TOREX-4: a torsatron proof of principle experiment

International Nuclear Information System (INIS)

Politzer, P.A.; Lidsky, L.M.; Montgomery, D.B.

1979-03-01

TOREX-4 is a torsatron Proof of Principle experiment designed to simultaneously achieve ntau approx. = to 5 x 10 13 , n approx. = to 5 x 10 14 /cm 3 , and T greater than or equal to 1 keV. TOREX-4 is capable of operating without externally driven currents; sufficient neutral beam power to reach betas of 2 to 5% is provided. The unique 4(+2) constant pitch angle winding configuration allows the reliable design of large systems with far greater experimental flexibility than can be achieved in conventional stellarators of comparable size. This will allow investigation of the basic physics questions of the torsatron configuration over a wide range of plasma properties and field configurations without sacrifice of the Proof of Principle goals

Experimental studies on the Auburn Torsatron: Progress report

International Nuclear Information System (INIS)

Gandy, R.F.; Swanson, D.G.

1987-10-01

Progress on the Auburn Torsatron is discussed in this report. In particular, experiments are described dealing with methods of surface mapping the magnetic configuration, plasma confinement studies, ion cyclotron heating and modification to the device

Overview of results from the ATF torsatron

International Nuclear Information System (INIS)

Colchin, R.J.; Murakami, M.; Anabitarte, E.; Anderson, F.S.B.; Bell, G.L.; Bell, J.D.; Bigelow, T.S.; Crume, E.C.; Dunlap, J.L.; Dyer, G.R.; England, A.C.; Fisher, P.W.; Gabbard, W.A.; Glowienka, J.C.; Goulding, R.H.; Halliwell, J.W.; Hanson, G.R.; Harris, J.H.; Haste, G.R.; Hidalgo-Vera, C.; Hillis, D.L.; Hiroe, S.; Horton, L.D.; Howe, H.C.; Hutchinson, D.P.; Isler, R.C.; Jernigan, T.C.; Kwon, M.; Langley, R.A.; Lee, D.K.; Lyon, J.F.; Lue, J.W.; Ma, C.H.; Menon, M.M.; Morris, R.N.; Mioduszewski, P.K.; Neilson, G.H.; Qualls, A.L.; Rasmussen, D.A.; Rogers, P.S.; Shaw, P.L.; Shepard, T.D.; Simpkins, J.E.; Sudo, S.; Thomas, C.E.; Uckan, T.; Wade, M.R.; Wilgen, J.B.; Wing, W.R.; Yamada, H.; Zielinski, J.J.

1990-01-01

Experiments involving plasma improvement, confinement scaling, bootstrap currents, and edge fluctuations have been carried out in the Advanced Toroidal Facility (ATF) torsatron [Fusion Technol. 10, 179 (1986)]. Average densities bar n e ≤9x10 19 m -3 have been obtained, with global energy confinement times τ * E ≤20 msec. Confinement times generally follow the stellarator/torsatron empirical scaling law, τ SL =0.17xP -0.58 n 0.69 e B 0.84 a 2 R 0.75 (with τ SL in seconds, power P in megawatts, density n e in 10 20 m -3 , and plasma radius a and major radius R in meters). Gas injection during neutral beam injection (NBI) causes increases in n e , so that τ * E does not decrease during NBI. Edge plasma fluctuations are found to exhibit a mode change near the peak of the energy confinement time. Plasma currents observed during electron cyclotron heating have been identified as bootstrap currents

H-mode study in CHS

International Nuclear Information System (INIS)

Toi, K.; Morisaki, T.; Sakakibara, S.

1995-02-01

In CHS rapid H-mode transition is observed in NBI heated deuterium and hydrogen plasmas without obvious isotope effect, when a net plasma current is ramped up to increase the external rotational transform. The H-mode of CHS has many similarities with those in tokamaks. Recent measurement with fast response Langmuir probes has revealed that the rapid change in floating potential occurs at the transition, but the change follows the formation of edge transport barrier. The presence of ι/2π = 1 surface near the edge and sawtooth crash triggered by internal modes may play an important role for determining the H-mode transition in CHS. (author)

High-mode-number ballooning modes in a heliotron/torsatron system: 1, Local magnetic shear

International Nuclear Information System (INIS)

Nakajima, N.

