE deployment.
Yeo, Woon-Young; Moon, Sung Ho; Kim, Jae-Hoon
2014-01-01
TD-LTE, one of the two duplexing modes in LTE, operates in unpaired spectrum and has the advantages of TDD-based technologies. It is expected that TD-LTE will be more rapidly deployed in near future and most of WiMax operators will upgrade their networks to TD-LTE gradually. Before completely upgrading to TD-LTE, WiMax may coexist with TD-LTE in an adjacent frequency band. In addition, multiple TD-LTE operators may deploy their networks in adjacent bands. When more than one TDD network operates in adjacent frequency bands, severe interference may happen due to adjacent channel interference (ACI) and unsynchronized operations. In this paper, coexistence issues between TD-LTE and other systems are analyzed and coexistence requirements are provided. This paper has three research objectives. First, frame synchronization between TD-LTE and WiMax is discussed by investigating possible combinations of TD-LTE and WiMax configurations. Second, an uplink scheduling algorithm is proposed to utilize a leakage pattern of ACI in synchronized operations. Third, minimum requirements for coexistence in unsynchronized operations are analyzed by introducing a concept of adjacent-channel coupling loss. From the analysis and simulation results, we can see that coexistence of TD-LTE with other TDD systems is feasible if the two networks are synchronized. For the unsynchronized case, some special cell-site engineering techniques may be required to reduce the ACI.
Tissue engineering in the treatment of cartilage lesions
Directory of Open Access Journals (Sweden)
Jakob Naranđa
2013-11-01
Full Text Available Background: Articular cartilage lesions with the inherent limited healing potential are difficult to treat and thus remain a challenging problem for orthopaedic surgeons. Regenerative treatment techniques, such as autologous chondrocyte implantation (ACI, are promising as a treatment option to restore hyaline-like cartilage tissue in damaged articular surfaces, as opposed to the traditional reparative procedures (e.g. bone marrow stimulation – microfracture, which promote a fibrocartilage formation with lower tissue biomechanical properties and poorer clinical results. ACI technique has undergone several advances and is constantly improving. The new concept of cartilage tissue preservation uses tissue-engineering technologies, combining new biomaterials as a scaffold, application of growth factors, use of stem cells, and mechanical stimulation. The recent development of new generations of ACI uses a cartilage-like tissue in a 3-dimensional culture system that is based on the use of biodegradable material which serves as a temporary scaffold for the in vitro growth and subsequent implantation into the cartilage defect. For clinical practice, single stage procedures appear attractive to reduce cost and patient morbidity. Finally, modern concept of tissue engineering facilitates hyaline-like cartilage formation and a permanent treatment of cartilage lesions.Conclusion: The review focuses on innovations in the treatment of cartilage lesions and covers modern concepts of tissue engineering with the use of biomaterials, growth factors, stem cells and bioreactors, and presents options for clinical use.
Study on reinforced lightweight coconut shell concrete beam behavior under torsion
International Nuclear Information System (INIS)
Gunasekaran, K.; Ramasubramani, R.; Annadurai, R.; Prakash Chandar, S.
2014-01-01
Highlights: • Use of coconut shell as aggregate in concrete production. • Behavior of coconut shell concrete under torsion. • Pre and post cracking behavior and analysis. • Torsional reinforcement and ductility. • Crack width and stiffness. - Abstract: This research investigates and evaluates the results of coconut shell concrete beams subjected to torsion and compared with conventional concrete beams. Eight beams, four with coconut shell concrete and four with conventional concrete were fabricated and tested. Study includes the general cracking characteristics, pre cracking behavior and analysis, post cracking behavior and analysis, minimum torsional reinforcement, torsional reinforcement, ductility, crack width and stiffness. It was observed that the torsional behavior of coconut shell concrete is comparable to that of conventional concrete. Compare to ACI prediction, equation suggested by Macgregor is more conservative in calculating cracking torsional resistance. But for the calculation of ultimate torque strength ACI prediction is more conservative compared to the equation suggested by Macgregor. Indian standard is also conservative in this regard, but it was under estimated compared to ACI and Macgregor equations. Minimum torsional reinforcement in beams is necessary to ensure that the beam do not fail at cracking. Compared to conventional concrete specimens, coconut shell concrete specimens have more ductility. Crack width at initial cracking torque for both conventional and coconut shell concrete with corresponding reinforcement ratios is almost similar
40 CFR 267.1101 - What design and operating standards must my containment building meet?
2010-07-01
... generally recognized by the industry such as the American Concrete Institute (ACI) and the American Society...) Stresses of daily operation, including the movement of heavy equipment within the unit and contact of such...
Talsma, Elise F; Moretti, Diego; Ly, Sou Chheng; Dekkers, Renske; van den Heuvel, Ellen Ghm; Fitri, Aditia; Boelsma, Esther; Stomph, Tjeerd Jan; Zeder, Christophe; Melse-Boonstra, Alida
2017-06-01
Background: Milk has been suggested to increase zinc absorption. The effect of processing and the ability of milk to enhance zinc absorption from other foods has not been measured directly in humans. Objective: We aimed to assess zinc absorption from 1 ) milk undergoing various processing and preparatory steps and 2 ) from intrinsically labeled high-phytate rice consumed with milk or water. Methods: Two randomized crossover studies were conducted in healthy young women [age:18-25 y; body mass index (in kg/m 2 ): 20-25]: 1 ) a milk study ( n = 19) comparing the consumption of 800 mL full-fat ultra-high temperature (UHT) milk [heat-treated milk (HTM)], full-fat UHT milk diluted 1:1 with water [heat-treated milk and water (MW)], water, or unprocessed (raw) milk (UM), each extrinsically labeled with 67 Zn, and 2 ) a rice study ( n = 18) comparing the consumption of 90 g intrinsically 67 Zn-labeled rice with 600 mL of water [rice and water (RW)] or full-fat UHT milk [rice and milk (RM)]. The fractional absorption of zinc (FAZ) was measured with the double-isotope tracer ratio method. In vitro, we assessed zinc extraction from rice blended into water, UM, or HTM with or without phytate. Results: FAZ from HTM was 25.5% (95% CI: 21.6%, 29.4%) and was not different from UM (27.8%; 95% CI: 24.2%, 31.4%). FAZ from water was higher (72.3%; 95% CI: 68.7%, 75.9%), whereas FAZ from MW was lower (19.7%; 95% CI: 17.5%, 21.9%) than HTM and UM (both P zinc from rice with HTM than from rice with water at various phytate concentrations. Conclusions: Milk enhanced human FAZ from high-phytate rice by 62% compared with water. Diluting milk with water decreases its absorption-enhancing proprieties, whereas UHT processing does not. This trial was registered at the Dutch trial registry as NTR4267 (http://www.trialregister.nl/trialreg/admin/rctview.asp?TC=4267). © 2017 American Society for Nutrition.
Autologous Matrix-Induced Chondrogenesis: A Systematic Review of the Clinical Evidence.
Gao, Liang; Orth, Patrick; Cucchiarini, Magali; Madry, Henning
2017-11-01
The addition of a type I/III collagen membrane in cartilage defects treated with microfracture has been advocated for cartilage repair, termed "autologous matrix-induced chondrogenesis" (AMIC). To examine the current clinical evidence regarding AMIC for focal chondral defects. Systematic review. A systematic review was performed by searching PubMed, ScienceDirect, and Cochrane Library databases. Inclusion criteria were clinical studies of AMIC for articular cartilage repair, written in English. Relative data were extracted and critically analyzed. PRISMA guidelines were applied, the methodological quality of the included studies was assessed by the modified Coleman Methodology Score (CMS), and aggregate data were generated. Twenty-eight clinical articles were included: 12 studies (245 patients) of knee cartilage defects, 12 studies (214 patients) of ankle cartilage defects, and 4 studies (308 patients) of hip cartilage defects. The CMS demonstrated a suboptimal study design in the majority of published studies (knee, 57.8; ankle, 55.3; hip, 57.7). For the knee, 1 study reported significant clinical improvements for AMIC compared with microfracture for medium-sized cartilage defects (mean defect size 3.6 cm 2 ) after 5 years (level of evidence, 1). No study compared AMIC with matrix-assisted autologous chondrocyte implantation (ACI) in the knee. For the ankle, no clinical trial was available comparing AMIC versus microfracture or ACI. In the hip, only one analysis (level of evidence, 3) compared AMIC with microfracture for acetabular lesions. For medium-sized acetabular defects, one study (level of evidence, 3) found no significant differences between AMIC and ACI at 5 years. Specific aspects not appropriately discussed in the currently available literature include patient-related factors, membrane fixation, and defect properties. No treatment-related adverse events were reported. This systematic review reveals a paucity of high-quality, randomized controlled
Real Time Space Weather Support for Chandra X-Ray Observatory Operations
O'Dell, Stephen L.; Minow, Joseph I.; Miller, J. Scott; Wolk, Scott J.; Aldcroft, Thomas L.; Spitzbart, Bradley D.; Swartz. Douglas A.
2012-01-01
NASA launched the Chandra X-ray Observatory in July 1999. Soon after first light in August 1999, however, degradation in the energy resolution and charge transfer efficiency of the Advanced CCD Imaging Spectrometer (ACIS) x-ray detectors was observed. The source of the degradation was quickly identified as radiation damage in the charge-transfer channel of the front-illuminated CCDs, by weakly penetrating ( soft , 100 500 keV) protons as Chandra passed through the Earth s radiation belts and ring currents. As soft protons were not considered a risk to spacecraft health before launch, the only on-board radiation monitoring system is the Electron, Proton, and Helium Instrument (EPHIN) which was included on Chandra with the primary purpose of monitoring energetic solar particle events. Further damage to the ACIS detector has been successfully mitigated through a combination of careful mission planning, autonomous on-board radiation protection, and manual intervention based upon real-time monitoring of the soft-proton environment. The AE-8 and AP-8 trapped radiation models and Chandra Radiation Models are used to schedule science operations in regions of low proton flux. EPHIN has been used as the primary autonomous in-situ radiation trigger; but, it is not sensitive to the soft protons that damage the front-illuminated CCDs. Monitoring of near-real-time space weather data sources provides critical information on the proton environment outside the Earth s magnetosphere due to solar proton events and other phenomena. The operations team uses data from the Geostationary Operational Environmental Satellites (GOES) to provide near-real-time monitoring of the proton environment; however, these data do not give a representative measure of the soft-proton (real-time data provided by NOAA s Space Weather Prediction Center. This presentation describes the radiation mitigation strategies to minimize the proton damage in the ACIS CCD detectors and the importance of real-time data
Energy Technology Data Exchange (ETDEWEB)
Oluwole, S.F.; Chabot, J.; Pepino, P.; Reemtsma, K.; Hardy, M.A.
1988-09-01
Recipient pretreatment with UV-B irradiated donor-specific blood transfusions (UV-DST) combined with peritransplant cyclosporine on days 0, +1, and +2 leads to permanent cardiac allograft survival in the ACI-to-Lewis rat strain combination. This study investigates the mechanisms of immunologic unresponsiveness induced by UV-DST and CsA by examining several in vitro and in vivo parameters in long-term cardiac allograft recipients. The results of the in vitro studies demonstrate that thoracic duct lymphocytes (TDL) of treated and allografted Lewis rats respond less in a mixed lymphocyte reaction to donor splenic lymphocytes (SpL) by 69%, 75%, and 73% (P less than 0.001) at 30, 50, and 100 days after transplantation, respectively, compared with controls, while the response to a third-party (W/F) SpL is unimpaired. In coculture experiments, the TDL from treated recipients specifically suppressed the response of unmodified Lewis TDL to ACI SpL by 59% and 40% (P less than 0.01) at 30 and 50 days after transplantation, respectively, while responses to W/F SpL were suppressed by only 3-6%. The sera obtained from ungrafted rats transfused with UV-DST suppressed the MLR between unmodified Lewis TDL and ACI SpL by 31% (P less than 0.05) while the sera from UV-DST and CsA-treated and allografted rats specifically suppressed the MLR by 75%, 80% (P less than 0.001) and 37% (P less than 0.01) at 10, 30, and 50 days after transplantation, respectively. In vivo adoptive transfer of 10(4) donor-type dendritic cells (DC) into recipients of beating cardiac allografts at 40 or 60 days after transplantation led to rapid and acute allograft rejection, while the adoptive transfer of 10(8) unseparated SpL obtained at 50 days after transplantation from treated Lewis recipients to syngeneic naive hosts led to a modest but significant prolongation of ACI test cardiac allografts.
Low Cost/Low Noise Variable Pitch Ducted Fan, Phase I
National Aeronautics and Space Administration — ACI proposes a design for a Propulsor (Low Cost/Low Noise Variable Pitch Ducted Fan) that has wide application in all sectors of Aviation. Propulsor hardware of this...
Affects and Affect Consciousness
MONSEN, JON T.; EILERTSEN, DAG ERIK; MELGÅRD, TROND; ØDEGÅRD, PÅL
1996-01-01
Affect consciousness (AC) was operationalized as degrees of awareness, tolerance, nonverbal expression, and conceptual expression of nine specific affects. A semistructured interview (ACI) and separate scales were developed to assess these aspects of affect integration. Their psychometric properties were preliminarily explored by having 20 former psychiatric outpatients complete the interview. Concurrent validity was assessed by using DSM-III-R Axis I and II diagnoses, the Health-Sickness Rating Scale, SCL-90-R, and several indexes from the Minnesota Multiphasic Personality Inventory. Satisfactory interrater reliability and high levels of internal consistency supported the construct validity of the measure. Results suggest the most meaningful use of this instrument is in measuring specific affect and overall AC. Clinically, the ACI has provided highly specific and relevant qualitative data for use in planning psychotherapeutic interventions. PMID:22700292
Discovery of Spatial and Spectral Structure in the X-Ray Emission from the Crab Nebula
Weisskopf, Martin C.; Hester, J. Jeff; Tennant, Allyn F.; Elsner, Ronald F.; Schulz, Norbert S.; Marshall, Herman L.; Karovska, Margarita; Nichols, Joy S.; Swartz, Douglas A.; Kolodziejczak, Jeffery J.
2000-01-01
The Chandra X-Ray Observatory observed the Crab Nebula and pulsar during orbital calibration. Zeroth-order images with the High-Energy Transmission Grating (HETG) readout by the Advanced Charge Coupled Devices (CCD) Imaging Spectrometer spectroscopy array (ACIS-S) show a striking richness of X-ray structure at a resolution comparable to that of the best ground-based visible-light observations. The HETG-ACIS-S images reveal, for the first time, an X-ray inner ring within the X-ray torus, the suggestion of a hollow-tube structure for the torus, and X-ray knots along the inner ring and (perhaps) along the inward extension of the X-ray jet. Although complicated by instrumental effects and the brightness of the Crab Nebula, the spectrometric analysis shows systematic variations of the X-ray spectrum throughout the nebula.
Discovery of Spatial and Spectral Structure in the X-Ray Emission from the Crab Nebula.
Weisskopf; Hester; Tennant; Elsner; Schulz; Marshall; Karovska; Nichols; Swartz; Kolodziejczak; O'Dell
2000-06-20
The Chandra X-Ray Observatory observed the Crab Nebula and pulsar during orbital calibration. Zeroth-order images with the High-Energy Transmission Grating (HETG) readout by the Advanced CCD Imaging Spectrometer spectroscopy array (ACIS-S) show a striking richness of X-ray structure at a resolution comparable to that of the best ground-based visible-light observations. The HETG-ACIS-S images reveal, for the first time, an X-ray inner ring within the X-ray torus, the suggestion of a hollow-tube structure for the torus, and X-ray knots along the inner ring and (perhaps) along the inward extension of the X-ray jet. Although complicated by instrumental effects and the brightness of the Crab Nebula, the spectrometric analysis shows systematic variations of the X-ray spectrum throughout the nebula.
Effect of PVA fiber content on creep property of fiber reinforced high-strength concrete columns
Xu, Zongnan; Wang, Tao; Wang, Weilun
2018-04-01
The effect of PVA (polyvinyl alcohol) fiber content on the creep property of fiber reinforced high-strength concrete columns was investigated. The correction factor of PVA fiber content was proposed and the creep prediction model of ACI209 was modified. Controlling the concrete strength as C80, changing the content of PVA fiber (volume fraction 0%, 0.25%, 0.5%, 1% respectively), the creep experiment of PVA fiber reinforced concrete columns was carried out, the creep coefficient of each specimen was calculated to characterize the creep property. The influence of PVA fiber content on the creep property was analyzed based on the creep coefficient and the calculation results of several frequently used creep prediction models. The correction factor of PVA fiber content was proposed to modify the ACI209 creep prediction model.
