KoreaScience (Korea)

Full Text Available

UK PubMed Central (United Kingdom)

Within the cardiac cell, the movements of calcium ions are tightly regulated by a number of regulatory proteins including pumps, and channels. The sarcoplasmic reticulum (SR) is in large part...Full Text Available

UK PubMed Central (United Kingdom)

We identify new organelles associated with the vacuolar system in plant cells. These organelles are defined biochemically by their internal content of three integral membrane proteins: a chimeric reporter...Full Text Available

UK PubMed Central (United Kingdom)

BackgroundSeveral proteins are known to be markedly expressed in the brain during cerebral ischemia; however, the changes in protein profiles within the ischemic brain after an ischemic...Full Text Available

UK PubMed Central (United Kingdom)

ObjectivesWe sought to identify a novel gene for dilated cardiomyopathy (DCM).BackgroundDCM is a heritable, genetically...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity Ca{sup 2+}-ATPases, which are involved in Ca{sup 2+} transport across membranes, were also inhibited by CD in a concentration ...

International Nuclear Information System (INIS)

The low excitation energy spectroscopy of "8"6Sr, "8"8Sr, "8"9Sr, "8"6Rb, and "8"7Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, "8"7Sr and "8"8Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various analytical ...

International Nuclear Information System (INIS)

The present work gives preliminary results of analysis of drug mixtures (NEPHROSAL tea bag) and its water infusion. In a sample of dried drugs the elements K, Ca, Mn, Fe, Ni, Cu, Zn, Br, Rb, Sr, Pb were identified, whereas in their water infusion only Ca, Mn, Zn and Sr were found. The method applied was radionuclide X-ray fluorescence analysis using a radionuclide source "1"0"9Cd, a Si/Li semiconductor detector and a multichannel analyzer Canberra 8100. (author) 6 refs.; 3 figs.

British Library Electronic Table of Contents (United Kingdom)

Cocoon sericin plays an important role in the reeling of silk and serves as a valuable biomaterial in the field of biomedicine, skincare, and food industries; however, knowledge about cocoon sericin proteins has been limited. For a comprehensive study on sericin, cocoons of eight varieties of silkworm of different geographic origin and with varied cocoon color were analyzed utilizing proteomics and bioinformatics approaches. The electrophoresis pattern demonstrated some common protein bands for all silkworm varieties and distinctive protein bands for some of those examined in the present study. The Ser2 protein, a new Ser3 protein, and four other novel sericin proteins were identified in cocoons for the first time. Products of both Ser1 and Ser3 genes appear to be ubiquitous in the cocoon ...

International Nuclear Information System (INIS)

The purpose of the present study was to examine the in vitro effects of low-dose cadmium (Cd) on developing cortical cells. The cortical cells removed from fetuses (embryonic day 15) were treated with 10 nM of Cd for 24 h. The effects of Cd on dendritic and synaptic development were immunocytochemically observed with anti-microtubule associated protein-2 (MAP2) and anti-synapsin I antibodies, respectively. Administration of Cd suppressed dendritic as well as synaptic development at 10 nM. By two-dimensional gel electrophoresis and liquid chromatography-tandem mass spectrometric (LC/MS/MS) analysis, we identified three proteins with different expression after Cd-treatment; dihydropyrimidinase-related protein 2 (DRP-2/CRMP-2), 14-3-3-epsillon and calmodulin (CaM). Though the number of identified proteins was small, these proteins are known to ...

Energy Technology Data Exchange (ETDEWEB)

Metagenomics projects based on shotgun sequencing of populations of micro-organisms yield insight into protein families. We used sequence similarity clustering to explore proteins with a comprehensive dataset consisting of sequences from available databases together with 6.12 million proteins predicted from an assembly of 7.7 million Global Ocean Sampling (GOS) sequences. The GOS dataset covers nearly all known prokaryotic protein families. A total of 3,995 medium- and large-sized clusters consisting of only GOS sequences are identified, out of which 1,700 have no detectable homology to known families. The GOS-only clusters contain a higher than expected proportion of sequences of viral origin, thus reflecting a poor sampling of viral diversity until now. Protein domain distributions in the GOS dataset and current protein databases show ...

UK PubMed Central (United Kingdom)

A histidine kinase protein (Cph1) with sequence homology and spectral characteristics very similar to those of the plant phytochrome has been recently identified in the cyanobacterium Synechocystis...Full Text Available

UK PubMed Central (United Kingdom)

A fluid-phase immunoradiometric assay has been developed which identifies an antigen on the Factor VIII (antihemophilic factor) procoagulant protein. This sensitive and quantitative assay is not influenced...Full Text Available

UK PubMed Central (United Kingdom)

CDC7 is an essential gene required for DNA replication in Saccharomyces cerevisiae. Cdc7p homologs have recently been identified in vertebrates, but their role in DNA...Full Text Available

UK PubMed Central (United Kingdom)

There are many methods to screen for abnormal amounts of proteinuria to identify patients at risk for progression of renal disease, but which method best predicts renal risk is unknown. Here, we analyzed...Full Text Available

UK PubMed Central (United Kingdom)

The CD1 family of proteins binds self and foreign glycolipids for presentation to CD1-restricted T cells. To identify previously uncharacterized active CD1 ligands, especially those of microbial origin,...Full Text Available

UK PubMed Central (United Kingdom)

We have identified two novel, very closely related genes, SAS1 and SAS2, from Dictyostelium discoideum. These encode small, approximately 20-kilodaton proteins with amino acid sequences thought to be...Full Text Available

UK PubMed Central (United Kingdom)

BackgroundUsing a transcriptional profiling approach, we recently identified myeloid-related protein-8/14 (MRP-8/14) to be expressed by platelets during acute MI....Full Text Available

UK PubMed Central (United Kingdom)

Histone-beta-galactosidase protein fusions were used to identify the domain of yeast histone 2B, which targets this protein to the nucleus. Amino acids 28 to 33 in H2B were required for nuclear localization...Full Text Available

International Nuclear Information System (INIS)

The thermodynamics of the Sr-Si system is of fundamental importance for the understanding of eutectic modification of Al-Si alloys. At the same time, strontium silicides have recently been found to have potential applications in electronic devices. Renewed research efforts have led to a re-evaluation of the phase equilibria in this system, resulting in the discovery of previously undetected stable intermetallic compounds. In this work, we investigate the finite temperature thermodynamic properties of the stable (and metastable) Sr-Si intermetallics. The vibrational properties of the intermetallic compounds are calculated within harmonic theory, with quasi-harmonic corrections to account for the effects of thermal expansion. The total free energies of the compounds are computed considering vibrational and electronic contributions, as well as weak anharmonic corrections. The ground state of the system is predicted and compared to previous ...

British Library Electronic Table of Contents (United Kingdom)

The cAMP response element-binding protein (CREB) is a highly conserved transcription factor that integrates signaling through the cAMP-dependent protein kinase A (PKA) in many eukaryotes. PKA plays a critical role in Dictyostelium development but no CREB homologue has been identified in this system. Here we show that Dictyostelium utilizes a CREB-like protein, BzpF, to integrate PKA signaling during late development. bzpF^- mutants produce compromised spores, which are extremely unstable and germination defective. Previously, we have found that BzpF binds the canonical CRE motif in vitro. In this paper, we determined the DNA binding specificity of BzpF using protein binding microarray (PBM) and showed that the motif with the highest specificity is a CRE-like sequence. BzpF is necessary to ...

International Nuclear Information System (INIS)

The subjects covered in this Symposium range through almost every clinical medical specialty. From an average of one paper in each of the past three Symposiums, the explosive interest in cerebral amyloidosis has led to the presentation of 12 papers on this subject in the present volume. The genetically predisposed familial amyloidotic processes, such as the polyneuropathies and familial Mediterranean fever have also stimulated extensive and intriguing investigations which have revealed the striking effect of a single amino acid substitution in transforming a normal protein into a lethal ''amyloidogenic'' one. This Symposium clearly depicts the advances since the first amyloid fibril protein was definitively identified and defined 14 years ago. Since all amyloid fibril proteins so far described are variants of normal proteins, attention to gene abnormalities now becomes a significant ...

Energy Technology Data Exchange (ETDEWEB)

The DNA sequence motif ATTTGCAT (octamer) or its inverse complement has been identified as an evolutionarily conserved element in the promoter region of immunoglobulin genes. Two major DNA-binding proteins that bind in a sequence-specific manner to the octamer DNA sequence have been identified in mammalian species--a ubiquitously expressed protein (Oct-1) and a lymphoid-specific protein (Oct-2). During characterization of the promoter region of the chicken immunoglobulin light chain gene, the authors identified two homologous octamer-binding proteins in chicken B cells. when the cloning of the human gene for Oct-2 revealed it to be a member of a distinct family of homeobox genes, they sought to determine if the human Oct-2 cDNA could be used to identify homologous chicken homeobox genes. Using a human Oct-2 ...

Energy Technology Data Exchange (ETDEWEB)

Short communication

British Library Electronic Table of Contents (United Kingdom)

Lung cancer is still difficult to treat by current chemotherapeutic procedures. We recently found that MVL, an anti-HIV lectin from blue-green algae Microcystis viridis, also has antitumor activity. The objective of this study was to investigate apoptosis-inducing activity of recombinant MVL (R-MVL) and proteomic changes in A549 cells, and to identify the molecular pathways responsible for the anti-cancer action of R-MVL. We found that R-MVL induces A549 cells apoptosis in a dose-dependent manner by using MTT assay, fluorescent microscope (FM) and flow cytometry (FCM), and the IC50 was calculated to be 24.12??g/ml. Subsequently, 7 altered proteins in R-MVL-treated A549 cells were identified, including upregulated aldehyde dehydrogenase 1 and ?-actin, and five downregulated proteins: heat s...