1996-05-01

The characteristics of the local magnetic shear, a quantity associated with high-mode-number ballooning mode stability, are considered in heliotron/torsatron devices that have a large Shafranov shift. The local magnetic shear is shown to vanish even in the stellarator-like region in which the global magnetic shear is positive. The reason for this is that the degree of the local compression of the poloidal magnetic field on the outer side of the torus, which maintains the toroidal force balance, is reduced in the stellarator-like region of global magnetic shear because the global rotational transform in heliotron/torsatron systems is a radially increasing function. This vanishing of the local magnetic shear is a universal property in heliotron/torsatron systems with a large Shafranov shift since it results from toroidal force balance in the stellarator-like global shear regime that is inherent to such systems

ATFSR: a small torsatron reactor

International Nuclear Information System (INIS)

Houlberg, W.A.; Lacatski, J.T.; Uckan, N.A.

1985-01-01

A small (average minor radius anti a approx. = 1 m), moderate-aspect-ratio torsatron reactor based on the Advanced Toroidal Facility (ATF) is proposed as a starting point for improved stellarator reactor designs. The major limitation of the compact size is the lack of space under the helical coils for the blanket and shield. Neoclassical confinement models for helically trapped particles show that a large electric potential (radial electric field) is necessary to achieve ignition in a device of this size, although high-Q operation is still attainable with more modest potentials

Investigation of a washer-stack plasma gun on the Auburn torsatron

International Nuclear Information System (INIS)

Austin, M.E. Jr.

1986-01-01

A pulsed device for producing a highly-ionized plasma in the Auburn Torsatron is described and construction details given. A plasma is formed by discharging a 14 uF capacitor charged to 6 to 12 kV through a titanium washer impregnated with hydrogen. The ions and electrons are injected transversely into the Torsatron confinement field and the plasma is studied with an x-band microwave interferometer and H-alpha spectral-line detectors. The results of initial measurements to determine the optimal performance parameters for the gun, such as discharge voltage and position, are presented. Also, peak electron density and decay time of the guns plasma are given for different machine and souce conditions

Helical magnetic axis configuration combined with l = 1 and weak l = -1 torsatron fields

International Nuclear Information System (INIS)

Kikuchi, Hitoshi; Saito, Katsunori; Gesso, Hirokazu; Shiina, Shoichi

1989-01-01

The superposition of a relatively weak l = -1 torsatron field on a main l = 1 torsatron field leads to the improvement of the confinement properties due to the formation of a local magnetic well, which results from the local curvature of the helical magnetic axis with a larger excursion in the major radius direction. This l±1 helical magnetic axis system has a comparatively simple, compact coil structure. Here the vacuum configuration properties of l = ±1 system are described. (author)

ATF-1 torsatron studies

International Nuclear Information System (INIS)

Lyon, J.F.; Carreras, B.A.; Charlton, L.A.

1983-01-01

The main advances in the ORNL Stellarator Program since the 1982 IAEA Conference have been: (1) engineering design of the ATF-1 torsatron; (2) extension of 3-D MHD equilibrium and stability studies and calculations of helical axis configurations; (3) study of stable equilibria with greater than or equal to 8% and direct access to the second stability regime; (4) 3-D Monte Carlo and analytic transport calculations which show a large reduction in transport at low collisionality for the absolute value of e phi'/T' greater than or equal to 1; (5) calculation of ambipolar electric fields; and (b) calculation of well confined ion drift surfaces in the ergodic field region outside the last closed flux surface

Anticancer agent CHS-828 inhibits cellular synthesis of NAD

DEFF Research Database (Denmark)

Olesen, U.H.; Christensen, M.K.; Bjorkling, F.