HIZBUT TAHRIR MALAYSIA: the Emergence of a New Transnational Islamist Movement in Malaysia
Directory of Open Access Journals (Sweden)
Mohamed Nawab Mohamed Osman
2009-02-01
Full Text Available This paper looks at the Hizbut Tahrir of Malaysia and places it in the context of the wider and deeper development of Muslim politics and mass mobilisation across Asia and the world at large. While much has been written about the Hizbut Tahrir of Indonesia (HTI, little is known about the HTM. This paper traces the initial arrival of the HT to Malaysia, via the network of Malaysian students and activists who were educated abroad and who have managed to build their own inter-personal networks and relationships outside the parameters of mainstream political Islam and the state apparatus in the country. Furthermore it is interesting to note that HTM in Malaysia takes its own unique stand on Islamic issues with relation to the mainstream Islamic party PAS and the Malay-Muslim UMNO party. The paper therefore attempts to locate the ideological positioning of the HTM in the wider context of Islamist politics in contemporary Malaysia and to analyse its relationship to the wider currents of ethno-communal as well as religious politics in the country as a whole.
Directory of Open Access Journals (Sweden)
Marwa Ben Manaa
2016-07-01
Full Text Available Carbazole-based molecular glasses have emerged as a promising alternative to the widely used hole-transporting materials (HTM spiro-OMeTAD in solid-state dye-sensitized solar cells (DSSCs. The pore filling fraction (PFF of the mesoporous TiO2 layer by the HTM appears as a key parameter determining the final efficiency of a DSSC. In this work, the pore-filling properties of a family of carbazole-based HTMs are investigated for the first time and the photovoltaic behavior of DSSC devices (fabricated using the D102 dye is discussed in light of the present findings. It is found that N-aryl substituted 3,6-bis(diphenylaminyl-carbazole derivatives exhibit relatively low PFF of ca. 60%. Methoxy groups on the diphenylamine moieties have little influence on the PFF, indicating that the strong enhancement in power conversion efficiency (PCE is not related to an improved filling of the pores by the HTM. N-alkylated HTMs lead to higher PFF, increasing with the alkyl chain length, up to 78%.
78 FR 24239 - Advisory Committee for Cyberinfrastructure; Notice of Meeting
2013-04-24
... NATIONAL SCIENCE FOUNDATION Advisory Committee for Cyberinfrastructure; Notice of Meeting In... Foundation announces the following meeting: Name: Advisory Committee for Cyberinfrastructure (25150). Date... Person: Marc Rigas, Advanced Cyberinfrastructure (CISE/ ACI), National Science Foundation, 4201 Wilson...
Strengthening of non-seismically detailed reinforced concrete beam ...
Indian Academy of Sciences (India)
work and in order to carry the anchorages sufficiently away from the column face ..... Owing to the strengthening application, joint shear stress–strain behaviour was ..... structures (ACI 352R-02), MI: American Concrete Institute, Farmington Hills.
New record of the sympatric distribution of two Asian species of the horseshoe crab
Digital Repository Service at National Institute of Oceanography (India)
Chatterji, A.
distribution of two Asian species of the horses... http://www.ias.ac.in/currsci/sep25/articles14.htm 1 of 3 2/11/05 9:47 AM New record of the sympatric distribution of two Asian species of the horseshoe crab The geographical distribution of four extant species...... http://www.ias.ac.in/currsci/sep25/articles14.htm 2 of 3 2/11/05 9:47 AM This species was found breeding actively on relatively clean and sandy beaches. The other species (C. rotundicauda) was not reported in these areas.However, during the survey...
DEFF Research Database (Denmark)
Møller, Henrik S.; Jensen, Karin G.; Kuijpers, Antoon
2006-01-01
Sedimentological and geochemical (XRF) data together with information from diatom and benthic foraminifera records of a 3.5 m long gravity core from Ameralik fjord, southern West Greenland, is used for reconstructing late Holocene environmental changes in this area. The changes are linked...... to large-scale North Atlantic ocean and climate variability. AMS 14C-dating of benthic foraminifera indicates that the sediment core covers the last 4400 years and may include the termination of the Holocene Thermal Maximum (HTM). The late HTM (4.4-3.2 ka BP) is characterized by high accumulation rates...
2012-10-10
... ACI, AGNC, AMLN, AMZN, ANR, APA, ARNA, ATPG, AUY, BAX, BTU, CLF, COP, CRM, CVX, DAL, DD, DE, DIS, DOW... because members would benefit from clear guidance in the fee schedule that describes the manner in which...
DEFF Research Database (Denmark)
Erdle, Benjamin; Herrmann, Simon; Porichis, Stella
2017-01-01
BACKGROUND: Little is known about long-term sporting activity after periosteal autologous chondrocyte implantation (ACI-P) and its correlation to clinical, morphological, and ultrastructural cartilage characteristics on magnetic resonance imaging (MRI). PURPOSE: To evaluate long-term sporting...
International Nuclear Information System (INIS)
Koh, Kyungtaek; Kim, Dogyeum; Park, Chunjin; Ryu, Gumsung; Park, Jungjun; Lee, Janghwa
2013-01-01
Concrete undergoing early frost damage in cold weather will experience significant loss of not only strength, but also of permeability and durability. Accordingly, concrete codes like ACI-306R prescribe a minimum compressive strength and duration of curing to prevent frost damage at an early age and secure the quality of concrete. Such minimum compressive strength and duration of curing are mostly defined based on the strength development of concrete. However, concrete subjected to frost damage at early age may not show a consistent relationship between its strength and durability. Especially, since durability of concrete is of utmost importance in nuclear power plant structures, this relationship should be imperatively clarified. Therefore, this study verifies the feasibility of the minimum compressive strength specified in the codes like ACI-306R by evaluating the strength development and the durability preventing the frost damage of early age concrete for nuclear power plant. The results indicate that the value of 5 MPa specified by the concrete standards like ACI-306R as the minimum compressive strength to prevent the early frost damage is reasonable in terms of the strength development, but seems to be inappropriate in the viewpoint of the resistance to chloride ion penetration and freeze-thaw. Consequently, it is recommended to propose a minimum compressive strength preventing early frost damage in terms of not only the strength development, but also in terms of the durability to secure the quality of concrete for nuclear power plants in cold climates
Varnet, Léo; Meunier, Fanny; Trollé, Gwendoline; Hoen, Michel
2016-01-01
A vast majority of dyslexic children exhibit a phonological deficit, particularly noticeable in phonemic identification or discrimination tasks. The gap in performance between dyslexic and normotypical listeners appears to decrease into adulthood, suggesting that some individuals with dyslexia develop compensatory strategies. Some dyslexic adults however remain impaired in more challenging listening situations such as in the presence of background noise. This paper addresses the question of the compensatory strategies employed, using the recently developed Auditory Classification Image (ACI) methodology. The results of 18 dyslexics taking part in a phoneme categorization task in noise were compared with those of 18 normotypical age-matched controls. By fitting a penalized Generalized Linear Model on the data of each participant, we obtained his/her ACI, a map of the time-frequency regions he/she relied on to perform the task. Even though dyslexics performed significantly less well than controls, we were unable to detect a robust difference between the mean ACIs of the two groups. This is partly due to the considerable heterogeneity in listening strategies among a subgroup of 7 low-performing dyslexics, as confirmed by a complementary analysis. When excluding these participants to restrict our comparison to the 11 dyslexics performing as well as their average-reading peers, we found a significant difference in the F3 onset of the first syllable, and a tendency of difference on the F4 onset, suggesting that these listeners can compensate for their deficit by relying upon additional allophonic cues.
Lean Manufacturing Auto Cluster at Chennai
Bhaskaran, E.
2012-10-01
Due the presence of lot of automotive Industry, Chennai is known as Detroit of India, that producing over 40 % of the Indian vehicle and components. Lean manufacturing concepts have been widely recognized as an important tool in improving the competitiveness of industries. This is a continuous process involving everyone, starting from management to the shop floor. Automotive Component Industries (ACIs) in Ambattur Industrial Estate, Chennai has formed special purpose vehicle (SPV) society namely Ambattur Industrial Estate Manufacturers Association (AIEMA) Technology Centre (ATC) lean manufacturing cluster (ATC-LMC) during July 2010 under lean manufacturing competitiveness scheme, that comes under National Manufacturing Competitiveness Programme of Government of India. The Tripartite Agreement is taken place between National Productivity Council, consultants and cluster (ATC-LMC). The objective is to conduct diagnostic study, study on training and application of various lean manufacturing techniques and auditing in ten ACIs. The methodology adopted is collection of primary data/details from ten ACIs. In the first phase, diagnostic study is done and the areas for improvement in each of the cluster member companies are identified. In the second phase, training programs and implementation is done on 5S and other areas. In the third phase auditing is done and found that the lean manufacturing techniques implementation in ATC-LMC is sustainable and successful in every cluster companies, which will not only enhance competitiveness but also decrease cost, time and increase productivity. The technical efficiency of LMC companies also increases significantly.
Macmull, Simon; Jaiswal, Parag K; Bentley, George; Skinner, John A; Carrington, Richard W J; Briggs, Tim W R
2012-07-01
Chondromalacia patella is a distinct clinical entity of abnormal softening of the articular cartilage of the patella, which results in chronic retropatellar pain. Its aetiology is still unclear but the process is thought to be a due to trauma to superficial chondrocytes resulting in a proteolytic enzymic breakdown of the matrix. Our aim was to assess the effectiveness of autologous chondrocyte implantation on patients with a proven symptomatic retropatellar lesion who had at least one failed conventional marrow-stimulating therapy. We performed chondrocyte implantation on 48 patients: 25 received autologous chondrocyte implantation with a type I/III membrane (ACI-C) method (Geistlich Biomaterials, Wolhusen, Switzerland), and 23 received the Matrix-assisted Chondrocyte Implantation (MACI) technique (Genzyme, Kastrup, Denmark). Over a mean follow-up period of 40.3 months, there was a statistically significant improvement in subjective pain scoring using the visual analogue scale (VAS) and objective functional scores using the Modified Cincinnati Rating System (MCS) in both groups. Chondromalacia patellae lesions responded well to chondrocyte implantation. Better results occurred with MACI than with ACI-C. Excellent and good results were achieved in 40% of ACI-C patients and 57% of MACI patients, but success of chondrocyte implantation was greater with medial/odd-facet lesions. Given that the MACI procedure is technically easier and less time consuming, we consider it to be useful for treating patients with symptomatic chondral defects secondary to chondromalacia patellae.
Lahariya, Chandrakant; Mishra, Ashok; Nandan, Deoki; Gautam, Praveen; Gupta, Sanjay
2011-01-01
Conditional Cash Transfer (CCT) schemes have shown largely favorable changes in the health seeking behavior. This evaluation study assesses the process and performance of an Additional Cash Incentive (ACI) scheme within an ongoing CCT scheme in India, and document lessons. A controlled before and during design study was conducted in Madhya Pradesh state of India, from August 2007 to March 2008, with increased in institutional deliveries as a primary outcome. In depth interviews, focus group discussions and household surveys were done for data collection. Lack of awareness about ACI scheme amongst general population and beneficiaries, cumbersome cash disbursement procedure, intricate eligibility criteria, extensive paper work, and insufficient focus on community involvement were the major implementation challenges. There were anecdotal reports of political interference and possible scope for corruption. At the end of implementation period, overall rate of institutional deliveries had increased in both target and control populations; however, the differences were not statistically significant. No cause and effect association could be proven by this study. Poor planning and coordination, and lack of public awareness about the scheme resulted in low utilization. Thus, proper IEC and training, detailed implementation plan, orientation training for implementer, sufficient budgetary allocation, and community participation should be an integral part for successful implementation of any such scheme. The lesson learned this evaluation study may be useful in any developing country setting and may be utilized for planning and implementation of any ACI scheme in future.
CHANDRA OBSERVATION OF THE TeV SOURCE HESS J1834-087
International Nuclear Information System (INIS)
Misanovic, Zdenka; Kargaltsev, Oleg; Pavlov, George G.
2011-01-01
Chandra ACIS observed the field of the extended TeV source HESS J1834-087 for 47 ks. A previous XMM-Newton EPIC observation of the same field revealed a point-like source (XMMU J183435.3-084443) and an offset region of faint extended emission. In the low-resolution, binned EPIC images the two appear to be connected. However, the high-resolution Chandra ACIS images do not support the alleged connection. In these images, XMMU J183435.3-084443 is resolved into a point source, CXOU J183434.9-084443 (L 0.5-8keV ≅ 2.3 x 10 33 erg s -1 , for a distance of 4 kpc; photon index Γ ≅ 1.1), and a compact (∼ 0.5-8keV ≅ 4.1 x 10 33 erg s -1 , Γ ≅ 2.7). The nature of the nebula is uncertain. We discuss a dust scattering halo and a pulsar-wind nebula as possible interpretations. Based on our analysis of the X-ray data, we re-evaluate the previously suggested interpretations of HESS J1834-087 and discuss a possible connection to the Fermi Large Area Telescope source 1FGL J1834.3-0842c. We also obtained an upper limit of 3 x 10 -14 erg cm -2 s -1 on the unabsorbed flux of the SGR J1833-0832 (in quiescence), which happened to be in the ACIS field of view.
Energy Technology Data Exchange (ETDEWEB)
Koh, Kyungtaek; Kim, Dogyeum; Park, Chunjin; Ryu, Gumsung; Park, Jungjun; Lee, Janghwa [Korea Institute Construction Technology, Goyang (Korea, Republic of)
2013-06-15
Concrete undergoing early frost damage in cold weather will experience significant loss of not only strength, but also of permeability and durability. Accordingly, concrete codes like ACI-306R prescribe a minimum compressive strength and duration of curing to prevent frost damage at an early age and secure the quality of concrete. Such minimum compressive strength and duration of curing are mostly defined based on the strength development of concrete. However, concrete subjected to frost damage at early age may not show a consistent relationship between its strength and durability. Especially, since durability of concrete is of utmost importance in nuclear power plant structures, this relationship should be imperatively clarified. Therefore, this study verifies the feasibility of the minimum compressive strength specified in the codes like ACI-306R by evaluating the strength development and the durability preventing the frost damage of early age concrete for nuclear power plant. The results indicate that the value of 5 MPa specified by the concrete standards like ACI-306R as the minimum compressive strength to prevent the early frost damage is reasonable in terms of the strength development, but seems to be inappropriate in the viewpoint of the resistance to chloride ion penetration and freeze-thaw. Consequently, it is recommended to propose a minimum compressive strength preventing early frost damage in terms of not only the strength development, but also in terms of the durability to secure the quality of concrete for nuclear power plants in cold climates.
Discovery of the third transient X-ray binary in the galactic globular cluster Terzan 5
Energy Technology Data Exchange (ETDEWEB)
Bahramian, Arash; Heinke, Craig O.; Sivakoff, Gregory R.; Gladstone, Jeanette C. [Department of Physics, University of Alberta, CCIS 4-183, Edmonton, AB T6G 2E1 (Canada); Altamirano, Diego; Wijnands, Rudy [Astronomical Institute " Anton Pannekoek," University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 70 Vassar Street, Cambridge, MA 02139 (United States); Linares, Manuel [Instituto de Astrofísica de Canarias, c/Vía Láctea s/n, E-38205 La Laguna, Tenerife (Spain); Pooley, David [Department of Physics, Sam Houston State University, Huntsville, TX 77341 (United States); Degenaar, Nathalie, E-mail: bahramia@ualberta.ca [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States)
2014-01-10
We report and study the outburst of a new transient X-ray binary (XRB) in Terzan 5, the third detected in this globular cluster, Swift J174805.3-244637 or Terzan 5 X-3. We find clear spectral hardening in Swift/XRT data during the outburst rise to the hard state, thanks to our early coverage (starting at L{sub X} ∼ 4 × 10{sup 34} erg s{sup –1}) of the outburst. This hardening appears to be due to the decline in relative strength of a soft thermal component from the surface of the neutron star (NS) during the rise. We identify a Type I X-ray burst in Swift/XRT data with a long (16 s) decay time, indicative of hydrogen burning on the surface of the NS. We use Swift/BAT, MAXI/GSC, Chandra/ACIS, and Swift/XRT data to study the spectral changes during the outburst, identifying a clear hard-to-soft state transition. We use a Chandra/ACIS observation during outburst to identify the transient's position. Seven archival Chandra/ACIS observations show evidence for variations in Terzan 5 X-3's nonthermal component but not the thermal component during quiescence. The inferred long-term time-averaged mass accretion rate, from the quiescent thermal luminosity, suggests that if this outburst is typical and only slow cooling processes are active in the NS core, such outbursts should recur every ∼10 yr.
An intergalactic absorbing cloud in the neighbourhood of the North galactic pole
International Nuclear Information System (INIS)
Murawski, W.