International Nuclear Information System (INIS)

Two methods were used to label pig kidney microvillar membrane proteins from the luminal and cytoplasmic surfaces of closed membrane vesicles. The first method was lactoperoxidase-catalysed radioiodination. Lactoperoxidase and glucose oxidase were positioned inside or outside the vesicles, iodination being initiated by adding glucose and "1"2"5I. After electrophoresis of the proteins, asymmetric labelling patterns on radioautographs were observed. However the major disadvantage of this method was the high degree of intramembrane labelling of the fatty acid chains of membrane lipids. The second method overcame this disadvantage. A new hydophilic photoreagent, 3,5-di("1"2"5I)iodo-4-azidobenzenesulphonate, was transported by a Na"+-dependent system into microvillar vesicles, thus permitting labelling from either side of the membrane when the vesicles were photolysed. The activity of several microvillar peptidases survived the labelling reaction ...

Energy Technology Data Exchange (ETDEWEB)

Protein kinase C activity has been identified in the rat brown adipocyte. About 60% of this activity is found in the cytosolic fraction under basal conditions, and 12-O-tetradecanoylphorbol 13-acetate (TPA) causes a rapid shift from the cytosol to the particulate fraction. Norepinephrine and phenylephrine causes a similar redistribution that can be blocked by prazosin but not by alprenolol. {alpha}{sub 1}-Adrenergic agonists cause three- to fivefold stimulation of type 2 iodothyronine 5{prime}-deiodinase activity in brown adipocytes. TPA has no effect on basal deiodinase activity and reduces the response of the enzyme to {alpha}{sub 1}-adrenergic agonists. These results suggest that the translocation of protein kinase C from cytosol to particulate fraction is not sufficient to increase deiodinase activity but can modulate the {alpha}{sub 1}-adrenergic agonist-mediated responses in these cells.

International Nuclear Information System (INIS)

Soybean is one of the most economical and nutritious food packed with basic nutrients that combat diseases stemming from mal- and under-nutrition. Despite its rich nutritional profile, use of soybean in food has been limited because soybean proteins are often associated with compounds, which could exert a negative impact on the nutritional quality of the protein. Trypsin inhibitor (TI) is one of the important anti-nutritional factors that exert negative effect by causing growth inhibition. Soybean cultivar VLS-2 was irradiated with 250 Gy gamma rays in a gamma cell (200) with 60Co source installed at BARC to induce mutations for low trypsin inhibitor content. Three mutants with lower levels of TI content were identified and can be utilized for developing elite varieties of soybean. (author)

British Library Electronic Table of Contents (United Kingdom)

Glial fibrillary acidic protein (GFAP) is the main intermediate filament protein in mature astrocytes, but also an important component of the cytoskeleton in astrocytes during development. Major recent developments in astrocyte biology and the discovery of novel intermediate filament functions enticed the interest in the function of GFAP. The discovery of various GFAP splice variants gave an additional boost to explore this protein in more detail.The structural role of GFAP in astrocytes has been widely accepted for a long time, but over the years, GFAP has been shown to be involved in astrocyte functions, which are important during regeneration, synaptic plasticity and reactive gliosis. Moreover, different subpopulations of astrocytes have been identified, which are likely to have distinc...

CERN Document Server

The 12 GeV upgrade at Jefferson Lab has identified two new large spectrometers as Physics detectors for the project. The first is a 7.5 Gev/c 35 m-sr. spectrometer that requires a pair of identical Combined Function Superconducting Magnets (CFSM) that can simultaneously produce 1.5 T dipole fields and 4.5 T/m quadrupole fields inside a warm bore of 120cm. The second is an 11 GeV/c 2 m-sr. spectrometer that requires a CFSM that simultaneously produces a dipole field of 4.0 T and a quadruple field of 3.0 T/m in a 60 cm warm bore. Magnetic designs using TOSCA 3D have been performed to realize the magnetic requirements, provide 3d fields for optics analysis and produce field and force information for the engineering feasibility of the magnets. A two-sector cos( theta )/cos(2 theta ) design with a low nominal current density, warm bore and warm iron design has been selected and analyzed. These low current densities are ...

Energy Technology Data Exchange (ETDEWEB)

Intact rat fat cell exposed to 12.5 ..mu..M (..gamma..-32P)ATP incorporate label into specific proteins within minutes. By solubilizing the reaction mixture with SDS which bypasses the subcellular fractionation steps, the labeled proteins can be identified in autoradiographs of SDS-PAGE gels. The most prominently labeled protein has an M/sub r/ of 42,000. Localization of this component to the cell surface can be made on the basis of inhibition of phosphorylation by addition of a protein derived from the rat brain with protein kinase inhibitory property, susceptibility of the phosphorylated protein to the tryptic digestion, inhibition of phosphorylation of this protein after brief exposure to melittin. To rule out the possibility that the cell surface protein might be a mitochondrial contaminant from ...

UK PubMed Central (United Kingdom)

The Myc oncoprotein is a potent inducer of cell growth, cell cycle progression, and apoptosis. While many direct Myc target genes have been identified, the molecular determinants of Myc’s transcriptional...Full Text Available

UK PubMed Central (United Kingdom)

To understand how DEXD/H-box proteins recognize and interact with their cellular substrates, we have been studying Prp28p, a DEXD/H-box splicing factor required for switching the U1 snRNP with the U6...Full Text Available

International Nuclear Information System (INIS)

A #lambda#gt11 cDNA library was constructed from poly(U)-Spharose-selected Entamoeba histolytica trophozoite RNA in order to clone and identify surface antigens. The library was screened with rabbit polyclonal anti-E. histolytica serum. A 700-base-pair cDNA insert was isolated and the nucleotide sequence was determined. The deduced amino acid sequence of the cDNA revealed a cysteine-rich protein. DNA hybridizations showed that the gene was specific to E. histolytica since the cDNA probe reacted with DNA from four axenic strains of E. histolytica but did not react with DNA from Entamoeba invadens, Acanthamoeba castellanii, or Trichomonas vaginalis. The insert was subcloned into the expression vector pGEX-1 and the protein was expressed as a fusion with the C terminus of glutathione S-transferase. Purified fusion protein was used to generate 22 monoclonal antibodies (mAbs) and a mouse polyclonal antiserum ...

International Nuclear Information System (INIS)

We studied the effect of extracellular Ca"2"+ concentration ([Ca"2"+]_e) on adipocyte differentiation. Preadipocytes exposed to continuous [Ca"2"+]_e higher than 2.5 mmol/l accumulated little or no cytoplasmic lipid compared to controls in 1.8 mmol/l [Ca"2"+]_e. Differentiation was monitored by Oil Red O staining of cytoplasmic lipid and triglyceride assay of accumulated lipid, by RT-PCR analysis of adipogenic markers, and by the activity of glycerol-3-phosphate dehydrogenase (GPDH). Elevated [Ca"2"+]_e inhibited expression of peroxisome proliferator-activated receptor #gamma#, CCAAT/enhancer binding protein #alpha#, and steroid regulatory binding element protein. High [Ca"2"+]_e significantly inhibited differentiation marker expression including adipocyte fatty acid binding protein, and GPDH. The decrease in Pref-1 expression that accompanied differentiation also was prevented by high [Ca"2"+]_e. Treatment of 3T3-L1 cells ...

Science.gov (United States)

The Drosophila melanogaster tissue-specific transcription factor NTF-1 was originally identified in vitro as a protein that could bind to and activate transcription from the Dopa decarboxylase (Ddc) gene. A structure-function analysis of NTF-1 led to the identification of a discrete amino-terminal activation domain. Here, we report that an NTF-1 mutant lacking the activation domain acts as a trans-dominant inhibitor of NTF-1 activation in tissue culture cells by forming inactive heterodimers with the full-length protein. Ectopically expressing this dominant-negative protein or the full-length protein in developing Drosophila embryos leads to dire developmental consequences. Overexpressing the trans-dominant NTF-1 leads to lethality, while overexpressing full-length NTF-1 results in both lethality and morphogenetic defects. Our results suggest that both the activity and the ...

Energy Technology Data Exchange (ETDEWEB)

Enzyme-linked Immunosorbent assay systems for the identification of irradiated egg, pork and chicken was developed. Eggs were irradiated in their shells to 0.5{approx}7kGy. Pork was irradiated to 0.5{approx}3kGy and chicken irradiated to 0.5kGy{approx}5kGy. The most sensitive proteins to irradiation were screened by SDS-PAGE and purified. Ovalbumin from egg, salt soluble protein(p) from pork, and salt soluble protein(c) from chicken showed the most sensitivity to irradiation. To investigate for a practical use in identifying of irradiated egg, pork and chicken, competitive ELISA was performed. The binding activity of ovalbumin to anti-ovalbumin IgG was reduced in a dose-dependent manner by irradiating up to 7kGy, and considerably lowered after irradiating at 7kGy. The concentration of 50% inhibition of ovalbumin to IgG was increased to 1.5(0.5kGy){approx}3.7(7kGy) times in an dose-dependent ...

Energy Technology Data Exchange (ETDEWEB)

The effect of insulin on protein biosynthesis was examined in differentiated 3T3-L1 and 3T3-F442A adipocytes. Insulin altered the relative rate of synthesis of specific proteins independent of its ability to hasten conversion of the fibroblast (preadipocyte) phenotype to the adipocyte phenotype. Although more than one pattern of response to insulin was observed, the authors focused on the induction of a Mr 33,000 protein which was identified as the glycolytic enzyme glyceraldehyde-3-phosphate dehydrogenase (GAPDH). Exposure of 3T3 adipocytes to insulin throughout differentiation specifically increased GAPDH activity and protein content by 2- to 3-fold as compared to 3T3 adipocytes differentiated in the absence of insulin. These changes in enzyme activity and content could be accounted for by a 4-fold increase in the relative rate of synthesis of GAPDH and a 9-fold increase in ...

Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

International Nuclear Information System (INIS)

We conducted (n, #gamma#) and (d, p) reactions leading to "8"7", "8"8", "8"9"Sr in addition to "8"8Sr (d, t) "8"7Sr and 24 keV neutron capture in "8"8Sr. (orig./HSI).