2008-01-01

Malignant cells display increased demands for energy production and DNA repair. Nicotinamide adenine dinucleotide (NAD) is required for both processes and is also continuously degraded by cellular enzymes. Nicotinamide phosphoribosyltransferase (Nampt) is a crucial factor in the resynthesis of NAD......, and thus in cancer cell survival. Here, we establish the cytotoxic mechanism of action of the small molecule inhibitor CHS-828 to result from impaired synthesis of NAD. Initially, we detected cross-resistance in cells between CHS-828 and a known inhibitor of Nampt, FK866, a compound of a structurally...... different class. We then showed that nicotinamide protects against CHS-828-mediated cytotoxicity. Finally, we observed that treatment with CHS-828 depletes cellular NAD levels in sensitive cancer cells. In conclusion, these results strongly suggest that, like FK866, CHS-828 kills cancer cells by depleting...

Neoclassical transport in a multiple-helicity torsatron in the low-collisionality (1/#betta#) regime

International Nuclear Information System (INIS)

Shaing, K.C.; Hokin, S.A.

1983-02-01

For a sufficiently high number of field periods (m/iota > l), the magnetic field of a multiple helicity torsatron can be reduced to a simple form such that the second adiabatic invariant J can be calculated. It is found that the particle and the heat fluxes for a multiple helicity torsatron in the low collisionality (1/#betta#) regime have the same geometric dependences. An optimization of both quantities is carried out for a given equilibrium constraint. It is shown that the transport fluxes can be smaller than those of the conventional stellarator by an order of magnitude. The effect of finite plasma beta on the neoclassical fluxes is also studied

RF plasma production and heating below ion-cyclotron frequencies in Uragan torsatrons

International Nuclear Information System (INIS)

Moiseenko, V.E.; Berezhnyj, V.L.; Bondarenko, V.N.; Burchenko, P.Ya.; Chechkin, V.V.; Chernyshenko, V.Ya.; Dreval, M.B.; Garkusha, I.E.; Glazunov, G.P.; Grigor'eva, L.I.; Konovalov, V.G.; Kotsubanov, V.D.; Kramskoi, Ye.D.; Kulaga, A.E.; Lozin, A.V.; Castejon, F.; Hidalgo, C.; Hartmann, D.; Koch, R.; Lyssoivan, A.I.

2011-01-01

In the IPP-Kharkiv there are two torsatrons (stellarators) in operation, and in both of them Alfven resonance heating under high-k || conditions is used. This method of heating is advantageous for small-size devices, since in contrast to the minority and second-harmonic heating it can be realized at lower plasma densities. A series of experiments has been performed at the Uragan-3M torsatron with an aim to investigate the features of the discharge with a three-half-turn antenna. Electron temperatures in the T-bar = 0.2-0.5 keV range are achieved at plasma densities n-bar e approx. (0.5-1.5) x 10 13 cm -3 . The plasma energy content has increased by a factor of 2 with respect to the plasma produced with the frame antenna. A new four-strap shielded antenna has been manufactured and installed in the Uragan-2M. A high-frequency discharge for wall conditioning is introduced in the Uragan-2M torsatron. The discharge is sustained by a specially designed small frame antenna, and efficient hydrogen dissociation is achieved. A self-consistent model has been developed for simulation of plasma production in ICRF. The model includes a set of particle and energy-balance equations for the electrons, and the boundary problem for the Maxwell equations. The first calculation results on RF plasma production in the Uragan-2M stellarator with the frame-type antenna are presented.

Magnetic surface mapping with highly transparent screens on the Auburn Torsatron

International Nuclear Information System (INIS)

Hartwell, G.J.; Gandy, R.F.; Henderson, M.A.; Hanson, J.D.; Swanson, D.G.; Bush, C.J.; Colchin, R.J.; England, A.C.; Lee, D.K.