1983-01-01
The purpose of this investigation is to study the possibility that the lack of galaxies in the area between the Virgo and Coma clusters, to which OKROY (1965) drew attention, is due to an intergalactic cloud. Using Zwicky's Catalogue of Galaxies and Clusters of Galaxies, it is shown that there is a shortage of galaxies in the suspected area for all magnitude classes. The absorption of the cloud is calculated to be 0.45+-05 mag. A quantity called the areal colour index (ACI) is introduced and defined as ACI=a sub(b) b sub(b)/(a sub(r) b sub(r)) where a and b are the lengths of the major and minor axes of a galaxy, respectively, and the subscripts b and r respectively refer to measurements on the blue and red prints of the Palomar survey, given in the Uppsala Catalogue of Galaxies. The average ACI is found to be 1.25 for the control area, and 1.04 for the area covered by Okroy's alleged obscuring cloud. On the basis of this colour data an approximate map showing the shape of the cloud is given. The effect of the alleged cloud on the shape frequency of types of galaxies is discussed. It is found that the cloud significantly increases the ratio of elliptical and dwarf galaxies to SO's. The determination of the distance to the cloud and its density is discussed. (author)
Controlled low strength materials (CLSM), reported by ACI Committee 229
International Nuclear Information System (INIS)
Rajendran, N.
1997-01-01
Controlled low-strength material (CLSM) is a self-compacted, cementitious material used primarily as a backfill in lieu of compacted fill. Many terms are currently used to describe this material including flowable fill, unshrinkable fill, controlled density fill, flowable mortar, flowable fly ash, fly ash slurry, plastic soil-cement, soil-cement slurry, K-Krete and other various names. This report contains information on applications, material properties, mix proportioning, construction and quality-control procedures. This report's intent is to provide basic information on CLSM technology, with emphasis on CLSM material characteristics and advantages over conventional compacted fill. Applications include backfills, structural fills, insulating and isolation fills, pavement bases, conduit bedding, erosion control, void filling, and radioactive waste management
Determination of niobium with p-arsonophenylazochromotropic acied and cetylpyridinium bromide
International Nuclear Information System (INIS)
Sanz-Medel, A.; Camara Rica, C.; Perez-Bustamante, J.A.
1980-01-01
Color stabilization and modification of the visible spectrum of the p-arsonophenylazochromotropic acid (L) and Nb(V) binary complex by the addition of surfactants has been studied in the course of a search for improved spectrophotometric methods for niobium. Addition of cationic surfactants resulted in an effective means of color stabilization and brought about a drastic improvement in the intensity of the absorption band maximum (sensitized reactions). The surfactant which gave the most intense absorption band maximum was cetylpyridinium bromide (CPAB). Spectrophotometric measurements indicate the formation of two Nb-L-CPAB ion-association ternary complexes: a complex with the stoichiometry 1:2:4 was formed in approximately 1 M HCl. The other complex had the stoichiometry 1:1:2 and formed in 2 to 4 M HCl mediums. Both ternary complexes mentioned can be applied to the spectrophotometric determination of niobium and two different analytical methods have been established: the complex formed in a 1.0 M HCl medium provides a method less selective than the complex formed in 2 to 4 M HCl. The method provided by the former complex is sensitive (epsilon = 1.87 x 10 4 L mol -1 cm -1 ), has a working range of 0.5 to 5 ppm Nb, and has a relative standard deviation of 0.5%. The complex formed in the higher acidity range provides a less sensitive method. The working range is 1 to 9 ppm and epsilon = 7.40 x 10 3 L mol -1 cm -1 . This latter method is most adequate for a selective spectrophotometric determination of niobium (relative standard deviation being 0.5%). 5 figures, 2 tables
Autogenous Deformation of Concrete
DEFF Research Database (Denmark)
Autogenous deformation of concrete can be defined as the free deformation of sealed concrete at a constant temperature. A number of observed problems with early age cracking of high-performance concretes can be attributed to this phenomenon. During the last 10 years , this has led to an increased...... focus on autogenous deformation both within concrete practice and concrete research. Since 1996 the interest has been significant enough to hold international, yearly conferences entirely devoted to this subject. The papers in this publication were presented at two consecutive half-day sessions...... at the American Concrete Institute’s Fall Convention in Phoenix, Arizona, October 29, 2002. All papers have been reviewed according to ACI rules. This publication, as well as the sessions, was sponsored by ACI committee 236, Material Science of Concrete. The 12 presentations from 8 different countries indicate...
development of optimized s hollow block with block with ment
African Journals Online (AJOL)
eobe
optimize the design computation process the design ... acy is checked using the control factors. Finally a ... utation process which takes the desired property of the mix, and generat of the mix ...... We recall our statistical hypothesis as follows: 1.
Influence of amino acids on the phytotoxicity of 2-benzoxazolinone on Lemna paucicostata
2-Benzoxazolinone (BOA) is a phytotoxic compound that induces strong effects on plant metabolism. BOA effects include increased membrane permeability, degradation of proteins and pigments, increased lipid peroxidation, oxidative stress and senescence induction. In this work, the effects of amino aci...
The Efficacy of Foreign Assistance in Counter Narcotics
2013-03-01
ACI Were Initiated. ...........................................................................................................15 Figure 3. Coffee ...Crop Reduction Components)...................................................................................25 Table 6. Colombian Coffee Prices in U.S...drug trafficking. Due to the covert nature of narcotics transactions, scholars are limited to estimations based on coca, poppy, and cannabis
Characterization of some enzymatic properties of recombinant α ...
African Journals Online (AJOL)
edoja
The optimal pH and temperature for glucosidase activity of the enriched rAciHBGase. III were pH 5.0 and ... (honey producing or not) requirement of honeybees for the α-glucosidase ..... the Hitachi Scholarship Foundation, the 90th Anniversary.
Lifescience Database Archive (English)
Full Text Available Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda
Lifescience Database Archive (English)
Full Text Available Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein upda
Wang, Hong
2015-06-26
Perovskite solar cells are very promising for practical applications owing to their rapidly rising power conversion efficiency and low cost of solution-based processing. 2,2’,7,7’-tetrakis-(N,N-di-p-methoxyphenylamine) 9,9’-spirobifluorene (Spiro-OMeTAD) is most widely used as hole transporting material (HTM) in perovskite solar cells. However, the tedious synthesis and high cost of Spiro-OMeTAD inhibit its commercial-scale application in the photovoltaic industry. In this article, we report a carbazole-based compound (R01) as a new HTM in efficient perovskite solar cells. R01 is synthesized via a facile route consisting of only two steps from inexpensive commercially available materials. Furthermore, R01 exhibits higher hole mobility and conductivity than the state-of-the-art Spiro-OMeTAD. Perovskite solar cells fabricated with R01 produce a power conversion efficiency of 12.03%, comparable to that obtained in devices using Spiro-OMeTAD in this study. Our findings underscore R01 as a highly promising HTM with high performance, and its facile synthesis and low cost may facilitate the large-scale applications of perovskite solar cells.
Directory of Open Access Journals (Sweden)
Xinzheng Zhang
2017-01-01
Full Text Available Skill learning autonomously through interactions with the environment is a crucial ability for intelligent robot. A perception-action integration or sensorimotor cycle, as an important issue in imitation learning, is a natural mechanism without the complex program process. Recently, neurocomputing model and developmental intelligence method are considered as a new trend for implementing the robot skill learning. In this paper, based on research of the human brain neocortex model, we present a skill learning method by perception-action integration strategy from the perspective of hierarchical temporal memory (HTM theory. The sequential sensor data representing a certain skill from a RGB-D camera are received and then encoded as a sequence of Sparse Distributed Representation (SDR vectors. The sequential SDR vectors are treated as the inputs of the perception-action HTM. The HTM learns sequences of SDRs and makes predictions of what the next input SDR will be. It stores the transitions of the current perceived sensor data and next predicted actions. We evaluated the performance of this proposed framework for learning the shaking hands skill on a humanoid NAO robot. The experimental results manifest that the skill learning method designed in this paper is promising.
Kohnehpoushi, Saman; Nazari, Pariya; Abdollahi Nejand, Bahram; Eskandari, Mehdi
2018-05-01
In this work MoS2 thin film was studied as a potential two-dimensional (2D) hole-transporting material for fabrication of low-cost, durable and efficient perovskite solar cells. The thickness of MoS2 was studied as a potential factor in reaching high power conversion efficiency in perovskite solar cells. The thickness of the perovskite layer and the different metal back contacts gave distinct photovoltaic properties to the designed cells. The results show that a single sheet of MoS2 could considerably improve the power conversion efficacy of the device from 10.41% for a hole transport material (HTM)-free device to 20.43% for a device prepared with a 0.67 nm thick MoS2 layer as a HTM. On the back, Ag and Al collected the carriers more efficiently than Au due to the value of their metal contact work function with the TiO2 conduction band. The present work proposes a new architecture for the fabrication of low-cost, durable and efficient perovskite solar cells made from a low-cost and robust inorganic HTM and electron transport material.
Wang, Hong; Sheikh, Arif D.; Feng, Quanyou; Li, Feng; Chen, Yin; Yu, Weili; Alarousu, Erkki; Ma, Chun; Haque, Mohammed; Shi, Dong; Wang, Zhong-Sheng; Mohammed, Omar F.; Bakr, Osman; Wu, Tao
2015-01-01
Perovskite solar cells are very promising for practical applications owing to their rapidly rising power conversion efficiency and low cost of solution-based processing. 2,2’,7,7’-tetrakis-(N,N-di-p-methoxyphenylamine) 9,9’-spirobifluorene (Spiro-OMeTAD) is most widely used as hole transporting material (HTM) in perovskite solar cells. However, the tedious synthesis and high cost of Spiro-OMeTAD inhibit its commercial-scale application in the photovoltaic industry. In this article, we report a carbazole-based compound (R01) as a new HTM in efficient perovskite solar cells. R01 is synthesized via a facile route consisting of only two steps from inexpensive commercially available materials. Furthermore, R01 exhibits higher hole mobility and conductivity than the state-of-the-art Spiro-OMeTAD. Perovskite solar cells fabricated with R01 produce a power conversion efficiency of 12.03%, comparable to that obtained in devices using Spiro-OMeTAD in this study. Our findings underscore R01 as a highly promising HTM with high performance, and its facile synthesis and low cost may facilitate the large-scale applications of perovskite solar cells.
2006-01-01
As announced in the Bulletin during the summer, the Pension Fund has published a complete new version of the Fund's Rules and Regulations incorporating all amendments up to 1 November 2006, following the decisions of the CERN Council. This new version of the Rules and Regulations can be downloaded in A4 format (pdf document) directly from the Pension Fund's website (http://pensions.web.cern.ch/Pensions/statuts___rules.htm for the Rules and http://pensions.web.cern.ch/Pensions/règlements___regulations.htm for the Regulations) or obtained from the Fund Administration (Tel. 022 767 27 42, Building 5, 1-030, or by e-mail Sophia.Revol@cern.ch).
Aircraft-measured indirect cloud effects from biomass burning smoke in the Arctic and subarctic
Directory of Open Access Journals (Sweden)
L. M. Zamora
2016-01-01
Full Text Available The incidence of wildfires in the Arctic and subarctic is increasing; in boreal North America, for example, the burned area is expected to increase by 200–300 % over the next 50–100 years, which previous studies suggest could have a large effect on cloud microphysics, lifetime, albedo, and precipitation. However, the interactions between smoke particles and clouds remain poorly quantified due to confounding meteorological influences and remote sensing limitations. Here, we use data from several aircraft campaigns in the Arctic and subarctic to explore cloud microphysics in liquid-phase clouds influenced by biomass burning. Median cloud droplet radii in smoky clouds were ∼ 40–60 % smaller than in background clouds. Based on the relationship between cloud droplet number (Nliq and various biomass burning tracers (BBt across the multi-campaign data set, we calculated the magnitude of subarctic and Arctic smoke aerosol–cloud interactions (ACIs, where ACI = (1∕3 × dln(Nliq∕dln(BBt to be ∼ 0.16 out of a maximum possible value of 0.33 that would be obtained if all aerosols were to nucleate cloud droplets. Interestingly, in a separate subarctic case study with low liquid water content ( ∼ 0.02 g m−3 and very high aerosol concentrations (2000–3000 cm−3 in the most polluted clouds, the estimated ACI value was only 0.05. In this case, competition for water vapor by the high concentration of cloud condensation nuclei (CCN strongly limited the formation of droplets and reduced the cloud albedo effect, which highlights the importance of cloud feedbacks across scales. Using our calculated ACI values, we estimate that the smoke-driven cloud albedo effect may decrease local summertime short-wave radiative flux by between 2 and 4 W m−2 or more under some low and homogeneous cloud cover conditions in the subarctic, although the changes should be smaller in high surface albedo regions of the
Potential influences of neglecting aerosol effects on the NCEP GFS precipitation forecast
Jiang, Mengjiao; Feng, Jinqin; Li, Zhanqing; Sun, Ruiyu; Hou, Yu-Tai; Zhu, Yuejian; Wan, Bingcheng; Guo, Jianping; Cribb, Maureen
2017-11-01
Aerosol-cloud interactions (ACIs) have been widely recognized as a factor affecting precipitation. However, they have not been considered in the operational National Centers for Environmental Predictions Global Forecast System model. We evaluated the potential impact of neglecting ACI on the operational rainfall forecast using ground-based and satellite observations and model reanalysis. The Climate Prediction Center unified gauge-based precipitation analysis and the Modern-Era Retrospective analysis for Research and Applications Version 2 aerosol reanalysis were used to evaluate the forecast in three countries for the year 2015. The overestimation of light rain (47.84 %) and underestimation of heavier rain (31.83, 52.94, and 65.74 % for moderate rain, heavy rain, and very heavy rain, respectively) from the model are qualitatively consistent with the potential errors arising from not accounting for ACI, although other factors cannot be totally ruled out. The standard deviation of the forecast bias was significantly correlated with aerosol optical depth in Australia, the US, and China. To gain further insight, we chose the province of Fujian in China to pursue a more insightful investigation using a suite of variables from gauge-based observations of precipitation, visibility, water vapor, convective available potential energy (CAPE), and satellite datasets. Similar forecast biases were found: over-forecasted light rain and under-forecasted heavy rain. Long-term analyses revealed an increasing trend in heavy rain in summer and a decreasing trend in light rain in other seasons, accompanied by a decreasing trend in visibility, no trend in water vapor, and a slight increasing trend in summertime CAPE. More aerosols decreased cloud effective radii for cases where the liquid water path was greater than 100 g m-2. All findings are consistent with the effects of ACI, i.e., where aerosols inhibit the development of shallow liquid clouds and invigorate warm-base mixed
Directory of Open Access Journals (Sweden)
Norma Suely Souto Souza
2011-11-01
Full Text Available Estimou-se a incidência cumulativa anual (ICA das doenças musculoesqueléticas incapacitantes que acometem a região cervical e/ou membros superiores (DMEMS relacionadas ao trabalho, entre trabalhadores do Regime Geral da Previdência Social (RGPS de Salvador, Bahia, Brasil. Trabalhadores que receberam benefícios por incapacidade temporária por DMEMS relacionadas ao trabalho foram considerados casos, em 2008. Os dados provêm dos sistemas administrativos do Instituto Nacional do Seguro Social (INSS e do Ministério do Trabalho e Emprego (MTE. A ICA foi de 15 por dez mil trabalhadores. Mulheres, os de menor renda e aqueles que trabalhavam no ramo de atividades financeiras e indústria de transformação tinham maior ICA-DMEMS do que os seus referentes. Mulheres com o menor rendimento (um salário mínimo: R$ 415,00 tiveram a maior ICA-DMEMS, de 123 casos por dez mil. Isso sugere desigualdade na ocorrência dessas enfermidades, indicando a necessidade de priorizar não só ações de prevenção, com foco na ergonomia e organização do trabalho, como também o diagnóstico precoce, tratamento e reabilitação profissional.This study focused on the annual cumulative incidence (ACI of disabling work-related musculoskeletal disorders affecting the neck and/or upper limbs (ULMSD among workers covered by the National Social Insurance System in the city of Salvador, Bahia State, Brazil. Cases were workers who received disability compensation benefits when unable to work due to ULMSD, during the year 2008. The data were obtained from the administrative systems of the National Social Insurance Institute and Ministry of Labor and Employment. ACI was 15 per 10,000 workers. Increased ACI of ULMSD was associated with female gender, lower income, and work in financial activities or manufacturing. Women earning the minimum wage (US$ 64.00 per month or less had the highest ACI of ULMSD (123 per 10,000, suggesting inequalities in the occurrence of these
Potential influences of neglecting aerosol effects on the NCEP GFS precipitation forecast
Directory of Open Access Journals (Sweden)
M. Jiang
2017-11-01
Full Text Available Aerosol–cloud interactions (ACIs have been widely recognized as a factor affecting precipitation. However, they have not been considered in the operational National Centers for Environmental Predictions Global Forecast System model. We evaluated the potential impact of neglecting ACI on the operational rainfall forecast using ground-based and satellite observations and model reanalysis. The Climate Prediction Center unified gauge-based precipitation analysis and the Modern-Era Retrospective analysis for Research and Applications Version 2 aerosol reanalysis were used to evaluate the forecast in three countries for the year 2015. The overestimation of light rain (47.84 % and underestimation of heavier rain (31.83, 52.94, and 65.74 % for moderate rain, heavy rain, and very heavy rain, respectively from the model are qualitatively consistent with the potential errors arising from not accounting for ACI, although other factors cannot be totally ruled out. The standard deviation of the forecast bias was significantly correlated with aerosol optical depth in Australia, the US, and China. To gain further insight, we chose the province of Fujian in China to pursue a more insightful investigation using a suite of variables from gauge-based observations of precipitation, visibility, water vapor, convective available potential energy (CAPE, and satellite datasets. Similar forecast biases were found: over-forecasted light rain and under-forecasted heavy rain. Long-term analyses revealed an increasing trend in heavy rain in summer and a decreasing trend in light rain in other seasons, accompanied by a decreasing trend in visibility, no trend in water vapor, and a slight increasing trend in summertime CAPE. More aerosols decreased cloud effective radii for cases where the liquid water path was greater than 100 g m−2. All findings are consistent with the effects of ACI, i.e., where aerosols inhibit the development of shallow liquid clouds and
Lifescience Database Archive (English)
Full Text Available rgic rhinitis: current options and future perspectives. ... JOURNAL ... Curr Opin Allergy Clin Immunol 14:168-76 (2014) DOI:10.1097/ACI.0000000000000043 ...5 ... PMID:24535140 (drug) ... AUTHORS ... Braido F, Arcadipane F, Marugo F, Hayashi M, Pawankar R ... TITLE ... Alle
2008-02-01
The objective of the proposed research project is to compare the results of two recently introduced nondestructive load test methods to the existing 24-hour load test method described in Chapter 20 of ACI 318-05. The two new methods of nondestructive...