Science.gov (United States)

A significant challenge in proteomics biomarker research is to identify the changes that are of highest diagnostic interest, among the many unspecific aberrations associated with disease burden and inflammation. In the present study liver tissue specimens (n=18) from six experimental stages were collected from the resistant hepatocyte (RH) rat model of liver cancer and analyzed by 2D DIGE. The study included triplicates of regenerating liver, control "sham-operated" liver, three distinct premalignant stages and hepatomas. Out of 81 identified proteins two-thirds were differentially abundant in rat hepatomas compared to control rat liver and, secondly, the majority of proteins were also changed in precursor stages. This underscores the importance of adequate control samples in explorative cancer biomarker research. We confirm several proteomic changes previously identified in human ...

British Library Electronic Table of Contents (United Kingdom)

DFNA5 was first identified as a gene causing autosomal dominant hearing loss (HL). Different mutations have been found, all exerting a highly specific gain-of-function effect, in which skipping of exon 8 causes the HL. Later reports revealed the involvement of the gene in different types of cancer. Epigenetic silencing of DFNA5 in a large percentage of gastric, colorectal and breast tumors and p53-dependent transcriptional activity have been reported, concluding that DFNA5 acts as a tumor suppressor gene in different frequent types of cancer. Despite these data, the molecular function of DFNA5 has not been investigated properly. Previous transfection studies with mutant DFNA5 in yeast and in mammalian cells showed a toxic effect of the mutant protein, which was not seen after transfection ...

British Library Electronic Table of Contents (United Kingdom)

The herbicide atrazine is a known immunotoxicant and an inhibitor of human natural killer (NK) cell lytic function. The precise changes in NK cell lytic function following atrazine exposure have not been fully elucidated. The current study identifies the point at which atrazine exerts its affect on the stepwise process of human NK cell-mediated lyses of the K562 target cell line. Using intracellular staining of human peripheral blood lymphocytes, it was determined that a 24-h in vitro exposure to atrazine did not decrease the level of NK cell lytic proteins granzyme A, granzyme B or perforin. Thus, it was hypothesized that atrazine exposure was inhibiting the ability of the NK cells to bind to the target cell and subsequently inhibit the release of lytic protein from the NK cell. To test t...

Scientific Electronic Library Online (English)

Abstract in english Functional properties of soy proteins for food are closely related to the composition of their storage protein subunits. Using base excision sequence scanning (BESS), we show that the absence of the A4 peptide in the G4 glycinin subunit of the soybean (Glycine max L.) cultivar Enrei was caused by the same point mutation in the Gy4 gene as previously reported in the soybean cultivar Raiden. Although the genetic relationship between Raiden and Enrei is not known, the same p (more) oint mutation in their Gy4 genes may indicate that they probably share a related origin. The application of BESS to identify single nucleotide polymorphisms (SNPs) as co-dominant markers for marker-assisted selection (MAS) of a recessive null allele is also discussed.

International Nuclear Information System (INIS)

... isobaric analogs mev range 01-10 neutrons nuclear reactions nuclear theory

International Nuclear Information System (INIS)

The aims of investigation were to follow the Sr transport in the food chain from the flora to the fauna and humans, and its dependence on the geological origin og the plant site, industrial emissions, the age and site of plants, the part of plant used for nutrition and the strontium content in the drinking water, to determine the Sr intake of humans with the help of the duplicate method, and to estimate the apparent absorption rate and balance of strontium depending on of the form of diet (mixed or ovolactovegetarian), sex, season, age, region (geological origin of the living space) and method of intake measurement (duplicate or basket method). Strontium, an ultra trace element widespread in the earth's crust, is not essential and only mildly toxic for plants, animals and man according to current knowledge. The biological essentiality of Sr has not been investigated yet. Amoeba species living in sea water use ...

International Nuclear Information System (INIS)

The herbicide atrazine is a known immunotoxicant and an inhibitor of human natural killer (NK) cell lytic function. The precise changes in NK cell lytic function following atrazine exposure have not been fully elucidated. The current study identifies the point at which atrazine exerts its affect on the stepwise process of human NK cell-mediated lyses of the K562 target cell line. Using intracellular staining of human peripheral blood lymphocytes, it was determined that a 24-h in vitro exposure to atrazine did not decrease the level of NK cell lytic proteins granzyme A, granzyme B or perforin. Thus, it was hypothesized that atrazine exposure was inhibiting the ability of the NK cells to bind to the target cell and subsequently inhibit the release of lytic protein from the NK cell. To test this hypothesis, flow cytometry and fluorescent microscopy were employed to analyze NK cell-target cell co-cultures following atrazine ...

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

International Nuclear Information System (INIS)

Published in summary form only. 6 Refs.

DEFF Research Database (Denmark)

Twenty-six unclassified Campylobacter-like strains previously isolated from 15 chicken carcasses and caecal contents, together with two more strains isolated from chicken faeces on a different occasion, were identified as Helicobacter pullorum using various phenotypic identification methods. API Campy identification kits and a 16-test identification scheme developed for campylobacters failed to identify these bacteria, or identified them as Campylobacter spp. Eighteen strains (including the two isolated on a different occasion) were chosen for examination using a more comprehensive probabilistic identification scheme. Using this method, 14 of the 18 strains were identified as H. pullorum with ID scores > 95%; two strains were also identified as H. pullorum with lower ID scores. Of the remaining two strains, one was not identified with this scheme and the ...

Energy Technology Data Exchange (ETDEWEB)

The human mitochondrial DNA (mtDNA) is a closed circular, 16,569-bp double-stranded DNA, encoding 13 genes whose protein products are subunits of the oxidative phosphorylation system required for synthesis of most of the ATP consumed by eukaryotic cells. Point mutations of the mtDNA that cause multi-tissue, loss-of-energy syndromes, called mitochondrial encephalomyopathies (e.g., MERRF and MELAS), have been identified. In addition, large-scale deletions of the human mtDNA have been identified and are the molecular bases for the neonatal and adolescent onset loss-of-energy syndromes Pearson and Kearns-Sayer, respectively. 5 refs., 1 fig.

Energy Technology Data Exchange (ETDEWEB)

Homology analyses of the protein sequences of chicken liver and rat mammary gland fatty acid synthases were carried out. The amino acid sequences of the chicken and rat enzymes are 67% identical. If conservative substitutions are allowed, 78% of the amino acids are matched. A region of low homologies exists between the functional domains, in particular around amino acid residues 1059-1264 of the chicken enzyme. Homologies between the active sites of chicken and rat and of chicken and yeast enzymes have been analyzed by an alignment method. A high degree of homology exists between the active sites of the chicken and rat enzymes. However, the chicken and yeast enzymes show a lower degree of homology. The DADPH-binding dinucleotide folds of the {beta}-ketoacyl reductase and the enoyl reductase sites were identified by comparison with a known consensus sequence for the DADP- and FAD-binding dinucleotide folds. The active sites of all of the enzymes ...

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

Science.gov (United States)

The GntR-like protein NorG has been shown to affect Staphylococcus aureus genes involved in the resistance to quinolones and ?-lactams, such as those encoding the NorB and AbcA transporters. To identify the target genes regulated by NorG, we carried out transcriptional profiling assays using S. aureus RN6390 and its isogenic norG::cat mutant. Our data showed that NorG positively affected the transcription of global regulators mgrA, arlS, and sarZ. The three putative drug efflux pump genes most positively affected by NorG were the NorB efflux pump (5.1-fold), the MmpL-like protein SACOL2566 (5.2-fold), and the BcrA-like drug transporter SACOL2525 (5.7-fold). The S. aureus predicted MmpL protein showed 53% homology with the MmpL lipid transporter of Mycobacterium tuberculosis, and the putative SACOL2525 protein showed 87% homology with the bacitracin drug transporter BcrA of ...

UK PubMed Central (United Kingdom)

Chaperones (stress proteins) are essential proteins to help the formation and maintenance of the proper conformation of other proteins and to promote cell survival after a large variety of environmental...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

This paper discusses the mineralogy and geochemistry of the No. 6 Coal (Pennsylvanian) in the Junger Coalfield, Ordos Basin, China. The results show that the vitrinite reflectance (0.58%) is lowest and the proportions of inertinite and liptinite (37.4% and 7.1%, respectively) in the No. 6 Coal of the Junger Coalfield are highest among all of the Late Paleozoic coals in the Ordos Basin. The No. 6 Coal may be divided vertically into four sections based on their mineral compositions and elemental concentrations. A high boehmite content (mean 6.1%) was identified in the No. 6 Coal. The minerals associated with the boehmite in the coal include goyazite, rutile, zircon, and Pb-bearing minerals (galena, clausthalite, and selenio-galena). The boehmite is derived from weathered and oxidized bauxite in the weathered crust of the underlying Benxi Formation (Pennsylvanian). A high Pb-bearing mineral content of samples ZG6-2 and ZG6-3 is likely of hydrothermal origin. The No. 6 ...

International Nuclear Information System (INIS)

The fundamental optical properties of dysprosium (Dy) doped strontium sulfide bulk samples for various dopant concentrations from 0.1 to 1.0 at.% were investigated by X-ray diffraction (XRD), electron paramagnetic resonance spectroscopy (EPR), room temperature photoluminescence (PL), photoluminescence excitation (PLE) and diffuse reflectance spectroscopy (DRS). Investigations by electron paramagnetic resonance yielded the state of Dy in the sample as Dy3+. An additional ESR line due to F+ center was observed. The PL emission spectrum consisted of several intense lines and a number of weaker ones which were identified as transitions between energy levels of Dy3+. The optimum doping concentration for maximum intensity was found to be 0.25 at.%. Blue shift of the absorption edge energy and red shift of the PLE spectrum were observed with increasing doping concentration. The former is due to Burstein-Moss (BM) effect and the latter is attributed due to the presence of ...