Previous children's studies in North America and Germany have shown that ambient sulfate particles are associated with an increased prevalence of bronchitis and decreased lung function. We have now investigated the ability of dietary intake of anti-inflammatory omega-3 fatty aci...
Pons, Patricia; Jaen, Javier; Catala, Alejandro
2017-01-01
User-centered design applied to non-human animals is showing to be a promising research line known as Animal Computer Interaction (ACI), aimed at improving animals' wellbeing using technology. Within this research line, intelligent systems for animal entertainment could have remarkable benefits for
Informe Tebeosfera 2013. La industria de la historieta en España en 2013
Directory of Open Access Journals (Sweden)
Manuel Barrero
2014-03-01
Full Text Available Anual report of the Tebeosfera Cultural Association (ACyT about the Spanish comics industry, based on the data from the Gran Catálogo de la Historieta (Spanish greatest comics catalog for all the titles distributed in Spain in 2013.
Mammary analogue secretory carcinoma (MASC) of salivary gland in four Mexican patients.
Serrano-Arévalo, Mónica L; Mosqueda-Taylor, Adalberto; Domínguez-Malagón, Hugo; Michal, Michal
2015-01-01
The Clinco-pathological, immunohistochemical and molecular findings of four cases of Mammary Analogue Secretory Carcinoma (MASC) of salivary glands found in Mexico are described. The cases were extracted from 253 salivary gland tumors from a single institution in Mexico City. The 85 Candidates for initial selection were: low grade mucoepidermoid carcinoma (MEC) (N=70 ), Acinic cell cancinoma (AciCC) (N=14), papillary cystadenocarcinoma (N=1), and adenocarcinoma NOS (N=0). Tumors with some histological features consistent with MASC (N= 17, 6.7%) were studied by immunohistochemistry for mammaglobin, STAT5, and S-100 protein and four cases were positive (1.5%), thus the diagnosis of MASC was established, and these were submitted for molecular studies for ETV6-NTRK3. Fusion gene was demonstrated in three cases, two had been erroneously diagnosed as poorly granulated AciCC, and one as low grade MEC with microcystic pattern. Female gender predominated (3:1); one occurred in the parotid, two in minor salivary glands and one in the submaxillary gland; infiltrating borders, atypical mitosis and lymph node metastases were seen in the parotideal tumor. Two patients with major salivary gland tumors are alive and well at 10 and 20 months respectively, the two patients with minor salivary gland tumors are lost. It can be concluded that is important to think in MASC in poorly granulated AciCC and low grade MEC with microcystic pattern. Immunohistochemisty studies confirm the diagnosis, preferentially supported by molecular studies. MASC may follow aggressive behavior or transform into a high grade neoplasm.
Lewis base additives improve the zeolite ferrierite-catalyzed synthesis of isostearic acid
Isostearic acid (IA) is of interest for industrial purposes especially in the area of biolubricants, such as cosmetics and slip additives for polyolefin and related copolymer films. This study was designed to develop a zeolitic catalysis process for IA production through isomerization of fatty aci...
The sophorolipids are a group of O-acylsophorose-based biosurfactants produced by several yeasts of the Starmerella clade. The known sophorolipids are typically partially acetylated 2-O-ß-D-glucopyranosyl-D-glucopyranose (sophorose) ß-O-glycosidically-linked to 17-L-hydroxy-delta-9-octadecenoic aci...
Lifescience Database Archive (English)
Full Text Available 17395579 Innate immunity minireview series: making biochemical sense of nucleic aci...007 Mar 29. (.png) (.svg) (.html) (.csml) Show Innate immunity minireview series: making biochemical sense o...itle Innate immunity minireview series: making biochemical sense of nucleic acidsensors that trigger antivir
Animal-Computer Interaction: Animal-Centred, Participatory, and Playful Design
Pons, Patricia; Hirskyj-Douglas, Ilyena; Nijholt, Antinus; Cheok, Adrian D.; Spink, Andrew; Riedel, Gernot; Zhou, Liting; Teekens, Lisanne; Albatal, Rami; Gurrin, Cathal
In recent years there has been growing interest in developing technology to improve animal's wellbeing and to support the interaction of animals within the digital world. The field of Animal-Computer Interaction (ACI) considers animals as the end-users of the technology being developed, orienting
Genetics Home Reference: familial hemophagocytic lymphohistiocytosis
... lymphohistiocytosis. Haematologica. 2010 Apr;95(4):538-41. doi: 10.3324/haematol.2009.019562. Citation on PubMed ... Clin Immunol. 2011 Dec;11(6):512-6. doi: 10.1097/ACI.0b013e32834c22f5. Review. Citation on PubMed ...
40 CFR 265.443 - Design and operating requirements.
2010-07-01
... standards established by professional organizations generally recognized by industry such as the American Concrete Institute (ACI) and the American Society of Testing Materials (ASTM) in judging the structural..., climatic conditions, the stress of installation, and the stress of daily operations, e.g., variable and...
40 CFR 264.573 - Design and operating requirements.
2010-07-01
... professional organizations generally recognized by the industry such as the American Concrete Institute (ACI) or the American Society of Testing and Materials (ASTM) in judging the structural integrity..., climatic conditions, the stress of daily operations, e.g., variable and moving loads such as vehicle...
Inventory management with advance capacity information
Jaksic, M.; Fransoo, J.C.; Tan, T.; Kok, de A.G.; Rusjan, B.
2011-01-01
An important aspect of supply chain management is dealing with demand and supply uncertainty. The uncertainty of future supply can be reduced if a company is able to obtain advance capacity information (ACI) about future supply/production capacity availability from its supplier. We address a
Wu, Ling; Prins, H.J.; Leijten, Jeroen Christianus Hermanus; Helder, M.; Evseenko, D.; Moroni, L; van Blitterswijk, Clemens; Lin, Y.; Karperien, Hermanus Bernardus Johannes
2016-01-01
Partly replacement of chondrocytes by stem cells has been proposed to improve the performance of autologous chondrocytes implantation (ACI). Our previous studies showed that the increased cartilage production in pellet co-cultures of chondrocytes and mesenchymal stem cells (MSCs) is due to a trophic
Solution-Processed hybrid Sb2 S3 planar heterojunction solar cell
Huang, Wenxiao; Borazan, Ismail; Carroll, David
Thin-film solar cells based on inorganic absorbers permit a high efficiency and stability. Among or those absorber candidates, recently Sb2S3 has attracted extensive attention because of its suitable band gap (1.5eV ~1.7 eV) , strong optical absorption, low-cost and earth-abundant constituents. Currently high-efficiency Sb2S3 solar cells have absorber layer deposited on nanostructured TiO2 electrodes in combination with organic hole transport material (HTM) on top. However it's challenging to fill the nanostructured TiO2 layer with Sb2S3 and subsequently by HTM, this leads to uncovered surface permits charge recombination. And the existing of Sb2S3/TiO2/HTM triple interface will enhance the recombination due to the surface trap state. Therefore, a planar junction cell would not only have simpler structure with less steps to fabricate but also ideally also have a higher open circuit voltage because of less interface carrier recombination. By far there is limited research focusing on planar Sb2S3 solar cell, so the feasibility is still unclear. Here, we developed a low-toxic solution method to fabricate Sb2S3 thin film solar cell, then we studied the morphology of the Sb2S3 layer and its impact to the device performance. The best device with a structure of FTO/TiO2/Sb2S3/P3HT/Ag has PCE over 5% which is similar or higher than yet the best nanostructure devices with the same HTM. Furthermore, based on solution engineering and surface modification, we improved the Sb2S3 film quality and achieved a record PCE. .
Evaluating CO2 and CH4 dynamics of Alaskan ecosystems during the Holocene Thermal Maximum
He, Yujie; Jones, Miriam C.; Zhuang, Qianlai; Bochicchio, Christopher; Felzer, B. S.; Mason, Erik; Yu, Zicheng
2014-01-01
The Arctic has experienced much greater warming than the global average in recent decades due to polar amplification. Warming has induced ecological changes that have impacted climate carbon-cycle feedbacks, making it important to understand the climate and vegetation controls on carbon (C) dynamics. Here we used the Holocene Thermal Maximum (HTM, 11–9 ka BP, 1 ka BP = 1000 cal yr before present) in Alaska as a case study to examine how ecosystem Cdynamics responded to the past warming climate using an integrated approach of combining paleoecological reconstructions and ecosystem modeling. Our paleoecological synthesis showed expansion of deciduous broadleaf forest (dominated by Populus) into tundra and the establishment of boreal evergreen needleleaf and mixed forest during the second half of the HTM under a warmer- and wetter-than-before climate, coincident with the occurrence of the highest net primary productivity, cumulative net ecosystem productivity, soil C accumulation and CH4 emissions. These series of ecological and biogeochemical shifts mirrored the solar insolation and subsequent temperature and precipitation patterns during HTM, indicating the importance of climate controls on C dynamics. Our simulated regional estimate of CH4 emission rates from Alaska during the HTM ranged from 3.5 to 6.4 Tg CH4 yr−1 and highest annual NPP of 470 Tg C yr−1, significantly higher than previously reported modern estimates. Our results show that the differences in static vegetation distribution maps used in simulations of different time slices have greater influence on modeled C dynamics than climatic fields within each time slice, highlighting the importance of incorporating vegetation community dynamics and their responses to climatic conditions in long-term biogeochemical modeling.
Medical device integration using mobile telecommunications infrastructure.
Moorman, Bridget A; Cockle, Richard A
2013-01-01
Financial pressures, an aging population, and a rising number of patients with chronic diseases, have encouraged the use of remote monitoring technologies. This usually entails at least one physiological parameter measurement for a clinician. Mobile telecommunication technologies lend themselves to this functionality, and in some cases, avoid some of the issues encountered with device integration. Moreover, the inherent characteristics of the mobile telecommunications infrastructure allow a coupling of business and clinical functions that were not possible before. Table I compares and contrasts some key aspect of device integration in and out of a healthcare facility. An HTM professional may be part of the team that acquires and/or manages a system using a mobile telecommunications technology. It is important for HTM professionals to ensure the data is in a standard format so that the interfaces across this system don't become brittle and break easily if one part changes. Moreover, the security and safety considerations of the system and the data should be a primary consideration in and y purchase, with attention given to the proper environmental and encryption mechanisms. Clinical engineers and other HTM professionals are unique in that they understand the patient/clinician/device interface and the need to ensure its safety and effectiveness regardless of geographical environment.
International Nuclear Information System (INIS)
Tian, Baolin; Ban, Dayan; Aziz, Hany
2013-01-01
We study the conductivity of thin films of molybdenum oxide (MoO x ) mixed with an organic hole transport material, such as N,N′-bis(naphthalen-1-yl)-N,N′-bis (phenyl)benzidine or 4′,4″-tri(N-carbazolyl)triphenylamine, in lateral test devices. Contrary to previous reports, the conductivity of the mixture is found to exceed that of neat MoO x , exhibiting ∼ 5 orders of magnitude higher conductivity in comparison to the neat films. Studies also show that the mixing enhances both hole and electron transport. The higher conductivity may be attributed to a higher concentration of “free” carriers in the mixture, as a result of the formation of a charge transfer complex between the MoO x and the hole transport material. The findings shed light on the potential of hybrid composites of inorganic and organic materials in realizing enhanced conductivity. - Highlights: • We investigate the conductivity of mixtures of MoO x and hole transport material (HTM). • Materials are studied in lateral devices instead of conventional vertical devices. • Mixing MoO x with HTM brings > 5 orders of magnitude increase in bulk conductivity. • The mixture of MoO x and HTM enhances both hole and electron transport
Melas-Kyriazi, John
2011-04-05
A detailed investigation of the effect of hole transport material (HTM) pore filling on the photovoltaic performance of solid-state dye-sensitized solar cells (ss-DSCs) and the specific mechanisms involved is reported. It is demonstrated that the efficiency and photovoltaic characteristics of ss-DSCs improve with the pore filling fraction (PFF) of the HTM, 2,2\\',7,7\\'-tetrakis-(N, N-di-p-methoxyphenylamine)9,9\\'-spirobifluorene(spiro-OMeTAD). The mechanisms through which the improvement of photovoltaic characteristics takes place were studied with transient absorption spectroscopy and transient photovoltage/photocurrent measurements. It is shown that as the spiro-OMeTAD PFF is increased from 26% to 65%, there is a higher hole injection efficiency from dye cations to spiro-OMeTAD because more dye molecules are covered with spiro-OMeTAD, an order-of-magnitude slower recombination rate because holes can diffuse further away from the dye/HTM interface, and a 50% higher ambipolar diffusion coefficient due to an improved percolation network. Device simulations predict that if 100% PFF could be achieved for thicker devices, the efficiency of ss-DSCs using a conventional rutheniumdye would increase by 25% beyond its current value. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Melas-Kyriazi, John; Ding, I-Kang; Marchioro, Arianna; Punzi, Angela; Hardin, Brian E.; Burkhard, George F.; Té treault, Nicolas; Grä tzel, Michael; Moser, Jacques-E.; McGehee, Michael D.
2011-01-01
A detailed investigation of the effect of hole transport material (HTM) pore filling on the photovoltaic performance of solid-state dye-sensitized solar cells (ss-DSCs) and the specific mechanisms involved is reported. It is demonstrated that the efficiency and photovoltaic characteristics of ss-DSCs improve with the pore filling fraction (PFF) of the HTM, 2,2',7,7'-tetrakis-(N, N-di-p-methoxyphenylamine)9,9'-spirobifluorene(spiro-OMeTAD). The mechanisms through which the improvement of photovoltaic characteristics takes place were studied with transient absorption spectroscopy and transient photovoltage/photocurrent measurements. It is shown that as the spiro-OMeTAD PFF is increased from 26% to 65%, there is a higher hole injection efficiency from dye cations to spiro-OMeTAD because more dye molecules are covered with spiro-OMeTAD, an order-of-magnitude slower recombination rate because holes can diffuse further away from the dye/HTM interface, and a 50% higher ambipolar diffusion coefficient due to an improved percolation network. Device simulations predict that if 100% PFF could be achieved for thicker devices, the efficiency of ss-DSCs using a conventional rutheniumdye would increase by 25% beyond its current value. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Mortensen, Diana; Ekstrand, Kim; Twetman, Svante
2016-01-01
, the DIAGNOdent pen and ICDAS at baseline, after bleaching, etching and placement of a clear fissure sealant. A digital radiograph was exposed at baseline. After the assessments, the actual lesion depth was histologically determined. Results : Bleaching did not affect the readings but significantly higher ACIS...
Summary of Research Academic Departments, 1987-1988
1988-12-01
to British maritime suprcm- periods in English history. The general thesis is acy and naval hegemony . The Eighth Naval History Symposium: Select...leaders additionally described of good leadership for many years, the exact qual- charismatic leaders as rugged or masculine (e.g., ilit’s required for
Inventory management with advance capacity information
Jaksic, M.; Fransoo, J.C.; Tan, T.; Kok, de A.G.; Rusjan, B.
2008-01-01
One of the important aspects of supply chain management is dealing with demand and supply uncertainty. The uncertainty of future supply can be reduced, if a company is able to obtain advance capacity information (ACI) on future supply/production capacity availability from its supplier. We address a
VizieR Online Data Catalog: The Chandra Source Catalog, Release 1.1 (Evans+ 2012)
Evans, I. N.; Primini, F. A.; Glotfelty, C. S.; Anderson, C. S.; Bonaventura, N. R.; Chen, J. C.; Davis, J. E.; Doe, S. M.; Evans, J. D.; Fabbiano, G.; Galle, E. C.; Gibbs, D. G.; Grier, J. D.; Hain, R. M.; Hall, D. M.; Harbo, P. N.; He, X.; Houck, J. C.; Karovska, M.; Kashyap, V. L.; Lauer, J.; McCollough, M. L.; McDowell, J. C.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Mossman, A. E.; Nichols, J. S.; Nowak, M. A.; Plummer, D. A.; Refsdal, B. L.; Rots, A. H.; Siemiginowska, A.; Sundheim, B. A.; Tibbetts, M. S.; van Stone, D. W.; Winkelman, S. L.; Zografou, P.
2014-01-01
This version of the catalog is release 1.1. It includes the information contained in release 1.0.1, plus point and compact source data extracted from HRC imaging observations, and catch-up ACIS observations released publicly prior to the end of 2009. (1 data file).
Ari, Timucin; Ari, Nilgun
2013-01-01
Early detection of occlusal caries in children is challenging for the dentists, because of the morphology of pit and fissures. The aim of this study was to compare in vitro the diagnostic performance of low-powered magnification with light-emitting diode headlight (LPMLED) using ICDAS-II criteria and AC Impedance Spectroscopy (ACIS) device, on occlusal surfaces of primary molars. The occlusal surfaces of 18 extracted primary molars were examined blindly by two examiners. The teeth were sectioned and examined under light microscopy using Downer's histological criteria as gold standard. Good to excellent inter- and intraexaminer reproducibility, higher sensitivity, specificity, and AUC values were achieved by LPMLED at D1 threshold. Also the relationship between histology and LPMLED was statistically significant. In conclusion visual aids have the potential to improve the performance of early caries detection and clinical diagnostics in children. Despite its potential, ACIS device should be considered as an adjunct method in detecting caries on primary teeth.
First characterisation of natural radioactivity in building materials manufactured in Albania
International Nuclear Information System (INIS)
Xhixha, G.; Ahmeti, A.; Bezzon, G. P.; Bitri, M.; Broggini, C.; Buso, G. P.; Caciolli, A.; Callegari, I.; Cfarku, F.; Colonna, T.; Fiorentini, G.; Guastaldi, E.; Mantovani, F.; Massa, G.; Menegazzo, R.; Mou, L.; Prifti, D.; Rossi Alvarez, C.; Kuqi, D. S.; Shyti, M.; Tushe, L.; Xhixha Kaceli, M.; Zyfi, A.
2013-01-01
This study focuses on the radiological characterisation of building materials manufactured in Albania by using a high resolution gamma-ray spectrometer. The average activity concentrations of 40 K , 226 Ra and 232 Th were, respectively, 644.1±64.2, 33.4 ± 6.4 and 42.2 ± 7.6 Bq kg -1 in the clay brick samples and 179.7 ± 48.9, 55.0 ± 5.8 and 17.0 ± 3.3 Bq kg -1 in the cement samples. The calculated activity concentration index (ACI), varied from 0.48±0.02 to 0.63±0.04 in the clay brick samples and from 0.29±0.03 to 0.37±0.02 in the cement samples. Based on the ACI, all of the clay brick and cement samples were categorised as A1 materials. The authors can exclude (at 3s level) any restriction of their use as bulk materials. (authors)
Karovska, Margarita
2003-09-01
The nearby system Mira AB composed of an aging AGB star (Mira A) and a WD companion (Mira B) offers a unique laboratory for studying wind accretion processes, a poorly understood phenomenon in many sources. Recent Chandra ACIS-S Obs.(70ks on 12/6/03; PI.M.Karovska) resolved for the first time the components (~0.6") in X-rays, and detected a new bright soft source (A. This is the first detection of X-rays from an AGB star. This source was not detected by ROSAT in 1993 or recently by XMM 8/03 (AAS/03,J.Kastner), and could be a transient phenomenon. Model fitting shows that the soft X-ray emission is likely several emission lines, rather then a continuum; with ACIS spectral resolution we cannot resolve or identify these lines. We propose a 40ks LETG+HRC-S obs. to identify the lines and determine the emission mechanism.
First characterisation of natural radioactivity in building materials manufactured in Albania.
Xhixha, G; Ahmeti, A; Bezzon, G P; Bitri, M; Broggini, C; Buso, G P; Caciolli, A; Callegari, I; Cfarku, F; Colonna, T; Fiorentini, G; Guastaldi, E; Mantovani, F; Massa, G; Menegazzo, R; Mou, L; Prifti, D; Rossi Alvarez, C; Sadiraj Kuqi, Dh; Shyti, M; Tushe, L; Xhixha Kaçeli, M; Zyfi, A
2013-07-01
This study focuses on the radiological characterisation of building materials manufactured in Albania by using a high-resolution gamma-ray spectrometer. The average activity concentrations of (40)K, (226)Ra and (232)Th were, respectively, 644.1±64.2, 33.4 ± 6.4 and 42.2 ± 7.6 Bq kg(-1) in the clay brick samples and 179.7 ± 48.9, 55.0 ± 5.8 and 17.0 ± 3.3 Bq kg(-1) in the cement samples. The calculated activity concentration index (ACI), varied from 0.48±0.02 to 0.63±0.04 in the clay brick samples and from 0.29±0.03 to 0.37±0.02 in the cement samples. Based on the ACI, all of the clay brick and cement samples were categorised as A1 materials. The authors can exclude (at 3σ level) any restriction of their use as bulk materials.
2013-05-09
...Fish.htm . FOR FURTHER INFORMATION CONTACT: Rich Malinowski, Southeast Regional Office, telephone 727-824-5305, email rich.malinowski@noaa.gov . SUPPLEMENTARY INFORMATION: The reef fish fishery of the...
Influence of Different Coupling Modes on the Robustness of Smart Grid under Targeted Attack
Directory of Open Access Journals (Sweden)
WenJie Kang
2018-05-01
Full Text Available Many previous works only focused on the cascading failure of global coupling of one-to-one structures in interdependent networks, but the local coupling of dual coupling structures has rarely been studied due to its complex structure. This will result in a serious consequence that many conclusions of the one-to-one structure may be incorrect in the dual coupling network and do not apply to the smart grid. Therefore, it is very necessary to subdivide the dual coupling link into a top-down coupling link and a bottom-up coupling link in order to study their influence on network robustness by combining with different coupling modes. Additionally, the power flow of the power grid can cause the load of a failed node to be allocated to its neighboring nodes and trigger a new round of load distribution when the load of these nodes exceeds their capacity. This means that the robustness of smart grids may be affected by four factors, i.e., load redistribution, local coupling, dual coupling link and coupling mode; however, the research on the influence of those factors on the network robustness is missing. In this paper, firstly, we construct the smart grid as a two-layer network with a dual coupling link and divide the power grid and communication network into many subnets based on the geographical location of their nodes. Secondly, we define node importance ( N I as an evaluation index to access the impact of nodes on the cyber or physical network and propose three types of coupling modes based on N I of nodes in the cyber and physical subnets, i.e., Assortative Coupling in Subnets (ACIS, Disassortative Coupling in Subnets (DCIS, and Random Coupling in Subnets (RCIS. Thirdly, a cascading failure model is proposed for studying the effect of local coupling of dual coupling link in combination with ACIS, DCIS, and RCIS on the robustness of the smart grid against a targeted attack, and the survival rate of functional nodes is used to assess the robustness of
Influence of Different Coupling Modes on the Robustness of Smart Grid under Targeted Attack.
Kang, WenJie; Hu, Gang; Zhu, PeiDong; Liu, Qiang; Hang, Zhi; Liu, Xin
2018-05-24
Many previous works only focused on the cascading failure of global coupling of one-to-one structures in interdependent networks, but the local coupling of dual coupling structures has rarely been studied due to its complex structure. This will result in a serious consequence that many conclusions of the one-to-one structure may be incorrect in the dual coupling network and do not apply to the smart grid. Therefore, it is very necessary to subdivide the dual coupling link into a top-down coupling link and a bottom-up coupling link in order to study their influence on network robustness by combining with different coupling modes. Additionally, the power flow of the power grid can cause the load of a failed node to be allocated to its neighboring nodes and trigger a new round of load distribution when the load of these nodes exceeds their capacity. This means that the robustness of smart grids may be affected by four factors, i.e., load redistribution, local coupling, dual coupling link and coupling mode; however, the research on the influence of those factors on the network robustness is missing. In this paper, firstly, we construct the smart grid as a two-layer network with a dual coupling link and divide the power grid and communication network into many subnets based on the geographical location of their nodes. Secondly, we define node importance ( N I ) as an evaluation index to access the impact of nodes on the cyber or physical network and propose three types of coupling modes based on N I of nodes in the cyber and physical subnets, i.e., Assortative Coupling in Subnets (ACIS), Disassortative Coupling in Subnets (DCIS), and Random Coupling in Subnets (RCIS). Thirdly, a cascading failure model is proposed for studying the effect of local coupling of dual coupling link in combination with ACIS, DCIS, and RCIS on the robustness of the smart grid against a targeted attack, and the survival rate of functional nodes is used to assess the robustness of the smart grid
3rd ACIS International Conference on Applied Computing and Information Technology
2016-01-01
This edited book presents scientific results of the 3nd International Conference on Applied Computing and Information Technology (ACIT 2015) which was held on July 12-16, 2015 in Okayama, Japan. The aim of this conference was to bring together researchers and scientists, businessmen and entrepreneurs, teachers, engineers, computer users, and students to discuss the numerous fields of computer science and to share their experiences and exchange new ideas and information in a meaningful way. Research results about all aspects (theory, applications and tools) of computer and information science, and to discuss the practical challenges encountered along the way and the solutions adopted to solve them.
Andean Counterdrug Initiative (ACI) and Related Funding Programs: FY2006 Assistance
National Research Council Canada - National Science Library
Veillette, Connie
2006-01-01
...), International Military Education and Training (IMET) funds, and other types of economic aid. Congress continues to express concern with the volume of drugs readily available in the United States and elsewhere in the world...
Andean Counterdrug Initiative (ACI) and Related Funding Programs: FY2007 Assistance
National Research Council Canada - National Science Library
Veillette, Connie
2007-01-01
...), International Military Education and Training (IMET) funds, and other types of economic aid. Congress continued to express concern with the volume of drugs readily available in the United States and elsewhere in the world...
Las ciudades como escenarios de la ensoñación
Directory of Open Access Journals (Sweden)
Carlos Carbonell
2004-11-01
Full Text Available El presente ensayo plantea una serie de consideraciones en torno a las relaciones entre la actividad turística y los imaginarios urbanos, a partir de las cuales es posible formular una lectura del turismo desde una perspectiva sociocultural. Los vínculos existentes entre itinerarios e imaginarios son analizados a la luz de la historia reciente, cuando se densificaron las redes globales de circulación, se mejoraron las tecnologías de transporte y comunicaciones y se popularizó la idea del viaje. Todos estos fenómenos confluyen en las ciudades contemporáneas, convirtiendo a las metrópolis en escenarios de encuentro entre turistas, habitantes y actores sociales que participan de diversas formas en las dinámicas generadas por el turismo y el aprovechamiento del tiempo libre, dando lugar a una reflexión sobre el papel del sector turístico en los procesos de construcción de ciudadanía.
CHANDRA ACIS SURVEY OF X-RAY POINT SOURCES: THE SOURCE CATALOG
Energy Technology Data Exchange (ETDEWEB)
Wang, Song; Liu, Jifeng; Qiu, Yanli; Bai, Yu; Yang, Huiqin; Guo, Jincheng; Zhang, Peng, E-mail: jfliu@bao.ac.cn, E-mail: songw@bao.ac.cn [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2016-06-01
The Chandra archival data is a valuable resource for various studies on different X-ray astronomy topics. In this paper, we utilize this wealth of information and present a uniformly processed data set, which can be used to address a wide range of scientific questions. The data analysis procedures are applied to 10,029 Advanced CCD Imaging Spectrometer observations, which produces 363,530 source detections belonging to 217,828 distinct X-ray sources. This number is twice the size of the Chandra Source Catalog (Version 1.1). The catalogs in this paper provide abundant estimates of the detected X-ray source properties, including source positions, counts, colors, fluxes, luminosities, variability statistics, etc. Cross-correlation of these objects with galaxies shows that 17,828 sources are located within the D {sub 25} isophotes of 1110 galaxies, and 7504 sources are located between the D {sub 25} and 2 D {sub 25} isophotes of 910 galaxies. Contamination analysis with the log N –log S relation indicates that 51.3% of objects within 2 D {sub 25} isophotes are truly relevant to galaxies, and the “net” source fraction increases to 58.9%, 67.3%, and 69.1% for sources with luminosities above 10{sup 37}, 10{sup 38}, and 10{sup 39} erg s{sup −1}, respectively. Among the possible scientific uses of this catalog, we discuss the possibility of studying intra-observation variability, inter-observation variability, and supersoft sources (SSSs). About 17,092 detected sources above 10 counts are classified as variable in individual observation with the Kolmogorov–Smirnov (K–S) criterion ( P {sub K–S} < 0.01). There are 99,647 sources observed more than once and 11,843 sources observed 10 times or more, offering us a wealth of data with which to explore the long-term variability. There are 1638 individual objects (∼2350 detections) classified as SSSs. As a quite interesting subclass, detailed studies on X-ray spectra and optical spectroscopic follow-up are needed to categorize these SSSs and pinpoint their properties. In addition, this survey can enable a wide range of statistical studies, such as X-ray activity in different types of stars, X-ray luminosity functions in different types of galaxies, and multi-wavelength identification and classification of different X-ray populations.
Choosing the right health care provider for pregnancy and childbirth
... page: //medlineplus.gov/ency/patientinstructions/000596.htm Choosing the right health care provider for pregnancy and childbirth To use the sharing features on this page, please enable JavaScript. ...
76 FR 72507 - National Emissions Standards for Hazardous Air Pollutants: Ferroalloys Production
2011-11-23
... for reference purposes, the following terms and acronyms are defined here: ACI Activated Carbon... of coke, charcoal, high- and low-volatility coal, or wood chips. Raw materials are crushed and sized... organic compounds that result from incomplete combustion of coal, coke or other fuel that is charged to...
Modeling and Control of Algae Harvesting, Dewatering and Drying (HDD) Systems
2012-05-01
concentration to 5% water based on latent heat of vaporization Algae Botryococcus braunii Chlorella vulgaris Euglena gracilis Nannochlorops is...microalga Chlorella protothecoides by heterotrophic growth in fermenters. J Biotechnol 126:499–507, 2006 [9] Acièn Fernández F-G, Garcìa Camacho F
International Nuclear Information System (INIS)
Domayer, S.E.; Welsch, G.H.; Nehrer, S.; Chiari, C.; Dorotka, R.; Szomolanyi, P.; Mamisch, T.C.; Yayon, A.; Trattnig, S.
2010-01-01
Objective: To assess repair tissue (RT) after the implantation of BioCart TM II, an autologous chondrocyte implantation (ACI) technique with a fibrin-hyaluronan polymer as scaffold. T2 mapping and delayed Gadolinium Enhanced Magnetic Resonance Imaging of Cartilage (dGEMRIC) were used to gain first data on the biochemical properties of BioCart TM II RT in vivo. Methods: T2 mapping and dGEMRIC were performed at 3 T in five patients (six knee joints) who had undergone ACI 15-27 months before. T2 maps were obtained using a pixel wise, mono-exponential non-negative least squares fit analysis. For quantitative T1 mapping a dual flip angle 3D GRE sequence was used and T1 maps were calculated pre- and post-contrast using IDL software. Subsequent region of interest analysis was carried out in comparison with morphologic MRI. Results: A spatial variation of T2 values in both hyaline, normal cartilage (NC) and RT was found. Mean RT T2 values and mean NC T2 values did not differ significantly. Relative T2 values were calculated from global RT and NC T2 and showed a small range (0.84-1.07). The relative delta relaxation rates (rΔR1) obtained from the T1 maps had a wider range (0.77-4.91). Conclusion: T2 mapping and dGEMRIC provided complementary information on the biochemical properties of the repair tissue. BioCart TM II apparently can provide RT similar to hyaline articular cartilage and may become a less-invasive alternative to ACI with a periosteal flap.