International Nuclear Information System (INIS)

Cockayne syndrome (CS) is a rare autosomal recessive disease, which shows diverse clinical symptoms such as photosensitivity, severe mental retardation and developmental defects. CS cells are hypersensitive to killing by ultraviolet (UV)-irradiation and defective in transcription-coupled repair. Two genetic complementation groups in CS (CS-A and CS-B) have been identified. We analyzed mutations of the CSA gene in 5 CS-A patients and identified 3 types of mutations. Four unrelated CS-A patients (CS2OS, CS2AW, Nps2 and CS2SE) had a deletion including exon 4, suggesting that there is a founder effect on the CSA mutation in Japanese CS-A patients. Patient CS2SE was a compound heterozygote for this deletion and an amino acid substitution at the 106th glutamine to proline (Q106P) in the WD-40 repeat motif of the CSA protein, which resulted in a defective nucleotide excision repair. Patient Mps1 had a large deletion in the ...

British Library Electronic Table of Contents (United Kingdom)

Photoluminescence properties and local electronic structures of rare earth (Eu^3^+ and Ce^3^+) activated Sr3AlO4F have been studied. X-ray powder diffraction data indicated that the activator ions of Eu^3^+ and Ce^3^+ can be incorporated into the Sr3AlO4F lattice and formed limited solid solutions of Sr3-2xLnxNaxAlO4F (Ln=Eu, Ce) with Na^+ as a charge compensator ion. The local structure around Sr sites was initially explored using Eu-activated Sr3AlO4F as a structural probe. Sr3AlO4F:Eu^3^+ exhibits orange-red emission ranging from 520 to 740nm with a maximum peak at about 619nm mainly originating from the ^5D0->^7FJ (J=0, 1, 2, 3, 4) transitions, indicating that Eu exists mainly in the trivalent state due to a strong oxidative lattice in Sr3AlO4F. Sr3AlO4F:Ce^3^+ shows an unusual long-wa...

Energy Technology Data Exchange (ETDEWEB)

This report summarises nearly 20 biosphere reports and gives a synthesis of the work performed within the SR-Site Biosphere project, i.e. the biosphere part of SR-Site. SR-Site Biosphere provides the main project with dose conversion factors (LDFs), given a unit release rate, for calculation of human doses under different release scenarios, and assesses if a potential release from the repository would have detrimental effects on the environment. The intention of this report is to give sufficient details for an overview of methods, results and major conclusions, with references to the biosphere reports where methods, data and results are presented and discussed in detail. The philosophy of the biosphere assessment was to make estimations of the radiological risk for humans and the environment as realistic as possible, based on the knowledge of present-day conditions at Forsmark and the past and expected future development of ...

UK PubMed Central (United Kingdom)

Reversion-induced LIM protein (RIL) is a member of the ALP (actinin-associated LIM protein) subfamily of the PDZ/LIM protein family. RIL serves as an adaptor protein and seems to regulate cytoskeletons....Full Text Available

Energy Technology Data Exchange (ETDEWEB)

Peroxisome proliferating agents (PPAs) are a structurally diverse group of chemicals that include environmental chemical contaminants such as certain chlorinated herbicides, solvents and plasticizers. PPAs have previously been shown to induce anti-trout laruci acid hydroxylase immunoreactive proteins in bluegill and catfish. In this investigation, induction of lauric acid hydroxylase activity and immunoreactive proteins was confirmed, and the mass spectral analysis of specific hydroxylation products was performed in order to identify possible species-specific differences in fatty acid metabolism. Male bluegill (Lepomis macrochirus) and channel catfish (Ictalurus punctatus) were administered clofibrate or ciprofibrate 48 hr prior to hepatic or trunk kidney (catfish only) microsome preparation. While no significant differences were observed in male catfish, male bluegill had significant decreases in hematocrit and plasma ...

Energy Technology Data Exchange (ETDEWEB)

The large aggregating proteoglycan aggrecan is a major structural component of the extracellular matrix of articular cartilage. Recent cDNA cloning of the human aggrecan gene (AGC1) reveals a core protein of at least 2316 amino acids characterized by several distinct structural domains. Two globular domains, termed G1 and G2, are present at the amino terminus of the molecule and a third, termed G3, is present at the carboxy terminus. The G1 domain is homologous in structure to the cartilage link protein and accounts for the aggregating potential of aggrecan through its ability to interact with hyaluronic acid. The aggrecan gene is known to consist of 15 exons, with each exon encoding a distinct functional region of the mature protein. However, while the link protein gene is known to reside on chromosome 5 in the human, the location of the aggrecan gene is currently undetermined in any species. The probe ...

Energy Technology Data Exchange (ETDEWEB)

The g factors of the 2/sub 1//sup +/ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g(/sup 84/Sr)= + 0.419(47), g(/sup 86/Sr)= + 0.273(50) and g(/sup 88/Sr)= + 1.15(17). The mean lifetimes of the 2/sub 1//sup +/ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions.

British Library Electronic Table of Contents (United Kingdom)

The levels of General Transcription Factor (TF) IIA were examined during mammalian brain development and in rat embryo fibroblasts and transformed cell lines. The large TFIIA subunit paralogues ab and t are largely produced in unsynchronized cell lines, yet only TFIIA ab is observed in a number of differentiated tissue extracts. Steady-state protein levels of the TFIIA t, ab, and g subunits were significantly reduced when human embryonal (ec) and hepatic carcinoma cell lines were stimulated to differentiate with either all-trans-retinoic acid (ATRA) or sodium butyrate. ATRA-treated NT2-ec cells required replating to induce a neuronal phenotype and loss of detectable TFIIA t and g proteins. High levels of TFIIA t, ab, and g and Sp factors were identified in extracts from human fetal and rat...

Energy Technology Data Exchange (ETDEWEB)

Previous work showed that (TH)p-azidopuromycin photoaffinity labeled 70 S Escherichia coli ribosomes and that photoincorporation into 50 S subunit proteins was in the order L23 greater than L18/22 greater than L15. In the present work the authors report on immunoelectron microscopic studies of the complexes formed by p-azidopuromycin-modified 50 S subunits with antibodies to the N6,N6-dimethyladenosine moiety of the antibiotic. The p-azidopuromycin-modified 50 S subunits appear to be identical to unmodified control subunits in electron micrographs. Complexes of modified subunits with antibodies to the N6,N6-dimethyladenosine moiety of p-azidopuromycin were visualized in micrographs. Two regions of p-azidopuromycin photoincorporation were identified. The primary site, seen in about 75% of the complexes, is between the central protuberance and small projection, on the side away from the L7/L12 arm, in a region thought to contain the ...

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

British Library Electronic Table of Contents (United Kingdom)

The human genome encodes 11 cysteine cathepsins belonging to the papain-like family of cysteine peptidases that are known predominantly as endo-lysosomal enzymes. However, it is now understood that the functions and activities of cysteine cathepsins are not limited to endo-lysosomal compartments, as they are also active in the peri- and extracellular space. The thyroid gland is an endocrine organ where such intra- and extracellular proteolytic activities are required to solubilize the prohormone thyroglobulin from its luminal, covalently cross-linked storage forms for subsequent processing into smaller protein fragments and thyroid hormone liberation. Cathepsin K has been identified as one of the cysteine cathepsins with a crucial role in thyroglobulin processing. However, cathepsin K has ...

Energy Technology Data Exchange (ETDEWEB)

When labeled cAMP is incubated with isolated mitochondria from rat liver, it penetrates not only through the outer membrane of the mitochondria but also into the mitoplasts, where it is accumulated chiefly in the matrix. Damage to the mitochondrial membrane by freezing-thawing promotes not an influx but an efflux of cAMP out of the mitoplasts. A substantial part of the labeled nucleotide in all the investigated submitochondrial fractions was identified as intact cAMP by the method of thin-layer chromatography. The transport of cAMP into the mitochondria can explain the activation of their functions by the hormones that activate cytoplasmic adenylate cyclase and by extramitochondrial (cytosol) cAMP, as well as the presence of cAMP-dependent protein kinase and cAMP-phosphodiesterase in the mitochondria.

British Library Electronic Table of Contents (United Kingdom)

Meningococcal disease is an infection caused by Neisseria meningitidis. Genetic factors contribute to host susceptibility and progression to disease, but the genes responsible for disease development are largely unknown. We report here a genome-wide association study for host susceptibility to meningococcal disease using 475 individuals with meningococcal disease (cases) and 4,703 population controls from the UK. We performed, in Western European and South European cohorts (consisting of 968 cases and 1,376 controls), two replication studies for the most significant SNPs. A cluster of complement factor SNPs replicated independently in both cohorts, including SNPs within complement factor H (CFH) (rs1065489 (p.936Dprotein 3 (CFHR3)(rs426736, P = 4.6 ...

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

KoreaScience (Korea)

Full Text Available

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

KoreaScience (Korea)

Full Text Available

British Library Electronic Table of Contents (United Kingdom)

We have successfully grown single crystalline Formula Not Shown with the range of Formula Not Shown using the floating-zone method. All compounds show orthorhombic symmetry in this substitution range, but the difference between lattice constants a and b decreases with increasing Sr concentration and becomes almost zero at Formula Not Shown . Characteristic temperatures, which correspond to antiferromagnetic ordering and structural transition, decrease with increasing Sr concentration. The value of the magnetic susceptibility below 30K increases with increasing Sr concentration. The temperature dependence of the electrical resistivity revealed that Sr substitution significantly suppresses the highly anisotropic electric structure of Formula Not Shown .

International Nuclear Information System (INIS)

... bcs theory electron reactions excited states form factors inelastic scattering

International Nuclear Information System (INIS)

The product of the human GRO gene is a cytokine with inflammatory and growth-regulatory properties; GRO is also called MGSA for melanoma growth-stimulatory activity. The authors have identified two additional genes, GRO#beta# and GRO#gamma#, that share 90% and 86% identity at the deduced amino acid level with the original GRO#alpha# isolate. One amino acid substitution of proline in GRO#alpha# by leucine in GRO#beta# and GRO#gamma# leads to a large predicted change in protein conformation. Significant differences also exist in the 3' untranslated region, including different numbers of ATTTA repeats associated with mRNA instability. A 122-base-pair region in the 3' region is conserved among the three GRO genes, and a part of it is also conserved in the Chinese hamster genome, suggesting a role in regulation. DNA hybridization with oligonucleotide probes and partial sequence analysis of the genomic clones confirm that the three forms are derived ...