Energy Technology Data Exchange (ETDEWEB)
Otter, Sophie [Department of Clinical Oncology, Royal Marsden Hospital, Sutton and London (United Kingdom); Schick, Ulrike; Gulliford, Sarah [Department of Clinical Oncology, Royal Marsden Hospital, Sutton and London (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Lal, Punita [Sanjay Gandhi Postgraduate Institute of Medical Sciences, Lucknow India (India); Franceschini, Davide [Department of Radiotherapy and Radiosurgery, Humanitas Research Hospital, Milan (Italy); Newbold, Katie; Nutting, Christopher; Harrington, Kevin [Department of Clinical Oncology, Royal Marsden Hospital, Sutton and London (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Bhide, Shreerang, E-mail: shreerang.bhide@icr.ac.uk [Department of Clinical Oncology, Royal Marsden Hospital, Sutton and London (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Department of Radiotherapy and Radiosurgery, Humanitas Research Hospital, Milan (Italy)
2015-11-01
Purpose: The study aimed to apply the atlas of complication incidence (ACI) method to patients receiving radical treatment for head and neck squamous cell carcinomas (HNSCC), to generate constraints based on dose-volume histograms (DVHs), and to identify clinical and dosimetric parameters that predict the risk of grade 3 oral mucositis (g3OM) and pharyngeal dysphagia (g3PD). Methods and Materials: Oral and pharyngeal mucosal DVHs were generated for 253 patients who received radiation (RT) or chemoradiation (CRT). They were used to produce ACI for g3OM and g3PD. Multivariate analysis (MVA) of the effect of dosimetry, clinical, and patient-related variables was performed using logistic regression and bootstrapping. Receiver operating curve (ROC) analysis was also performed, and the Youden index was used to find volume constraints that discriminated between volumes that predicted for toxicity. Results: We derived statistically significant dose-volume constraints for g3OM over the range v28 to v70. Only 3 statistically significant constraints were derived for g3PD v67, v68, and v69. On MVA, mean dose to the oral mucosa predicted for g3OM and concomitant chemotherapy and mean dose to the inferior constrictor (IC) predicted for g3PD. Conclusions: We have used the ACI method to evaluate incidences of g3OM and g3PD and ROC analysis to generate constraints to predict g3OM and g3PD derived from entire individual patient DVHs. On MVA, the strongest predictors were radiation dose (for g3OM) and concomitant chemotherapy (for g3PD).
The 100 most influential papers about cataract surgery: a bibliometric analysis
Directory of Open Access Journals (Sweden)
Ze-Nan Lin
2017-10-01
Full Text Available AIM: To identify the 100 most cited papers in cataract surgery, we performed a comprehensive bibliometric analysis basing on the literature search on the Thomson Reuters Web of Knowledge. METHODS: The number of citations, including the total citations, latest 5y citations and average citation number per year (ACY, authorship, year of publication, major topics, journal of publication, country and institution of origin of each paper were recorded and then analyzed. Pearson’s correlation analysis was conducted to evaluate the correlation between the published year and the number of citations. The correlation between journal’s impact factor (IF and number of citations was assessed as well. RESULTS: The most cited paper was the classic paper done by the European Society of Cataract & Refractive Surgeons (ESCRS group. This paper focused on the topic of endophthalmitis. Not only the most cited papers originated from the USA, but also some American institutions like Johns Hopkins University, Harvard Medical School, etc. had the most citations. Pearson’s correlation analysis indicated that the latest 5y citations and ACY were significantly related with the published year (5y citations: r=0.615, P<0.001; ACY: r=0.657, P<0.001, whereas no association between the total number of citations and published year was found (r=0.045. Moreover, the IFs of journals were found to have no significant effect on the number of total citations. CONCLUSION: To our knowledge, this is the first study on the most influential papers in cataract surgery after a comprehensive research of relevant literatures. The present work may provide us concise information concerning the development history of cataract surgery over the past 66y.
Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.
Directory of Open Access Journals (Sweden)
Michael B Prouse
Full Text Available Despite the prominent roles played by R2R3-MYB transcription factors in the regulation of plant gene expression, little is known about the details of how these proteins interact with their DNA targets. For example, while Arabidopsis thaliana R2R3-MYB protein AtMYB61 is known to alter transcript abundance of a specific set of target genes, little is known about the specific DNA sequences to which AtMYB61 binds. To address this gap in knowledge, DNA sequences bound by AtMYB61 were identified using cyclic amplification and selection of targets (CASTing. The DNA targets identified using this approach corresponded to AC elements, sequences enriched in adenosine and cytosine nucleotides. The preferred target sequence that bound with the greatest affinity to AtMYB61 recombinant protein was ACCTAC, the AC-I element. Mutational analyses based on the AC-I element showed that ACC nucleotides in the AC-I element served as the core recognition motif, critical for AtMYB61 binding. Molecular modelling predicted interactions between AtMYB61 amino acid residues and corresponding nucleotides in the DNA targets. The affinity between AtMYB61 and specific target DNA sequences did not correlate with AtMYB61-driven transcriptional activation with each of the target sequences. CASTing-selected motifs were found in the regulatory regions of genes previously shown to be regulated by AtMYB61. Taken together, these findings are consistent with the hypothesis that AtMYB61 regulates transcription from specific cis-acting AC elements in vivo. The results shed light on the specifics of DNA binding by an important family of plant-specific transcriptional regulators.
Sykes, J G; Kuiper, J H; Richardson, J B; Roberts, S; Wright, K T; Kuiper, N J
2018-05-01
High hopes have been pinned on regenerative medicine strategies in order to prevent the progression of cartilage damage to osteoarthritis, particularly by autologous chondrocyte implantation (ACI). The loss of chondrocyte phenotype during in vitro monolayer expansion, a necessary step to obtain sufficient cell numbers, may be a key limitation in ACI. In this study, it was determined whether a shorter monolayer expansion approach could improve chondrogenic differentiation. The effects of two supplement types, foetal bovine serum (FBS) and Stemulate™ (a commercial source of human platelet lysate), on the expansion and re-differentiation potential of human chondrocytes, isolated from five individuals, were compared. Chondrocytes were expanded with 10 % FBS or 10 % Stemulate™. Pellets were cultured for 28 d in chondrogenic differentiation medium and assessed for the presence of cartilage matrix molecules and genes associated with chondrogenicity. Stemulate™ significantly enhanced the proliferation rate [average population doubling times: FBS, 25.07 ± 6.98 d (standard error of the mean, SEM) vs. Stemulate™, 13.10 ± 2.57 d (SEM)]. Sulphated glycosaminoglycans (sGAG), total collagen and qRT-PCR analyses of cartilage genes showed that FBS-expanded chondrocytes demonstrated significantly better chondrogenic capacity than Stemulate™-expanded chondrocytes. Histologically, FBS-expanded chondrocyte pellets appeared to be more stable, with a more intense staining for toluidine blue, indicating a greater chondrogenic capacity. Although Stemulate™ positively influenced chondrocyte proliferation, it had a negative effect on chondrogenic differentiation potential. This suggested that, in the treatment of cartilage defects, Stemulate™ might not be the ideal supplement for expanding chondrocytes (which maintained a chondrocyte phenotype) and, hence, for cell therapies (including ACI).
Directory of Open Access Journals (Sweden)
JG Sykes
2018-05-01
Full Text Available High hopes have been pinned on regenerative medicine strategies in order to prevent the progression of cartilage damage to osteoarthritis, particularly by autologous chondrocyte implantation (ACI. The loss of chondrocyte phenotype during in vitro monolayer expansion, a necessary step to obtain sufficient cell numbers, may be a key limitation in ACI. In this study, it was determined whether a shorter monolayer expansion approach could improve chondrogenic differentiation. The effects of two supplement types, foetal bovine serum (FBS and Stemulate™ (a commercial source of human platelet lysate, on the expansion and re-differentiation potential of human chondrocytes, isolated from five individuals, were compared. Chondrocytes were expanded with 10 % FBS or 10 % Stemulate™. Pellets were cultured for 28 d in chondrogenic differentiation medium and assessed for the presence of cartilage matrix molecules and genes associated with chondrogenicity. Stemulate™ significantly enhanced the proliferation rate [average population doubling times: FBS, 25.07 ± 6.98 d (standard error of the mean, SEM vs. Stemulate™, 13.10 ± 2.57 d (SEM]. Sulphated glycosaminoglycans (sGAG, total collagen and qRT-PCR analyses of cartilage genes showed that FBS-expanded chondrocytes demonstrated significantly better chondrogenic capacity than Stemulate™-expanded chondrocytes. Histologically, FBS-expanded chondrocyte pellets appeared to be more stable, with a more intense staining for toluidine blue, indicating a greater chondrogenic capacity. Although Stemulate™ positively influenced chondrocyte proliferation, it had a negative effect on chondrogenic differentiation potential. This suggested that, in the treatment of cartilage defects, Stemulate™ might not be the ideal supplement for expanding chondrocytes (which maintained a chondrocyte phenotype and, hence, for cell therapies (including ACI.
Energy Technology Data Exchange (ETDEWEB)
Domayer, S.E. [Department of Orthopedics, Medical University of Vienna, Waehringer Guertel 18-20, A 1090 Vienna (Austria); MR Centre of Excellence, Department of Radiodiagnostics, Medical University of Vienna, Lazarettgasse 14, A-1090 Vienna (Austria)], E-mail: stephan.domayer@meduniwien.ac.at; Welsch, G.H. [MR Centre of Excellence, Department of Radiodiagnostics, Medical University of Vienna, Lazarettgasse 14, A-1090 Vienna (Austria); Nehrer, S. [Centre of Regenerative Medicine, Danube University of Krems, Dr.-Karl-Dorrek-Strasse, 30 A-3500 Krems (Austria)], E-mail: stefan.nehrer@donau-uni.ac.at; Chiari, C.; Dorotka, R. [Department of Orthopedics, Medical University of Vienna, Waehringer Guertel 18-20, A 1090 Vienna (Austria); Szomolanyi, P. [MR Centre of Excellence, Department of Radiodiagnostics, Medical University of Vienna, Lazarettgasse 14, A-1090 Vienna (Austria); Institute of Measurement Science, Slovak Academy of Sciences, Dubravska cesta 9, 841 04 Bratislava (Slovakia); Mamisch, T.C. [Department of Orthopedics, Inselspital, University of Bern, 3010 Bern (Switzerland); Yayon, A. [ProChon Biotech Ltd., Weizmann Science Park, Nes Ziona (Israel); Trattnig, S. [MR Centre of Excellence, Department of Radiodiagnostics, Medical University of Vienna, Lazarettgasse 14, A-1090 Vienna (Austria)], E-mail: siegfried.trattnig@meduniwien.ac.at
2010-03-15
Objective: To assess repair tissue (RT) after the implantation of BioCart{sup TM}II, an autologous chondrocyte implantation (ACI) technique with a fibrin-hyaluronan polymer as scaffold. T2 mapping and delayed Gadolinium Enhanced Magnetic Resonance Imaging of Cartilage (dGEMRIC) were used to gain first data on the biochemical properties of BioCart{sup TM}II RT in vivo. Methods: T2 mapping and dGEMRIC were performed at 3 T in five patients (six knee joints) who had undergone ACI 15-27 months before. T2 maps were obtained using a pixel wise, mono-exponential non-negative least squares fit analysis. For quantitative T1 mapping a dual flip angle 3D GRE sequence was used and T1 maps were calculated pre- and post-contrast using IDL software. Subsequent region of interest analysis was carried out in comparison with morphologic MRI. Results: A spatial variation of T2 values in both hyaline, normal cartilage (NC) and RT was found. Mean RT T2 values and mean NC T2 values did not differ significantly. Relative T2 values were calculated from global RT and NC T2 and showed a small range (0.84-1.07). The relative delta relaxation rates (r{delta}R1) obtained from the T1 maps had a wider range (0.77-4.91). Conclusion: T2 mapping and dGEMRIC provided complementary information on the biochemical properties of the repair tissue. BioCart{sup TM}II apparently can provide RT similar to hyaline articular cartilage and may become a less-invasive alternative to ACI with a periosteal flap.
... this page: //medlineplus.gov/ency/article/001059.htm Periodontitis To use the sharing features on this page, please enable JavaScript. Periodontitis is inflammation and infection of the ligaments and ...
... page: //medlineplus.gov/ency/article/007307.htm Myocarditis - pediatric To use the sharing features on this page, please enable JavaScript. Pediatric myocarditis is inflammation of the heart muscle in ...
... this page: //medlineplus.gov/ency/article/007456.htm Neurosciences To use the sharing features on this page, please enable JavaScript. Neurosciences (or clinical neurosciences) refers to the branch of ...
... this page: //medlineplus.gov/ency/article/000473.htm Rhabdomyolysis To use the sharing features on this page, please enable JavaScript. Rhabdomyolysis is the breakdown of muscle tissue that leads ...
78 FR 48885 - Changes in Flood Hazard Determinations
2013-08-12
... INFORMATION CONTACT: Luis Rodriguez, Chief, Engineering Management Branch, Federal Insurance and Mitigation.... Wolff, Public Works team.com/lomrs.htm. County (13-06- Bexar County Department, 233 2069P). Judge, Paul...
Hamilton, D. S.; Carslaw, K. S.; Spracklen, D. V.; Folberth, G.; Kaplan, J. O.; Pringle, K.; Scott, C.
2015-12-01
Anthropogenic land use change (LUC) has had a major impact on the climate by altering the amount of carbon stored in vegetation, changing surface albedo and modifying the levels of both biogenic and pyrogenic emissions. While previous studies of LUC have largely focused on the first two components, there has recently been a recognition that changes to aerosol and related pre-cursor gas emissions from LUC are equally important. Furthermore, it has also recently been recognised that the pre-industrial (PI) to present day (PD) radiative forcing (RF) of climate from aerosol cloud interactions (ACI) due to anthropogenic emissions is highly sensitive to the amount of natural aerosol that was present in the PI. This suggests that anthropogenic RF from ACI may be highly sensitive to land-use in the PI. There are currently two commonly used baseline reference years for the PI; 1750 and 1860. Rapid LUC occurred between 1750 and 1860, with large reductions in natural vegetation cover in Eastern Northern America, Europe, Central Russia, India and Eastern China as well as lower reductions in parts of Brazil and Africa. This LUC will have led to significant changes in biogenic and fire emissions with implications for natural aerosol concentrations and PI-to-PD RF. The focus of this study is therefore to quantify the impact of LUC between 1750 and 1860 on aerosol concentrations and PI-to-PD RF calculations from ACI. We use the UK Met Office HadGEM3-UKCA coupled-chemistry-climate model to calculate the impacts of anthropogenic emissions and anthropogenic LUC on aerosol size distributions in both 1750 and 1860. We prescribe LUC using the KK10 historical dataset of land cover change. Monoterpene emissions are coupled directly to the prescribed LUC through the JULES land surface scheme in HadGEM3. Fire emissions from LUC were calculated offline using the fire module LPJ-LMfire in the Lund-Potsdam-Jena dynamic global vegetation model. To separate out the impacts of LUC from
Effects of Urban Wastewater Loading on Macro- and Meio-infauna ...
African Journals Online (AJOL)
Benthic infaunal community studies are a useful tool to determine the health of an ecosystem. In this study, an unbalanced ACI (After Control/Impact) design was used to compare the infaunal community structure in a contaminated peri-urban mangrove swamp with two nearby pristine mangroves of similar ecological traits in ...
Exterior beam-column joint study with non-conventional ...
Indian Academy of Sciences (India)
Reinforced concrete structures beam-column joints are the most critical regions in seismic prone areas. Proper reinforcement anchorage is essential to enhance the performance of the joints. An attempt has been made to appraise the performance of the anchorages and joints. The anchorages are detailed as per ACI-352 ...
Lifescience Database Archive (English)
Full Text Available ion characterized by mild to moderate mucocutaneous bleeding. Patients are with platelet dysfunction but nor...et P2Y12 receptor of a patient with congenital bleeding. ... JOURNAL ... Proc Natl Ac...i J, Collins PW, Watson SP, Morgan NV ... TITLE ... SLFN14 mutations underlie thrombocytopenia with excessive bleeding
O'Hare, Thomas
2005-01-01
The current study of 376 college freshman adjudicated the first time for breaking university drinking rules tested the predictive power of four alcohol consumption and problem drinking indices--recent changes in drinking (the Alcohol Change Index: ACI), heavy drinking, binge drinking index, and the Alcohol Use Disorders Identification Test (AUDIT)…
Survey of Experience Using Reinforced Concrete in Floating Marine Structures.
1983-01-01
analyzed in several steps. The load history can be simulated by .. using load increments and independent load vectors . 4.31 NTH is not only active in...NILSEN, N., " FEILD TEST OF REINFORCEMENT CORROSION IN CONCRETE", PERFORMANCE OF CONCRETE IN MARINE ENVIRONMENT, ACI SPECIAL PUBLICATION SP-65, 1980. 136
Structures to Resist the Effects of Accidental Explosions
1990-11-01
10, ARF Project No. D087, Armour Research Foundation of Illinois lnstitute of Technology. 24. Jack, W. H., Jr., Measurements of Normally Reflected...the ACI code. It is obvious then that at the supports of an element with draped tendons, d and thus the shear capacity are greatly reduced. Draped
... page: //medlineplus.gov/ency/article/007340.htm Fetal echocardiography To use the sharing features on this page, please enable JavaScript. Fetal echocardiography is a test that uses sound waves ( ultrasound ) ...
... this page: //medlineplus.gov/ency/article/001055.htm Dental cavities To use the sharing features on this page, please enable JavaScript. Dental cavities are holes (or structural damage) in the ...
... this page: //medlineplus.gov/ency/article/007228.htm Hyperglycemia - infants To use the sharing features on this page, please enable JavaScript. Hyperglycemia is abnormally high blood sugar. The medical term ...
... page: //medlineplus.gov/ency/article/003529.htm Antimitochondrial antibody To use the sharing features on this page, please enable JavaScript. Antimitochondrial antibodies (AMA) are substances ( antibodies ) that form against mitochondria. ...
Studies on Urinary Schistosomiasis in Selected Villages around ...
African Journals Online (AJOL)
1Department of Biological Sciences, Usmanu Danfodiyo University, Sokoto, Nigeria. 2Department of ... caused by blood flukes of the genus Schistosoma and ..... Teaching/5480/samplesize.htm ... Evaluation of three diagnostic techniques.
... page: //medlineplus.gov/ency/article/003270.htm Hemolytic crisis To use the sharing features on this page, please enable JavaScript. Hemolytic crisis occurs when large numbers of red blood cells ...
... bowel disease (IBD). Centers for Disease Control and Prevention. https://www.cdc.gov/ibd/what-is-IBD.htm. Accessed Nov. 15, 2017. Hyperthyroidism (Overactive thyroid). National Institute of Diabetes and Digestive ...
... this page: //medlineplus.gov/ency/article/002939.htm Hemorrhoid surgery To use the sharing features on this page, please enable JavaScript. Hemorrhoids are swollen veins around the anus. They may ...
... this page: //medlineplus.gov/ency/article/001534.htm Mathematics disorder To use the sharing features on this page, please enable JavaScript. Mathematics disorder is a condition in which a child's ...
... this page: //medlineplus.gov/ency/article/000320.htm Diabetic ketoacidosis To use the sharing features on this page, please enable JavaScript. Diabetic ketoacidosis (DKA) is a life-threatening problem that ...
... this page: //medlineplus.gov/ency/article/002579.htm Caffeine overdose To use the sharing features on this page, please enable JavaScript. Caffeine is a substance that exists naturally in certain ...
Allegheny County Soil Type Areas
Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset contains soil type and soil classification, by area. Additional info at: http://mcdc.cas.psu.edu/datawiz.htm;...
... page: //medlineplus.gov/ency/article/003741.htm Sensitivity analysis To use the sharing features on this page, please enable JavaScript. Sensitivity analysis determines the effectiveness of antibiotics against microorganisms (germs) ...
... this page: //medlineplus.gov/ency/article/001462.htm Keratosis pilaris To use the sharing features on this page, please enable JavaScript. Keratosis pilaris is a common skin condition in which ...
... page: //medlineplus.gov/ency/article/007206.htm Shoulder arthroscopy To use the sharing features on this page, please enable JavaScript. Shoulder arthroscopy is surgery that uses a tiny camera called ...
... this page: //medlineplus.gov/ency/article/003868.htm Electrocardiogram To use the sharing features on this page, please enable JavaScript. An electrocardiogram (ECG) is a test that records the electrical ...
... this page: //medlineplus.gov/ency/article/002628.htm Dextromethorphan overdose To use the sharing features on this page, please enable JavaScript. Dextromethorphan is a medicine that helps stop coughing. It ...
... this page: //medlineplus.gov/ency/article/000345.htm Craniopharyngioma To use the sharing features on this page, please enable JavaScript. A craniopharyngioma is a noncancerous (benign) tumor that develops at ...
... this page: //medlineplus.gov/ency/article/000897.htm Vulvovaginitis - overview To use the sharing features on this page, please enable JavaScript. Vulvovaginitis or vaginitis is swelling or infection of the ...
78 FR 45939 - Changes in Flood Hazard Determinations
2013-07-30
... INFORMATION CONTACT: Luis Rodriguez, Chief, Engineering Management Branch, Federal Insurance and Mitigation... Works team.com/lomrs.htm. County (13-06- Bexar County Department, 233 0089P). Judge, Paul North Pecos-La...
78 FR 14573 - Changes in Flood Hazard Determinations
2013-03-06
... INFORMATION CONTACT: Luis Rodriguez, Chief, Engineering Management Branch, Federal Insurance and Mitigation... team.com/lomrs.htm. County (13-06- Bexar County Public Works, 233 0093P). Judge, Paul North Pecos La...
... this page: //medlineplus.gov/ency/article/002534.htm Piroxicam overdose To use the sharing features on this page, please enable JavaScript. Piroxicam is a nonsteroidal anti-inflammatory drug (NSAID) used ...
... this page: //medlineplus.gov/ency/article/002480.htm Acetone poisoning To use the sharing features on this page, please enable JavaScript. Acetone is a chemical used in many household products. ...
76 FR 13453 - Marine Mammals; Incidental Take During Specified Activities
2011-03-11
....dog.dnr.state.ak.us/oil/index.htm . Industry activities may occur on state lease sales during the time... safety facilities, data recording facilities and communication equipment); building gravel pads; building...
... this page: //medlineplus.gov/ency/patientinstructions/000331.htm Immunizations - diabetes To use the sharing features on this page, please enable JavaScript. Immunizations (vaccines or vaccinations) help protect you from some ...
... this page: //medlineplus.gov/ency/article/007262.htm Lipoprotein-a To use the sharing features on this page, please enable JavaScript. Lipoproteins are molecules made of proteins and fat. They ...
... this page: //medlineplus.gov/ency/article/002655.htm Ibuprofen overdose To use the sharing features on this page, please enable JavaScript. Ibuprofen is a type of nonsteroidal anti-inflammatory drug ( ...
... this page: //medlineplus.gov/ency/article/003302.htm Short philtrum To use the sharing features on this page, please enable JavaScript. A short philtrum is a shorter than normal distance between ...
... this page: //medlineplus.gov/ency/article/003503.htm Creatine phosphokinase test To use the sharing features on this page, please enable JavaScript. Creatine phosphokinase (CPK) is an enzyme in the body. ...
... page: //medlineplus.gov/ency/article/003483.htm Total protein To use the sharing features on this page, please enable JavaScript. The total protein test measures the total amount of two classes ...
... this page: //medlineplus.gov/ency/article/007338.htm Protein-losing enteropathy To use the sharing features on this page, please enable JavaScript. Protein-losing enteropathy is an abnormal loss of protein ...
... this page: //medlineplus.gov/ency/article/003578.htm Toxicology screen To use the sharing features on this page, please enable JavaScript. A toxicology screen refers to various tests that determine the ...
... http://www.fda.gov/aboutfda/centersoffices/officeoffoods/cfsan/default.htm . Selected References Huncharek M, Kupelnick B. Personal use of hair dyes and the risk of bladder cancer: results of a meta-analysis. ...
... page: //medlineplus.gov/ency/article/002507.htm Naproxen sodium overdose To use the sharing features on this page, please enable JavaScript. Naproxen sodium is a nonsteroidal anti-inflammatory drug (NSAID) used ...
... page: //medlineplus.gov/ency/article/003493.htm Triglyceride level To use the sharing features on this page, please enable JavaScript. The triglyceride level is a blood test to measure the amount ...
... medlineplus.gov/ency/patientinstructions/000177.htm Total parenteral nutrition To use the sharing features on this page, please enable JavaScript. Total parenteral nutrition (TPN) is a method of feeding that bypasses ...
Acetylcholine receptor antibody
... medlineplus.gov/ency/article/003576.htm Acetylcholine receptor antibody To use the sharing features on this page, please enable JavaScript. Acetylcholine receptor antibody is a protein found in the blood of ...
... this page: //medlineplus.gov/ency/article/003927.htm Nerve conduction velocity To use the sharing features on this page, please enable JavaScript. Nerve conduction velocity (NCV) is a test to see ...
... this page: //medlineplus.gov/ency/article/002222.htm Amino acids To use the sharing features on this page, please enable JavaScript. Amino acids are organic compounds that combine to form proteins . ...
... page: //medlineplus.gov/ency/article/002849.htm Scorpion fish sting To use the sharing features on this page, please enable JavaScript. Scorpion fish are members of the family Scorpaenidae, which includes ...
... medlineplus.gov/ency/article/003139.htm Urine - abnormal color To use the sharing features on this page, please enable JavaScript. The usual color of urine is straw-yellow. Abnormally colored urine ...
... medlineplus.gov/ency/article/003065.htm Tooth - abnormal colors To use the sharing features on this page, please enable JavaScript. Abnormal tooth color is any color other than white to yellowish- ...
76 FR 18768 - Cellular, Tissue, and Gene Therapies Advisory Committee; Notice of Meeting
2011-04-05
..., parking, and security procedures is available on the Internet at http://www.nih.gov/about/visitor/index... http://www.nih.gov/about/visitorsecurity.htm . Due to the limited available parking, visitors are...
77 FR 29667 - Blood Products Advisory Committee; Notice of Meeting
2012-05-18
... to the NIH campus, parking, and security procedures is available on the Internet at http://www.nih.../visitorsecurity.htm . Due to the limited available parking, visitors are encouraged to use public transportation...
... this page: //medlineplus.gov/ency/article/003606.htm D-xylose absorption To use the sharing features on this page, please enable JavaScript. D-xylose absorption is a laboratory test to determine ...
... this page: //medlineplus.gov/ency/article/000896.htm Gestational diabetes To use the sharing features on this page, please enable JavaScript. Gestational diabetes is high blood sugar (glucose) that starts or ...
... this page: //medlineplus.gov/ency/article/002417.htm Chloride in diet To use the sharing features on this page, please enable JavaScript. Chloride is found in many chemicals and other substances ...
... page: //medlineplus.gov/ency/article/002474.htm Mercuric chloride poisoning To use the sharing features on this page, please enable JavaScript. Mercuric chloride is a very poisonous form of mercury. It ...
... page: //medlineplus.gov/ency/article/007703.htm Fecal microbiota transplant To use the sharing features on this page, please enable JavaScript. Fecal microbiota transplantation (FMT) helps to replace some of the " ...
... page: //medlineplus.gov/ency/article/002649.htm Fenoprofen calcium overdose To use the sharing features on this page, please enable JavaScript. Fenoprofen calcium is a type of medicine called a nonsteroidal ...
... medlineplus.gov/ency/article/003406.htm Chorionic villus sampling To use the sharing features on this page, please enable JavaScript. Chorionic villus sampling (CVS) is a test some pregnant women have ...
Hyperimmunoglobulin E syndrome
... page: //medlineplus.gov/ency/article/001311.htm Hyperimmunoglobulin E syndrome To use the sharing features on this page, please enable JavaScript. Hyperimmunoglobulin E syndrome is a rare, inherited disease. It causes ...
... this page: //medlineplus.gov/ency/article/000634.htm Lymphogranuloma venereum To use the sharing features on this page, please enable JavaScript. Lymphogranuloma venereum (LGV) is a sexually transmitted bacterial infection. Causes ...
... this page: //medlineplus.gov/ency/article/000130.htm Coal worker's pneumoconiosis To use the sharing features on this page, please enable JavaScript. Coal worker's pneumoconiosis (CWP) is a lung disease that ...
... this page: //medlineplus.gov/ency/article/002706.htm Hair straightener poisoning To use the sharing features on this page, please enable JavaScript. Hair straightener poisoning occurs when someone swallows products that ...
... this page: //medlineplus.gov/ency/article/002705.htm Hair spray poisoning To use the sharing features on this page, please enable JavaScript. Hair spray poisoning occurs when someone breathes in (inhales) ...
... this page: //medlineplus.gov/ency/article/000308.htm Bartter syndrome To use the sharing features on this page, please enable JavaScript. Bartter syndrome is a group of rare conditions that affect ...
... page: //medlineplus.gov/ency/article/003522.htm Antistreptolysin O titer To use the sharing features on this page, please enable JavaScript. Antistreptolysin O (ASO) titer is a blood test to measure ...
2011-01-31
... EPA's public docket visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm... Library, EPA West Building, Room 3334, located at 1301 Constitution Avenue, NW., Washington, DC. The...
... page: //medlineplus.gov/ency/article/001422.htm Subdural effusion To use the sharing features on this page, please enable JavaScript. A subdural effusion is a collection of cerebrospinal fluid (CSF) trapped ...
... page: //medlineplus.gov/ency/article/001142.htm Annular pancreas To use the sharing features on this page, please enable JavaScript. An annular pancreas is a ring of pancreatic tissue that encircles ...
Serial analysis of gene expression (SAGE) in normal human trabecular meshwork.
Liu, Yutao; Munro, Drew; Layfield, David; Dellinger, Andrew; Walter, Jeffrey; Peterson, Katherine; Rickman, Catherine Bowes; Allingham, R Rand; Hauser, Michael A
2011-04-08
To identify the genes expressed in normal human trabecular meshwork tissue, a tissue critical to the pathogenesis of glaucoma. Total RNA was extracted from human trabecular meshwork (HTM) harvested from 3 different donors. Extracted RNA was used to synthesize individual SAGE (serial analysis of gene expression) libraries using the I-SAGE Long kit from Invitrogen. Libraries were analyzed using SAGE 2000 software to extract the 17 base pair sequence tags. The extracted sequence tags were mapped to the genome using SAGE Genie map. A total of 298,834 SAGE tags were identified from all HTM libraries (96,842, 88,126, and 113,866 tags, respectively). Collectively, there were 107,325 unique tags. There were 10,329 unique tags with a minimum of 2 counts from a single library. These tags were mapped to known unique Unigene clusters. Approximately 29% of the tags (orphan tags) did not map to a known Unigene cluster. Thirteen percent of the tags mapped to at least 2 Unigene clusters. Sequence tags from many glaucoma-related genes, including myocilin, optineurin, and WD repeat domain 36, were identified. This is the first time SAGE analysis has been used to characterize the gene expression profile in normal HTM. SAGE analysis provides an unbiased sampling of gene expression of the target tissue. These data will provide new and valuable information to improve understanding of the biology of human aqueous outflow.
Initial Validation of the Activity Choice Index among Overweight Women
Mullen, Sean P.; Silva, Marlene N.; Sardinha, Luís B.; Teixeira, Pedro J.
2016-01-01
Purpose: This prospective study was designed to evaluate psychometric properties of the Activity Choice Index (ACI), a measure for assessing one's choice to engage in more effortful, physically active behaviors in the course of daily routines over less-demanding, sedentary behaviors, in a sample of overweight women. Method: The sample included 192…
The very soft X-ray spectrum of the double pulsar system J0737-3039
Possenti, A.; Rea, N.; McLaughlin, M.A.; Camilo, F.; Kramer, M.; Burgay, M.; Joshi, B.C.; Lyne, A.G.
2008-01-01
We present the results of an 80 ks Chandra ACIS-S observation of the double pulsar system J0737-3039. Furthermore, we report on spectral, spatial and timing analysis of the combined X-ray observations performed so far for this system. Fitting a total of similar to 1100 photons, we show that the
EST Table: DC540689 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available DC540689 E_FL_dpe-_07J11_F_0 10/09/28 54 %/184 aa gb|ACY09589.1| cytochrome oxidase subunit 1 [Tetracis cach...exiata] 10/09/02 49 %/180 aa FBpp0100176|mt:CoI-PA 10/08/28 42 %/149 aa MTCE.26#CE3
Improving Joint Function Using Photochemical Hydrogels for Articular Surface Repair
2017-02-01
cartilage surface. Not only does this repair require multiple surgeries to complete, but there is little data supporting the benefits of ACI versus...Is it possible to reduce the knee joint compression force during level walking with hiking poles? Scand J Med Sci Sports 2011;21:e195–e200. 1338
A novel pathway of ceramide metabolism in Saccharomyces cerevisiae
DEFF Research Database (Denmark)
Voynova, Natalia S; Vionnet, Christine; Ejsing, Christer S.