Energy Technology Data Exchange (ETDEWEB)

A considerable fraction of radioactivity entering the environment from different nuclear events is associated with particles. The impact of these events can only be fully assessed where there is some knowledge about the mobility of particle bound radionuclides entering the environment. The behavior of particulate radionuclides is dependent on several factors, including the physical, chemical and redox state of the environment, the characteristics of the particles (e.g., the chemical composition, crystallinity and particle size) and on the oxidative state of radionuclides contained in the particles. Six plutonium-containing particles stemming from Runit Island soil (Marshall Islands) were characterized using non-destructive analytical and microanalytical methods. By determining the activity of {sup 239,240}Pu and {sup 241}Am isotopes from their gamma peaks structural information related to Pu matrix was obtained, and the source term was revealed. Composition and elemental distribution ...

UK PubMed Central (United Kingdom)

A large group of diseases, termed protein misfolding disorders, share the common feature of the accumulation of misfolded proteins. The possibility of a common mechanism underlying either the pathogenesis...Full Text Available

UK PubMed Central (United Kingdom)

CAAX proteins are widely involved in global cellular functions such as proliferation, differentiation, and carcinogenesis. As an important modulator of biological activity, signal transduction via protein...Full Text Available

International Nuclear Information System (INIS)

This paper describes stable strontium as composed of four stable isotopes ( Sr 88, Sr 87, Sr 86, and Sr 84), of which Sr 88 contributes more than 82% to its composition. Strontium exists in three crystalline, plymorphic forms; face-centered cubic alpha form, hexagonal beta form and body-centered cubic gamma form. Strontium occupies in many physicochemical aspects an intermediate position between calcium and barium, as does the solubility of strontium salts. As a result of its oxidation potential, strontium readily forms oxides, halides, and sulfide. The author proposes that the slight discrimination against strontium incorporation into bony tissues may be due to the difference in ionic potential (14%) between strontium and calcium. Ionic potential is an indicator of the strength of ionic bonds: strontium has a smaller ratio of ionic charge to ionic radius when compared with calcium.

International Nuclear Information System (INIS)

In-vitro experiments using "2"0"3Pb were performed to identify the lead binding components in human peripheral blood. The distribution of lead in plasma, in the red cell membrane, and within the red cell was also investigated. Studies of the distribution of "2"0"3Pb in the whole blood showed that at a lead concentration of 2.45 #mu#mol/l (50 #mu#g/100 ml) about 94% of lead had been incorporated by the erythrocytes and 6% remained in the plasma. After extraction of lipid by a methanol/chloroform mixture, about 75% of the lead was found to be associated with the protein fraction. The lipid contained about 21% of the "2"0"3Pb, the remainder being in the aqueous plasma. SDS polyacrylamide gel electrophoresis of blood plasma showed that almost 90% of the "2"0"3Pb was present in the albumin fraction; the remainder was likely to be associated with high molecular weight globulins. Several binding sites were identified on the ...

Energy Technology Data Exchange (ETDEWEB)

Duchenne and Becker muscular dystrophies are caused by defects of dystrophin, which forms a part of the membrane cytoskeleton of specialized cells such as muscle. It has been previously shown that the dystrophin-associated protein A1 (59-kDa DAP) is actually a heterogeneous group of phosphorylated proteins consisting of an acidic ({alpha}-A1) and a distinct basic ({beta}-A1) component. Partial peptide sequence of the A1 complex purified from rabbit muscle permitted the design of oligonucleotide probes that were used to isolate a cDNA for one human isoform of A1. This cDNA encodes a basic A1 isoform that is distinct from the recently described syntrophins in Torpedo and mouse and is expressed in many tissues with at least five distinct mRNA species of 5.9, 4.8, 4.3, 3.1, and 1.5 kb. A comparison of the human cDNA sequence with the GenBank expressed sequence tag (EST) data base has identified a relative from human skeletal ...

Science.gov (United States)

PMID:20880255

KoreaScience (Korea)

Full Text Available

International Nuclear Information System (INIS)

A procedure is described for the isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO_4, Ba(Ra)SO_4 and PbS are prepared. Ra is determined by gamma-spectrometry, "9"0Sr and "2"1"0Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for "9"0Sr and "2"1"0Pb and 50 mBq/kg for "2"2"6Ra and "2"2"8Ra. The procedure is useful for all kinds of foodstuff. (orig.).

Energy Technology Data Exchange (ETDEWEB)

A procedure is described for the isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO{sub 4}, Ba(Ra)SO{sub 4} and PbS are prepared. Ra is determined by gamma-spectrometry, {sup 90}Sr and {sup 210}Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for {sup 90}Sr and {sup 210}Pb and 50 mBq/kg for {sup 226}Ra and {sup 228}Ra. The procedure is useful for all kinds of foodstuff. (orig.) [Deutsch] Es wird ein Analysengang zur Abtrennung und Bestimmung von {sup ...

Energy Technology Data Exchange (ETDEWEB)

A balloon-borne instrument has measured the cosmic-ray antiproton flux between 130 and 320 MeV and searched for antihelium between 130 and 370 MeV per nuclear. These particles were selected from the background of normal-matter cosmic rays by combining a selective trigger with a detailed spark chamber visualization of each recorded event. Antiprotons are identified by their characteristic annihilatin radiation. Residue from background processes meeting the selection criteria is small. The observed 14 antiprotons yield a measured differential flux of 1.7 +- 0.5 x 10/sup -4/ antiprotons m/sup -2/ sr/sup -1/ s/sup -1/ MeV/sup -1/ at the top of the atmosphere. The corresponding antiproton/proton ratio is 2.2 +- 0.6 x 10/sup -4/,, only slightly smaller than the ratio observed by other experiments at higher energies. Thus the antiprotons have a spectral shape similar to the protons, at least down to about 100 MeV. The expected flux of these particles ...

International Nuclear Information System (INIS)

Red mud is a waste and tail material from primary aluminum production, and is named for its color, coming from its iron oxide content. The quantity of red mud is almost equal to the primary aluminum production and leads to a considerable environmental issue. Red mud of the ETI Seydisehir Aluminum Plant is considered as detrimental waste for storage due to its content of various metal oxides, elements and caustics. This detrimental effect is classified into two groups: first, environmental health and second, the cost of storage. In order to minimize the negative effect of red mud, there have been or are presently many investigations carried out on usage of red mud in building materials. However, no effective way of utilizing red mud has yet been found. In this study domestic red mud was investigated and chemical analyses were performed by EDAX and XRF techniques. Radioactivity of the samples was also measured with gamma spectroscopy. The concentrations of elemental Na, Al, Si, Ca, Ti, ...

International Nuclear Information System (INIS)

Using an ab initio pseudopotential method within a generalized gradient approximation of the density functional theory, the structural, electronic, and phonon properties of SrS in the B1 (NaCl) and B2 (CsCl) structures have been studied. The calculated lattice constants, static bulk modulus, and first-order pressure derivative of the bulk modulus are reported for both the B1 and B2 structures and compared with previous experimental and theoretical calculations. Electronic band structures and densities of states have been derived for SrS. Subsequently, a linear-response approach to the density functional theory is used to derive the phonon frequencies and densities of states.

Science.gov (United States)

... ootqn mojjl immonmlljlignhrf]\\\\\\]a`c`dtcdt_YVYYYUZVY]^_]eddljoiqrmps{sr{ urwwqyssxsyz ~quut xmrv}uxtuyw wttstutqtzsrpmqsn qrqnijp ojinikqihlkdehe_`\\[UU[ ...

Science.gov (United States)

Alcoholism; Anxiety Disorders; Generalized Anxiety Disorder; Post-Traumatic Stress Disorder; Panic Disorder; Obsessive-Compulsive Disorder

International Nuclear Information System (INIS)

Three new phases with compositions, LaSr_2FeTiO_7, NdSr_2FeTiO_7 and GdSr_2FeTiO_7, were prepared by the traditional ceramic method. Lazy-Pulverix analysis of the X-ray diffraction data suggests that the phases crystallize in the RP-type (n = 2) structure in the space group, I4/mmm. The cell dimensions along the c-axis decrease with decrease in size of the rare earth ions. Electrical resistivity, as a function of temperature, shows that the materials are insulators and the resistivity decreases with decrease in the size of the rare earth ion, which is attributed to increase in the three-dimensional character. (author)

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

International Nuclear Information System (INIS)

... excited states inelastic scattering mev range 10-100 mev range 100-1000

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

International Nuclear Information System (INIS)

... functions intermediate structure isobaric analogs level widths mev range

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

British Library Electronic Table of Contents (United Kingdom)

Proteins aggregated into spherulite structures of amyloid fibrils have been observed in patients with certain brain diseases such as Alzheimers and Parkinsons. The conditions under which these protein spherulites form and grow are not currently known. In order to illuminate the role of environmental factors on protein spherulites, this research aims to explore the kinetics and mechanisms of spherulite formation and growth, as monitored by optical microscopy, in a range of salt concentrations, and initial protein concentrations for two model proteins: bovine b-lactoglobulin and insulin. These two proteins are significantly different in their size and fibril growth rate, but both of these proteins have been shown previously to form amyloid fibrils and spherulites under low pH conditions. The...

Science.gov (United States)

The present work reports on Raman and Surface Enhanced Raman Scattering (SERS) vibrational fingerprints of ?-carotene and haemoglobin in fresh whole blood (i.e. right after blood test) with different laser excitations, i.e. visible (514 nm) and near-infrared (NIR, 785 nm). The use of colloidal silver nanoparticles significantly increases the Raman signal, thus providing a clear SERS spectrum of blood. The collected spectra have been examined and marker bands of ?-carotene and of the haem prosthetic group of haemoglobin have been found. In particular, the fundamental features of ?-carotene (514 nm excitation), blood proteins and haem molecules (785 nm excitation) were recognized and assigned. Moreover haemoglobin SERS signals can be identified and related with its oxygenation state (oxy-haemoglobin). The data reported show the prospects of Raman and SERS techniques to detect important bio-molecules in a whole blood sample with no pre-treatment. ...