2012-01-01
The hydrolysis of ceramides in yeast is catalysed by the alkaline ceramidases Ypc1p and Ydc1p, two highly homologous membrane proteins localized to the ER (endoplasmic reticulum). As observed with many enzymes, Ypc1p can also catalyse the reverse reaction, i.e. condense a non-esterified fatty aci...
... this page: //medlineplus.gov/ency/article/007715.htm Helicobacter pylori infection To use the sharing features on this page, please enable JavaScript. Helicobacter pylori ( H pylori ) is a type of bacteria that ...
Formal education of curriculum and instructional designers
McKenney, Susan; Visscher-Voerman, Irene
2013-01-01
McKenney, S., & Visscher-Voerman, I. (2013). Formal education of curriculum and instructional designers. Educational Designer, 2(6). Available online: http://www.educationaldesigner.org/ed/volume2/issue6/article20/index.htm
Mechanical ventilator - infants
... this page: //medlineplus.gov/ency/article/007240.htm Mechanical ventilator - infants To use the sharing features on this page, please enable JavaScript. A mechanical ventilator is a machine that assists with breathing. ...
Total parenteral nutrition - infants
... medlineplus.gov/ency/article/007239.htm Total parenteral nutrition - infants To use the sharing features on this page, please enable JavaScript. Total parenteral nutrition (TPN) is a method of feeding that bypasses ...
... this page: //medlineplus.gov/ency/article/003396.htm Visual acuity test To use the sharing features on this page, please enable JavaScript. The visual acuity test is used to determine the smallest ...
Dry mouth during cancer treatment
... gov/ency/patientinstructions/000032.htm Dry mouth during cancer treatment To use the sharing features on this page, please enable JavaScript. Some cancer treatments and medicines can cause dry mouth. Symptoms you ...
... gov/ency/article/003531.htm Anti-smooth muscle antibody To use the sharing features on this page, please enable JavaScript. Anti-smooth muscle antibody is a blood test that detects the presence ...
... page: //medlineplus.gov/ency/article/003535.htm Antinuclear antibody panel To use the sharing features on this page, please enable JavaScript. The antinuclear antibody panel is a blood test that looks at ...
Obesity hypoventilation syndrome (OHS)
... this page: //medlineplus.gov/ency/article/000085.htm Obesity hypoventilation syndrome (OHS) To use the sharing features on this page, please enable JavaScript. Obesity hypoventilation syndrome (OHS) is a condition in some ...
Enlarged prostate - after care
... page: //medlineplus.gov/ency/patientinstructions/000398.htm Enlarged prostate - after care To use the sharing features on this page, please enable JavaScript. The prostate is a gland that produces the fluid that ...
... this page: //medlineplus.gov/ency/article/001357.htm Swimming pool granuloma To use the sharing features on this page, please enable JavaScript. A swimming pool granuloma is a long-term (chronic) skin ...
... medlineplus.gov/ency/article/002762.htm Bubble bath soap poisoning To use the sharing features on this page, please enable JavaScript. Bubble bath soap poisoning occurs when someone swallows bubble bath soap. ...
Cooking utensils and nutrition
... this page: //medlineplus.gov/ency/article/002461.htm Cooking utensils and nutrition To use the sharing features on this page, please enable JavaScript. Cooking utensils can have an effect on your nutrition. ...
2010-10-01
... or downloaded from the Southwest Region home page (http://swr.nmfs.noaa.gov/permits.htm) to apply for... the vessel is fishing for, taking, retaining, possessing, or landing HMS shoreward of the outer...
Transcatheter aortic valve replacement
... gov/ency/article/007684.htm Transcatheter aortic valve replacement To use the sharing features on this page, please enable JavaScript. Transcatheter aortic valve replacement (TAVR) is surgery to replace the aortic valve. ...
... medlineplus.gov/ency/article/003587.htm Urine specific gravity test To use the sharing features on this page, please enable JavaScript. Urine specific gravity is a laboratory test that shows the concentration ...
... page: //medlineplus.gov/ency/article/003224.htm Skin color - patchy To use the sharing features on this page, please enable JavaScript. Patchy skin color is areas where the skin color is irregular. ...
76 FR 52668 - Vaccines and Related Biological Products Advisory Committee; Amendment of Notice
2011-08-23
... campus, parking, and security procedures is available on the Internet at http://www.nih.gov/about/visitor... is located at http://www.nih.gov/about/visitorsecurity.htm . Due to the limited available parking...
... this page: //medlineplus.gov/ency/article/003235.htm Bleeding into the skin To use the sharing features on this page, please enable JavaScript. Bleeding into the skin can occur from broken blood ...
... this page: //medlineplus.gov/ency/article/002871.htm Jerusalem cherry poisoning To use the sharing features on this page, please enable JavaScript. The Jerusalem cherry is a plant that belongs to the ...
... page: //medlineplus.gov/ency/article/007695.htm Delayed puberty in boys To use the sharing features on this page, please enable JavaScript. Delayed puberty in boys is when puberty does not begin ...
Extraocular muscle function testing
... medlineplus.gov/ency/article/003397.htm Extraocular muscle function testing To use the sharing features on this page, please enable JavaScript. Extraocular muscle function testing examines the function of the eye muscles. ...
... this page: //medlineplus.gov/ency/article/000548.htm Factor VII deficiency To use the sharing features on this page, please enable JavaScript. Factor VII (seven) deficiency is a disorder caused by a ...
... this page: //medlineplus.gov/ency/article/007235.htm Feeding tube - infants To use the sharing features on this page, please enable JavaScript. A feeding tube is a small, soft, plastic tube placed ...
... medlineplus.gov/ency/article/001292.htm Nasal septal hematoma To use the sharing features on this page, please enable JavaScript. A nasal septal hematoma is a collection of blood within the septum ...
... page: //medlineplus.gov/ency/patientinstructions/000401.htm Preventing hepatitis B or C To use the sharing features on this page, please enable JavaScript. Hepatitis B and hepatitis C infections cause irritation and ...
... this page: //medlineplus.gov/ency/article/000216.htm Hepatitis D (Delta agent) To use the sharing features on this page, please enable JavaScript. Hepatitis D is a viral infection caused by the ...
Reference Ranges & What They Mean
... htm. Accessed August 2015. Sources Used in Previous Reviews Books: Clinical Diagnosis and Management by Laboratory Methods. 20th ed. Henry JB, ed. New York: Saunders: 2001. Laboratory Medicine: Test Selection and Interpretation. ...
2012-11-21
... prompted by the identification of bacterial contamination (see FDA's Archive for Recalls, Market Withdrawals, and Safety Alerts at http://www.fda.gov/Safety/Recalls/ArchiveRecalls/default.htm ). Furthermore... allow for [[Page 69865
... page: //medlineplus.gov/ency/article/001911.htm Hormonal effects in newborns To use the sharing features on this page, please enable JavaScript. Hormonal effects in newborns occur because in the womb, babies ...
Acute respiratory distress syndrome
... page: //medlineplus.gov/ency/article/000103.htm Acute respiratory distress syndrome To use the sharing features on this page, please enable JavaScript. Acute respiratory distress syndrome (ARDS) is a life-threatening lung ...
... page: //medlineplus.gov/ency/article/003489.htm Total iron binding capacity To use the sharing features on this page, please enable JavaScript. Total iron binding capacity (TIBC) is a blood test to ...
... www.uptodate.com/home. Accessed March 1, 2016. Gonorrhea — CDC fact sheet. Centers for Disease Control and Prevention. http://www.cdc.gov/std/gonorrhea/stdfact-gonorrhea.htm. Accessed March 3, 2016. Frequently ...
Antidiuretic hormone blood test
... medlineplus.gov/ency/article/003702.htm Antidiuretic hormone blood test To use the sharing features on this page, please enable JavaScript. Antidiuretic blood test measures the level of antidiuretic hormone (ADH) in ...
... this page: //medlineplus.gov/ency/article/000373.htm Maple syrup urine disease To use the sharing features on this page, please enable JavaScript. Maple syrup urine disease (MSUD) is a disorder in ...
... this page: //medlineplus.gov/ency/article/003507.htm Lactic acid test To use the sharing features on this page, please enable JavaScript. Lactic acid is mainly produced in muscle cells and red ...
Calcium channel blocker overdose
... this page: //medlineplus.gov/ency/article/002580.htm Calcium-channel blocker overdose To use the sharing features on this page, please enable JavaScript. Calcium-channel blockers are a type of medicine used ...
... this page: //medlineplus.gov/ency/article/000205.htm Liver disease To use the sharing features on this page, please enable JavaScript. The term "liver disease" applies to many conditions that stop the ...
2013-11-13
... management activities, and we will reduce the Refuge's carbon footprint. Invasive species will be monitored...: Download the CCP and FONSI at http://www.fws.gov/pacific/planning/main/docs/wa/docsdungeness.htm . Email...
... page: //medlineplus.gov/ency/article/003558.htm Hepatitis virus panel To use the sharing features on this page, please enable JavaScript. The hepatitis virus panel is a series of blood tests used ...
... this page: //medlineplus.gov/ency/article/007069.htm Digital rectal exam To use the sharing features on this page, please enable JavaScript. A digital rectal exam is an examination of the lower ...
78 FR 18611 - Summit on Color in Medical Imaging; Cosponsored Public Workshop; Request for Comments
2013-03-27
.../BuildingsandFacilities/WhiteOakCampusInformation/ucm241740.htm . Contact: Aldo Badano, Center for Devices and..., MD 20993-0002, 301-796-2534, Aldo[email protected] . Registration: Registration is free and on a...
Grass and weed killer poisoning
... medlineplus.gov/ency/article/002838.htm Grass and weed killer poisoning To use the sharing features on this page, please enable JavaScript. Many weed killers contain dangerous chemicals that are harmful if ...
... this page: //medlineplus.gov/ency/article/003386.htm Wood lamp examination To use the sharing features on this page, please enable JavaScript. A Wood lamp examination is a test that uses ultraviolet ( ...
... this page: //medlineplus.gov/ency/article/007560.htm Spinal cord stimulation To use the sharing features on this page, please enable JavaScript. Spinal cord stimulation is a treatment for pain that uses ...
... this page: //medlineplus.gov/ency/article/007670.htm Hepatitis A - children To use the sharing features on this page, please enable JavaScript. Hepatitis A in children is swelling and inflamed tissue of ...
... page: //medlineplus.gov/ency/article/000163.htm Hypertensive heart disease To use the sharing features on this page, please enable JavaScript. Hypertensive heart disease refers to heart problems that occur because of ...
Wetlands & Deepwater Habitats - MO 2012 East West Gateway Wetlands (SHP)
NSGIC State | GIS Inventory — Cowardinâs Classification of Wetlands and Deep Water Habitats of the United States (http://www.npwrc.usgs.gov/resource/wetlands/classwet/index.htm), together with...
... page: //medlineplus.gov/ency/article/003835.htm RBC nuclear scan To use the sharing features on this page, please enable JavaScript. An RBC nuclear scan uses small amounts of radioactive material to ...
... page: //medlineplus.gov/ency/patientinstructions/000484.htm Epidural block - pregnancy To use the sharing features on this page, please enable JavaScript. An epidural block is a numbing medicine given by injection (shot) ...
... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...
2013-01-04
... EPA's public docket visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm... Library, EPA West Building, Room 3334, located at 1301 Constitution Avenue NW., Washington, DC. The Public...
Separation anxiety in children
... page: //medlineplus.gov/ency/article/001542.htm Separation anxiety in children To use the sharing features on this page, please enable JavaScript. Separation anxiety in children is a developmental stage in which ...
Group B streptococcus - pregnancy
... medlineplus.gov/ency/patientinstructions/000511.htm Group B streptococcus - pregnancy To use the sharing features on this page, please enable JavaScript. Group B streptococcus (GBS) is a type of bacteria that some ...
Adel, Youssef; Hilkhuysen, Gaston; Noreña, Arnaud; Cazals, Yves; Roman, Stéphane; Macherey, Olivier
2017-06-01
Electrical stimulation of auditory nerve fibers using cochlear implants (CI) shows psychophysical forward masking (pFM) up to several hundreds of milliseconds. By contrast, recovery of electrically evoked compound action potentials (eCAPs) from forward masking (eFM) was shown to be more rapid, with time constants no greater than a few milliseconds. These discrepancies suggested two main contributors to pFM: a rapid-recovery process due to refractory properties of the auditory nerve and a slow-recovery process arising from more central structures. In the present study, we investigate whether the use of different maskers between eCAP and psychophysical measures, specifically single-pulse versus pulse train maskers, may have been a source of confound.In experiment 1, we measured eFM using the following: a single-pulse masker, a 300-ms low-rate pulse train masker (LTM, 250 pps), and a 300-ms high-rate pulse train masker (HTM, 5000 pps). The maskers were presented either at same physical current (Φ) or at same perceptual (Ψ) level corresponding to comfortable loudness. Responses to a single-pulse probe were measured for masker-probe intervals ranging from 1 to 512 ms. Recovery from masking was much slower for pulse trains than for the single-pulse masker. When presented at Φ level, HTM produced more and longer-lasting masking than LTM. However, results were inconsistent when LTM and HTM were compared at Ψ level. In experiment 2, masked detection thresholds of single-pulse probes were measured using the same pulse train masker conditions. In line with our eFM findings, masked thresholds for HTM were higher than those for LTM at Φ level. However, the opposite result was found when the pulse trains were presented at Ψ level.Our results confirm the presence of slow-recovery phenomena at the level of the auditory nerve in CI users, as previously shown in animal studies. Inconsistencies between eFM and pFM results, despite using the same masking conditions, further
Swan-Ganz - right heart catheterization
... this page: //medlineplus.gov/ency/article/003870.htm Swan-Ganz - right heart catheterization To use the sharing features on this page, please enable JavaScript. Swan-Ganz catheterization is the passing of a thin ...
Small intestine aspirate and culture
... ency/article/003731.htm Small intestine aspirate and culture To use the sharing features on this page, please enable JavaScript. Small intestine aspirate and culture is a lab test to check for infection ...
... gov/ency/article/001414.htm Aneurysm in the brain To use the sharing features on this page, ... aneurysm occurs in a blood vessel of the brain, it is called a cerebral, or intracranial, aneurysm. ...
... this page: //medlineplus.gov/ency/patientinstructions/000163.htm Brain injury - discharge To use the sharing features on ... know was in the hospital for a serious brain injury. At home, it will take time for ...
Skilled nursing or rehabilitation facilities
... ency/patientinstructions/000435.htm Skilled nursing or rehabilitation facilities To use the sharing features on this page, ... to go to a Skilled Nursing or Rehabilitation Facility? Your health care provider may determine that you ...
How to avoid overheating during exercise
... patientinstructions/000865.htm How to avoid overheating during exercise To use the sharing features on this page, ... condition can get heat illness. Stay Cool During Exercise Try these tips to help prevent heat-related ...
... this page: //medlineplus.gov/ency/article/007165.htm Exercise and immunity To use the sharing features on ... take a daily walk or follow a simple exercise routine a few times a week. Exercise helps ...
Are you getting too much exercise?
... patientinstructions/000807.htm Are you getting too much exercise? To use the sharing features on this page, ... competitive edge without overdoing it. How too Much Exercise can Hurt To get stronger and faster, you ...
Skilled nursing and rehabilitation facilities - choosing
... gov/ency/patientinstructions/000436.htm Choosing a skilled nursing and rehabilitation facility To use the sharing features ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
Understanding your health care costs
... ency/patientinstructions/000878.htm Understanding your health care costs To use the sharing features on this page, ... on out-of-pocket costs. Out-of-Pocket Costs The good news is there is a limit ...
Hip joint replacement - slideshow
... this page: //medlineplus.gov/ency/presentations/100006.htm Hip joint replacement - series—Normal anatomy To use the ... to slide 5 out of 5 Overview The hip joint is made up of two major parts: ...
... this page: //medlineplus.gov/ency/patientinstructions/000905.htm Laser therapy for cancer To use the sharing features ... Lasers are also used on the skin. How Laser Therapy is Used Laser therapy can be used ...
... this page: //medlineplus.gov/ency/article/003679.htm Factor IX assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/003678.htm Factor VIII assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/003674.htm Factor II assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/000550.htm Factor V deficiency To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... page: //medlineplus.gov/ency/article/003548.htm Rheumatoid factor (RF) To use the sharing features on this ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/000549.htm Factor II deficiency To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/003676.htm Factor VII assay To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/000553.htm Factor X deficiency To use the sharing features on ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... this page: //medlineplus.gov/ency/article/002448.htm Cow's milk - infants To use the sharing features on ... year old, you should not feed your baby cow's milk, according to the American Academy of Pediatrics ( ...