British Library Electronic Table of Contents (United Kingdom)

Parkinson's disease (PD) is the most common neurodegenerative movement disorder. Mutations in PTEN-induced kinase 1 (PINK1) are a frequent cause of recessive PD. Autophagy, a pathway for clearance of protein aggregates or impaired organelles, is a newly identified mechanism for PD development. However, it is still unclear what molecules regulate autophagy in PINK1-silenced cells. Here we report that autophagosome formation is promoted in the early phase in response to PINK1 gene silencing by lentivirus transfer vectors expressed in mouse striatum. Reduced PP2A activity and increased phosphorylation of PP2A at Y307 (inactive form of PP2A) were observed in PINK1-knockdown dopaminergic cells and striatum tissues. Treatment with C2-ceramide (an agonist of PP2A) reduced autophagy levels in PINK...

Science.gov (United States)

Glypican-3 (GPC3), a membrane-bound heparan sulfate proteoglycan, is found to be overexpressed in hepatocellular carcinoma (HCC). The purpose of the present study was to investigate the possible role of GPC3 in the development of HCC. In this study, RNA interference (RNAi) with a GPC3 small hairpin RNA (GPC3 shRNA) was used to identify the effects of GPC3 on the regulation of malignant behaviors of HCC. MHCC97-H, a highly metastatic human HCC cell line in which GPC3 mRNA and protein levels were detected as the highest among the 4 HCC cell lines assessed in this study, and was thus selected as a cell model for in vitro and in vivo experiments. The results showed that down-regulation of GPC3 can significantly inhibit the proliferative and invasive ability of MHCC97-H. Compared with the parental HCC cells, GPC3-silenced cells exhibited attenuated capacities in developing tumors in nude mice, while the growth of tumor xenografts derived from these ...

Science.gov (United States)

The steroidogenic factor 1 (SF-1, also known as NR5A1) is a transcription factor belonging to the nuclear receptor superfamily. Whereas most of the members of this family have been extensively characterized, the therapeutic potential and pharmacology of SF-1 still remains elusive. Described here is the identification and characterization of selective inhibitory chemical probes of SF-1 by a rational ultra-high-throughput screening (uHTS) strategy. A set of 64,908 compounds from the National Institute of Health's Molecular Libraries Small Molecule Repository was screened in a transactivation cell-based assay employing a chimeric SF-1 construct. Two analogous isoquinolinones, ethyl 2-[2-[2-(2,3-dihydro-1,4-benzodioxin-7-ylamino)-2-oxoethyl]-1-oxoisoquinolin-5-yl]oxypropanoate (SID7969543) and ethyl 2-[2-[2-(1,3-benzodioxol-5-ylmethylamino)-2-oxoethyl]-1-oxoisoquinolin-5-yl]oxypropanoate and (SID7970631), were identified as potent submicromolar inhibitors, yielding ...

Science.gov (United States)

PURPOSE: Hepatocellular carcinoma (HCC) is a highly virulent malignancy with no effective treatment thus requiring innovative and effective targeted therapies. The oncogene Astrocyte elevated gene-1 (AEG-1) plays a seminal role in hepatocarcinogenesis and profoundly downregulates insulin-like growth factor binding protein-7 (IGFBP7). The present study focuses on analyzing potential tumor suppressor functions of IGFBP7 in HCC and the relevance of IGFBP7 downregulation in mediating AEG-1 function.EXPERIMENTAL DESIGN: IGFBP7 expression was detected by immunohistochemistry in HCC tissue microarray and real-time PCR and ELISA in human HCC cell lines. Dual Fluorescence in situ hybridization was performed to detect loss of heterozygosity at IGFBP7 locus. Stable IGFBP7-overexpressing clones were established in the background of AEG-1-overexpressing human HCC cells and were analyzed for in vitro proliferation and senescence and in vivo tumorigenesis and ...

International Nuclear Information System (INIS)

Microdamage naturally occurs in bone tissue as a result of cyclic loading placed on the body from normal daily activities. While it is usually repaired through the bone turnover process, accumulation of microdamage may result in reduced bone quality and increased fracture risk. It is unclear whether certain areas of bone are more susceptible to microdamage than others due to compositional differences. This study examines whether areas of microdamaged bone are chemically different than undamaged areas of bone. Bone samples (L3 vertebrae) were harvested from 15 dogs. Samples were stained with basic fuchsin, embedded in poly-methylmethacrylate, and cut into 5-(micro)m-thick sections. Fuchsin staining was used to identify regions of microdamage, and synchrotron infrared microspectroscopic imaging was used to determine the local bone composition. Results showed that microdamaged areas of bone were chemically different than the surrounding undamaged areas. Specifically, ...

Science.gov (United States)

In vertebrates, the positioning of the internal organs relative to the midline is asymmetric and evolutionarily conserved. A number of molecules have been shown to play critical roles in left-right patterning. Using representational difference analysis to identify genes that are differentially expressed on the left and right sides of the chick embryo, we cloned chick Claudin-1, an integral component of epithelial tight junctions. Here, we demonstrate that retroviral overexpression of Claudin-1, but not Claudin-3, on the right side of the chick embryo between HH stages 4 and 7 randomizes the direction of heart looping. This effect was not observed when Claudin-1 was overexpressed on the left side of the embryo. A small, but reproducible, induction of Nodal expression in the perinodal region on the right side of the embryo was noted in embryos that were injected with Claudin-1 retroviral particles on their right sides. However, no changes in Lefty,Pitx2 or cSnR ...

UK PubMed Central (United Kingdom)

BackgroundWe examined the effects of short-term consumption of whey protein isolate on muscle proteins and force recovery after eccentrically-induced muscle damage in healthy individuals.MethodsSeventeen...Full Text Available

UK PubMed Central (United Kingdom)

Thioredoxin, a small, ubiquitous protein which participates in redox reactions through the reversible oxidation of its active center dithiol to a disulfide, is an essential protein in Bacillus...Full Text Available

UK PubMed Central (United Kingdom)

The fusogenic orthoreoviruses express nonstructural fusion-associated small transmembrane (FAST) proteins that induce cell-cell fusion and syncytium formation. It has been speculated that the FAST proteins...Full Text Available

UK PubMed Central (United Kingdom)

The changes in protein species synthesized during early Drosophila embryogenesis were characterized by two-dimensional electrophoresis. Of the 261 proteins scored, 68 (26%) show dramatic changes in...Full Text Available

UK PubMed Central (United Kingdom)

A protein evolution strategy is described by which double-stranded DNA fragments encoding defined E. coli protein secondary structural elements (α-helices, β-strands...Full Text Available

UK PubMed Central (United Kingdom)

We have used the two-electrode voltage clamp technique and the patch clamp technique to investigate the regulation of ROMK1 channels by protein-tyrosine phosphatase (PTP) and protein-tyrosine...Full Text Available

UK PubMed Central (United Kingdom)

A heterobifunctional reagent, N-succinimidyl 3-(2-pyridyldithio)propionate, was synthesized. Its N-hydroxysuccinimide ester group reacts with amino groups and the 2-pyridyl disulphide structure reacts...Full Text Available

UK PubMed Central (United Kingdom)

Protein modifications such as phosphorylation are often studied by two-dimensional gel electrophoresis since the perturbation in the protein’s pI value is readily detected by this method....Full Text Available

UK PubMed Central (United Kingdom)

The Protein Data Bank in Europe (PDBe; pdbe.org) is actively involved in managing the international archive of biomacromolecular structure data as one of the partners in the Worldwide Protein Data Bank...Full Text Available

UK PubMed Central (United Kingdom)

The activity of Src-related protein-tyrosine kinases is repressed by the phosphorylation of a conserved carboxyl-terminal tyrosine by another cytoplasmic protein-tyrosine kinase termed p50csk. In this...Full Text Available

UK PubMed Central (United Kingdom)

In this study, we investigated on a systems level how complex protein interactions underlying cell polarity in yeast determine the dynamic association of proteins with the polar cortical domain (PCD)...Full Text Available

UK PubMed Central (United Kingdom)

Many genetic processes depend on proteins interacting with specific sequences on DNA. Despite the large excess of nonspecific DNA in the cell, proteins can locate their targets rapidly. After initial...Full Text Available

UK PubMed Central (United Kingdom)

Ethylene rapidly and transiently up-regulates the activity of several monomeric GTP-binding proteins (monomeric G proteins) in leaves of Arabidopsis as determined by two-dimensional gel electrophoresis...Full Text Available

UK PubMed Central (United Kingdom)

Computer-assisted analysis revealed a striking sequence similarity between the putative 24-kDa protein (p24) encoded by open reading frame (ORF) 5 of beet yellows closterovirus and the coat protein...Full Text Available

UK PubMed Central (United Kingdom)

Tooth enamel biomineralization is mediated by enamel proteins synthesized by ameloblast cells. Two classes of proteins have been described: enamelins and amelogenins. In lower vertebrates the absence...Full Text Available

UK PubMed Central (United Kingdom)

BackgroundThe fast growing Protein Data Bank contains the three-dimensional description of more than 45000 protein- and nucleic-acid structures today. The large majority of the data...Full Text Available

UK PubMed Central (United Kingdom)

Alpha-hemoglobin-stabilizing protein (AHSP) is an erythroid-specific protein that acts as a molecular chaperone for the free α chains of hemoglobin. Evidence strongly suggests...Full Text Available

International Nuclear Information System (INIS)

Data of thermally stimulated luminescence (TSL) of single (Cu), double (Cu, Mn) and triple (Cu, Mn, Gd) activated SrS phosphors, which throws light on the nature and distribution of deeper traps have been presented. The samples are prepared by Bhawalkar's method and excited by UV 365 nm and #gamma#-rays to study the phenomenon. (author). 8 refs., 2 figs., 1 tab.

Science.gov (United States)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at /sup 88/Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in /sup 87/Sr and /sup 89/Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic.) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,..gamma..) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

Energy Technology Data Exchange (ETDEWEB)

The neutron deficient Sr and Zr nuclei are studied in the relativistic mean-field approach. Large deformations and shape coexistence are predicted for these nuclei in the vicinity of the proton drip line. The charge radii are found to increase with the removal of neutrons from the semimagic {sup 88}Sr and {sup 90}Zr, in close agreement with the recent isotopic-shift measurements.

Science.gov (United States)

A large double-focusing mass spectrometer was used to obtain new values for the masses of Sr/sup 86/, Sr/sup 88/, and Zr/sup 90/. Mass differences calculated from these values are found to be in better agreement with nuclear transmutation information than were previous mass spectroscopically derived values. (auth)

International Nuclear Information System (INIS)

Radiometric X-ray fluorescence analysis was used for the determination of Mn, Fe, Cu, Zn and Pb in wastewater and sludges from three wastewater treatment plants in Bratislava (SR). Metals were determined in wastewaters after preconcentration by 8-hydroxyquinoline and in sludges by drying and pressing to pellets. "2"3"8Pu and "1"0"9Cd was used for excitation of fluorescence radiation. (author).

Energy Technology Data Exchange (ETDEWEB)

The electron scattering form factor for excitation of the 1/sup +/ state of /sup 88/Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no ..delta..-h admixtures are required.

International Nuclear Information System (INIS)

Neutron-hole states in /sup 87/Sr were studied by means of the /sup 88/Sr("3He,#alpha#)/sup 87/Sr reaction at 36 MeV. Angular distribution measurements were carried out from 3"0 to 41"0 (lab) and analyzed with the zero-range distorted-wave Born approximation method. Spectroscopic factors have been determined for about 50 discrete levels in /sup 87/Sr located below 6 MeV excitation energy and for the three lowest isobaric analog states 2p(3/2, 1f(5/2, and 2p(1/2 observed around 11 MeV. Many l = 1 and l = 3 discrete levels are observed in the 3--6 MeV excitation energy range. In addition, a large part of the 1f-2p strength is found to lie in the higher-lying continuum up to 13 MeV (about 10% and 40% for the l = 1 and 3 contributions, respectively). The distribution of the 1f-2p neutron-hole strength is compared to previous data on neighboring nuclei /sup 89/Zr and /sup 91/Mo. In addition, angular ...

Science.gov (United States)

Objective:? Primary hyperparathyroidism (HPT) is characterised by autonomous secretion of PTH from enlarged parathyroid glands leading, in most patients, to asymptomatic hypercalcaemia. Familial hypocalciuric hypercalcaemia (FHH) is an autosomal dominant disorder caused by inactivating mutations in the calcium sensing receptor (CaSR) gene; it is characterised by lifelong and usually asymptomatic hypercalcaemia. Establishing the correct diagnosis is important because surgery can be curative in HPT, but ineffective in FHH. There is overlap in the diagnostic criteria for the two disorders and some patients carrying inactivating mutations in the CaSR gene, which is suggestive of FHH, also have HPT with hyperplastic parathyroid glands or adenomas. Design and Patients:? CaSR gene mutations were analyzed and clinical and biochemical parameters evaluated in 139 consecutive out-patients presenting with hypercalcaemia and suspected ...

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

UK PubMed Central (United Kingdom)

Phospholemman (PLM), a member of the FXYD family of regulators of ion transport, is a major sarcolemmal substrate for protein kinases A and C in cardiac and skeletal muscle. In the heart, PLM...Full Text Available

UK PubMed Central (United Kingdom)

Male reproductive proteins (MRPs), associated with sperm and semen, are the moieties responsible for carrying male genes into the next generation. Evolutionary biologists have focused on their...Full Text Available

Science.gov (United States)

Protein isolated from hen egg-white and functions as a bacteriostatic enzyme by degrading bacterial cell walls. First enzyme ever characterized by protein ...

International Nuclear Information System (INIS)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

Energy Technology Data Exchange (ETDEWEB)

Changes in radiostrontium clearance (SrC) and bone formation (tetracycline labeling) were observed in the femurs of skeletally mature dogs following the various operative steps involved in bone screw fixation. Drilling, but not periosteal stripping, produced a small but statistically significant increase in SrC and endosteal bone formation in the distal third of the bone. Strontium clearance values equivalent to those produced by drilling alone were recorded after screw fixation at low or high torque (5 versus 20 inch pounds), as well as by the insertion of loosely fitting stainless steel implants. Bone formation (equals the percentage tetracycline-labeled trabecular bone surfaces) was increased by 30% when SrC values exceeded 3.5 ml/100 g bone/min, and the relationship was linear when SrC values ranged between 1.0 and 7.0 ml/100 g bone/min. The changes in SrC and bone formation ...

British Library Electronic Table of Contents (United Kingdom)

BaxSr1-xTiO3 (x=0.6, 0.75, 0.80, 0.85 and 0.9) compositions are prepared by solid-state reaction route using controlled heating and cooling. Density optimization by varying sintering temperature was achieved. X-ray diffraction (XRD) analysis shows the phase pure materials. The lattice constant decreases from 3.9868A (x=0.90) to 3.9449A (x=0.60) with increasing Sr2+; the tetragonal distortion also decreases. Dielectric constant show sharp peaks for samples having low strontium content (0.10, 0.15) and gets smeared out as the strontium content is increased (0.20, 0.25). For further higher Sr2+ composition (0.40), the dielectric peak could not be observed in the measured temperature range. The peak broadening in Sr2+ rich compositions indicates that diffused transitions and is attributed to t...

International Nuclear Information System (INIS)

Besides differentiation and apoptosis, cell migration is a basic process in brain development in which neural cells migrate several centimeters within the developing brain before reaching their proper positions and forming the right connections. For identifying signaling events that control neural migration and are therefore potential targets of chemicals to disturb normal brain development, we developed a human neurosphere-based migration assay based on normal human neural progenitor (NHNP) cells, in which the distance is measured that cells wander over time. Applying this assay, we investigated the role of the extracellular signal-regulated kinases 1 and 2 (ERK1/2) in the regulation of NHNP cell migration. Exposure to model substances like ethanol or phorbol 12-myristate 13-acetate (PMA) revealed a correlation between ERK1/2 activation and cell migration. The participation of phospho-(P-) ERK1/2 was confirmed by exposure of the cells to the MEK inhibitor PD98059, ...

International Nuclear Information System (INIS)

Description of problem or function: Format: EXREM III; Nuclides: radioactive decay data on 252 Nuclides: 1H-3, 4Be-7, 6C-11, 6C-14, 7N-13, 8O-15, 9F-18, 11Na-22, 11Na-24, 12Mg-28, 13Al-28, 15P-32, 15P-33, 16S-35, 17Cl-36, 17Cl-38, 18A-37, 18A-39, 19K-40, 19K-42, 19K-43, 20Ca-45, 20Ca-47, 20Ca-49, 21Sc-46, 21Sc-47, 21Sc-49, 24Cr-51, 25Mn-52M, 25Mn-52, 25Mn-54, 26Fe-52, 26Fe-55, 26Fe-59, 27Co-56, 27Co-57, 27Co-58, 27Co-60, 28Ni-56, 28Ni-63, 29Cu-64, 30Zn-65, 30Zn-69M, 30Zn-69, 31Ga-67, 31Ga-68, 32Ge-77, 33As-76, 33As-77, 34Se-75, 35Br-80M, 35Br-80, 35Br-82, 35Br-83, 35Br-84, 36Kr-79, 36Kr-83M, 36Kr-85M, 36Kr-85, 36Kr-87, 36Kr-88, 37Rb-84, 37Rb-86, 37Rb-87, 37Rb-88, 37Rb-89, 37Rb-90M, 37Rb-90, 38Sr-85, 38Sr-87M, 38Sr-89, 38Sr-90, 38Sr-91, 38Sr-92, 38Sr-93, 39Y-87, 39Y-88, 39Y-90, 39Y-91M, 39Y-91, 39Y-92, 39Y-93, 40Zr-93, 41Nb-93M, 40Zr-95, ...

UK PubMed Central (United Kingdom)

Pseudomonas syringae is a gram-negative bacterial plant pathogen that is dependent on a type III protein secretion system (TTSS) and the effector proteins it translocates into plant...Full Text Available

KoreaScience (Korea)

Full Text Available

Energy Technology Data Exchange (ETDEWEB)

Biological cells of the nitrogen fixating bacteria Xanthobacter autotrophicus GZ 29 have been cultivated with 57-Fe, and from the nitrogenase of these cells the 57-Fe marked molybdenum-iron-protein is extracted. The Moessbauer spectra of this enzyme show that the structure of the iron cluster is similar to the structure in the molybdenum-iron-proteins of Azotobacter vinelandii, Klebsiella pneumoniae or Clostridium pasteurianum.

KoreaScience (Korea)

Full Text Available

KoreaScience (Korea)

Full Text Available

KoreaScience (Korea)

Full Text Available

KoreaScience (Korea)

Full Text Available

UK PubMed Central (United Kingdom)

Protein bodies within the endosperm of castor bean (Ricinus communis L. cv. Hale) seeds arise from numerous small vacuoles which progressively become filled with storage protein, of...Full Text Available

KoreaScience (Korea)

Full Text Available

International Nuclear Information System (INIS)

Single-phased Sr3B2SiO8:Eu3+ phosphor was prepared by a solid-state method at 1020 oC. The luminescence spectra showed that Sr3B2SiO8:Eu3+ phosphor can be effectively excited by near ultraviolet light (393 nm) and blue light (464 nm). When excited at 393 or 464 nm Sr3B2SiO8:Eu3+ exhibited the main emission peaks at 611 and 620 nm, which resulted from the supersensitive 5D0#->#7F2 transition of Eu3+. The luminescence intensity of Sr3B2SiO8:Eu3+ at 611 and 620 nm reached the maximum when the doping content of Eu3+ was 4.5 mol%. Its chromaticity coordinates (0.646, 0.354) were very close to the NTSC standard values (0.67, 0.33). Thus, Sr3B2SiO8:Eu3+ is considered to be an efficient red-emitting phosphor for long-UV InGaN-based light-emitting diodes. - Highlights: ? Sr3B2SiO8:Eu3+ was synthesized using solid-state reaction method for the first time. ? The ...

British Library Electronic Table of Contents (United Kingdom)

Assembly of icosahedral capsids of proper size and symmetry is not understood. Residue F170 in bacteriophage P22 coat protein is critical for conformational switching during assembly. Substitutions at this site cause assembly of tubes of hexamerically arranged coat protein. Intragenic suppressors of the ts phenotype of F170A and F170K coat protein mutants were isolated. Suppressors were repeatedly found in the coat protein telokin-like domain at position 285, which caused coat protein to assemble into petite procapsids and capsids. Petite capsid assembly strongly correlated to the side chain volume of the substituted amino acid. We hypothesize that larger side chains at position 285 torque the telokin-like domain, changing flexibility of the subunit and intercapsomer contacts. Thus, a sing...

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

Science.gov (United States)

White spot syndrome virus (WSSV) is the causative agent of the white spot disease of shrimp. Penaeus monodon were captured from Muttukadu Estuary in Chennai, India, transported to the laboratory and maintained in an aerated system with continuous water circulation-biofiltration. WSSV-free P. monodon were challenged by feeding them only once with WSSV-infected tissues of P. monodon. Cumulative mortality (100%) of the infected individuals was determined. Tissues from infected and uninfected shrimp such as muscles, hepatopancreas, heart, gills and eye tissues (100mg of each) and haemolymph (50 microl) were subjected to SDS-PAGE. In infected muscle tissue, six newly expressed proteins were detected. In infected haemolymph, four new proteins and three intensely expressed high molecular weight proteins were observed. Three intensely expressed high molecular weight proteins were detected in infected heart ...

Energy Technology Data Exchange (ETDEWEB)

Mixed-conducting Sr-Fe-Co oxides have potential applications in dense ceramic membranes for high-purity oxygen separation and/or methane conversion to produce syngas (CO + H{sub 2}), because of their combined high electronic/ionic conductivity and significant oxygen permeability. We studied the crystal structure and microstructure of the system in X-ray diffraction experiments and by using scanning electron microscopy, respectively. Thermogravimetric analysis was conducted on the SrFeCo{sub 0.5}O{sub x} sample in environments of various oxygen partial pressures (pO{sub 2}). Conductivity increased while weight decreased with increasing temperature. Activation energy decreased while conductivity increased with increasing pO{sub 2}. The pO{sub 2}-dependent conducting behavior of the SrFeCo{sub 0.5}O{sub x} system can be understood by considering the trivalent-to-divalent transition of transition-metal ions.

Science.gov (United States)

We examined the subcellular localization of ryanodine receptors (RyR) in the cardiac muscle of carp using biochemical, immunohistochemical, and electron microscopic methods and compared it with those of rats and guinea pigs. To achieve this goal, an anti-RyR antibody was newly raised against a synthetic peptide corresponding to an amino acid sequence that was conserved among all sequenced RyRs. Western blot analysis using this antibody detected a single RyR band following the SDS-PAGE of sarcoplasmic reticulum (SR) membranes from carp atrium and ventricle as well as from mammalian hearts and skeletal muscles. The carp heart band had slightly greater mobility than those of mammalian hearts. Although immunohistochemical staining showed evident striations corresponding to the Z lines in longitudinal sections of mammalian hearts, clusters of punctate staining, in contrast, were distributed ubiquitously throughout carp atrium and ventricle. Electron microscopic images ...

Energy Technology Data Exchange (ETDEWEB)

The isotropic and anisotropic hyperfine constants of the ground X/sup 2/..sigma../sup +/ state of /sup 88/SrF and /sup 86/SrF are reported. Vibrational and rotational dependences are studied in a Dunham expansion analysis. Furthermore, the vibrational, rotational, and isotopic dependence of the spin-rotation constant is determined. The following values are obtained for X/sup 2/..sigma../sup +/, ..nu.. = 0, in /sup 88/SrF: ..gamma../sub 0/ = 74.79485 MHz, ..gamma../sub 1/ = 5.752 x 10/sup -5/ MHz, ..gamma../sub 2/ = -6.3 x 10/sup -10/ MHz, b/sub 0/ = 97.0834 MHz, b/sub 1/ = -3.300 x 10/sup -4/ MHz, c/sub 0/ = 30.268 MHz, C/sub I/ = 0.00230 MHz, where ..gamma.. is the spin-rotation parameter, b and c are the Frosch and Foley hyperfine parameters, and C/sub I/ is a nuclear spin-rotation correction. 4 figures, 4 tables.

International Nuclear Information System (INIS)

The 1985 evaluation of A = 1-1 (85B1114) has been revised. Experimental information is presented from the neutron-rich "1"0"1Sr to the neutron-deficient "1"0"1In.

International Nuclear Information System (INIS)

Study of the ground-state properties of Kr, Sr and Zr isotopes has been performed in the framework of the relativistic mean-field (RMF) theory using the recently proposed relativistic parameter set NL-SH. It is shown that the RMF theory provides an unified and excellent description of the binding energies, isotope shifts and deformation properties of nuclei over a large range of isospin in the Z=40 region. It is observed that the RMF theory with the force NL-SH is able to describe the anomalous kinks in isotope shifts in Kr and Sr nuclei, the problem which has hitherto remained unresolved. This is in contrast with the density-dependent Skyrme-Hartree-Fock approach which does not reproduce the behaviour of the isotope shifts about shell closure. On the Zr chain we predict that the isotope shifts exhibit a trend similar to that of the Kr and Sr nuclei. The RMF theory also predicts shape coexistence in heavy ...

UK PubMed Central (United Kingdom)

The cyclohexane-1,2-diamine-based bisbinaphthyl macrocycles (S)-/(R)-5 and their cyclic and acyclic analogs are synthesized. The interactions of...Full Text Available

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

Energy Technology Data Exchange (ETDEWEB)

This article describes the processes for the treatment of plastic waste: sampling, sorting, comminution. The requirements for the different processes for waste treatment (as recycling, utilization as raw material, energy recovery, combustion) are listed. (SR)

UK PubMed Central (United Kingdom)

Observations made during biochemical and toxicological studies of the housefly, in which the WHO standard reference (SR) strain was used as a standard, indicated that this strain differs from other...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

The authors investigated the effect of T-2 toxin on rat liver mitochondrial protein synthesis. Isolated rat liver mitochondria were supplemented with an S-100 supernatant from rat liver and an external ATP-generating system. An in-vitro assay employing cycloheximide, and inhibitor of cytoplasmic protein synthesis, and chloramphenicol, and inhibitor of mitochondrial protein synthesis, to distinguish mitochondrial protein synthesis from the cytoplasmic process. Amino acid incorporation into mitochondria was dependent on the concentration of mitochondria and was inhibited by chloramphenicol. The rate of uptake of tritium leucine into mitochondrial protein was unaffected by the addition of T-2 toxin and was not a rate-limiting step in incorporation. However, 0.02 micrograms/ml of T-2 toxin decreased the rate of protein synthesis inhibition correlated with the amount ...

Science.gov (United States)

We describe a method for affinity purification of sequence-specific DNA binding proteins that is fast and effective. Complementary chemically synthesized oligodeoxynucleotides that contain a recognition site for a sequence-specific DNA binding protein are annealed and ligated to give oligomers. This DNA is then covalently coupled to Sepharose CL-2B with cyanogen bromide to yield the affinity resin. A partially purified protein fraction is combined with competitor DNA and subsequently passed through the DNA-Sepharose resin. The desired sequence-specific DNA binding protein is purified because it preferentially binds to the recognition sites in the affinity resin rather than to the nonspecific competitor DNA in solution. For example, a protein fraction that is enriched for transcription factor Sp1 can be further purified 500- to 1000-fold by two sequential affinity chromatography ...

Energy Technology Data Exchange (ETDEWEB)

We propose a novel method for ultrasensitive isotope analysis that combines magnetic mass selection, resonant charge-exchange neutralization, and resonant laser ionizaion. Our method attains high isotopic abundance selectivity by means of continuous multistage separation of ions stored in a small ring. For the environmentally interesting case of /sup 90/Sr versus /sup 88/Sr we estimate that sensitivity better than 10/sup -15/ for a throughput of 10/sup 13/ atoms/sec and an efficiency (after the ion source) greater than 10% are readily achievable.

Energy Technology Data Exchange (ETDEWEB)

High-resolution spectroscopy of 13 bright red giants and Ba stars shows selective enhancement of Ba in three of them, HD 65699 (Ba 2), ..cap alpha..TrA (K4 III), and epsilonPeg (K2 Ib). Infrared spectra available for HD 65699 show that Sr is enhanced, too. This selective enhancement is discussed in terms of a modified s-process which converts some of the pre-existing r- and s-process matter into the magic nuclei /sup 88/Sr and /sup 138/Ba.

International Nuclear Information System (INIS)

Results of monitoring milk and tap water in New York City are presented. The New York City sample is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly "9"0Sr to calcium ratios for New York City since the inception of the sampling program in 1954 are presented. Samples of New York City tap water are taken daily, so that by the end of the month, approximately 100 liters have been collected. The available cesium-137 data expressed as the "1"3"7Cs to "9"0Sr ratio are also given.

International Nuclear Information System (INIS)

The form factor for excitation of the 1"+ state at 3.48 MeV in "8"8Sr by inelastic electron scattering has been measured for momentum transfers q = 0.24-0.62 fm"-"1. Neither its magnitude nor shape can be described employing the best available nuclear wave functions. We demonstrate with a schematic model that the observed reduction of the form factor may be understood by taking into account a renormalization of the M1-operator due to virtual #DELTA#-hole excitations. (orig.).