1987-01-01

In stellarator-type magnetic confinement devices (of which the torsatron is one), the magnetic field is produced entirely by external, current-carrying coils. Two methods for mapping magnetic surfaces in the Auburn Torsatron were tested and compared, both of which involve the use of highly transparent screens. The first method consists of coating the screen with a phosphor that emits light when struck by electrons emitted by an electron gun. A pattern representative of a magnetic surface is formed on the screen, and this pattern is recorded photographically. The second method uses an uncoated screen to collect electrons emitted from an emissive probe, which is scanned over a poloidal cross section of the torus. Under certain conditions, the collected current is a constant over a particular magnetic surface so that a contour plot of the current versus position is equivalent to a plot of the magnetic surfaces. Parametric studies of the two methods are presented, and the effectiveness of each technique is discussed

MHD instabilities in heliotron/torsatron

International Nuclear Information System (INIS)

Wakatani, Masahiro; Nakamura, Yuji; Ichiguchi, Katsuji

1992-01-01

Recent theoretical results on MHD instabilities in heliotron/torsatron are reviewed. By comparing the results with experimental data in Heliotron E, Heliotron DR and ATF, it is pointed out that resistive interchange modes are the most crucial instabilities, since the magnetic hill occupies a substantial region of the plasma column. Development of three-dimensional MHD equilibrium codes has made significant progress. By applying the local stability criteria shown by D 1 (ideal MHD mode) and D R (resistive MHD mode) to the equilibria given by the three-dimensional codes such as BETA and VMEC, stability thresholds for the low n ideal modes or the low n resistive modes may be estimated with resonable accuracy, where n is a toroidal mode number. (orig.)

Overexpression of CtCHS1 Increases Accumulation of Quinochalcone in Safflower

Directory of Open Access Journals (Sweden)

Dandan Guo

2017-08-01

Full Text Available Carthami flos, the dried petal of safflower (Carthamus tinctorius L. has been widely used in traditional Chinese medicine to treat cardiovascular and cerebrovascular diseases, in which quinochalcone glucosides such as hydrosafflower yellow A (HSYA, carthamin are uniquely present and have been identified as active compounds. In the present study, through sequencing of a safflower floret cDNA library and subsequent microarray analysis, we found 23 unigenes (5 PALs, 1 C4Hs, 5 4CLs, 6 CHSs, 2 CHIs, 2 DFRs, 2 FLSs involved in flavonoid pathway, of which 4 were up-regulated differentially during quinochalcone glucosides accumulation with the floret developing stage. The up-regulated genes were verified by PCR methods. Considering chalcone synthase are entry enzyme in flavonoid biosynthesis, CHS1 was focused on target gene to verify its function furtherly. Bioinformation analysis showed that CHS1 shared 86.94% conserved residues with CHS from other plants. Subcellular localization showed that CtCHS1 was localized in cytoplasm in onion epidermal cells. The transgenic safflower plant with overexpression CtCHS1 by Agrobacterium-mediated pollen-tube pathway method was firstly generated. The results present that expression of PAL2, PAL3, CHS1, CHS4, CHS6 increased and expression of CHI1 and CHI2 decreased in the transgenic plant floret. Meanwhile, the accumulation of quinochalcone glucosides increased by ∼20–30% and accumulation of quercetin-3-β-D-glucoside and quercetin decreased by 48 and 63% in the transgenic plant floret. These results suggested that CtCHS1 played an important role in quinochalcone glucosides biosynthesis rather than flavonol biosynthesis. These results also demonstrated that the pollen-tube pathway method was an efficient method for gene transformation in safflower. Our study will provide a deep understanding of potential synthetic genes involved in quinochalcone biosynthetic pathway.

Beta limit of resistive plasma in Torsatron / Heliotron

International Nuclear Information System (INIS)

Itoh, K.; Ichiguchi, K.; Itoh, S.I.

1992-02-01

Stability against the interchange mode in the Torsatron / Heliotron device is investigated, taking into account the effects of the resistivity, current diffusivity, ion viscosity and thermal diffusivity. Critical beta for the low-mode-number stability is found at the finite beta value. For the range of plasma parameters of the present experiments, the resistive mode and current diffusive mode set comparable critical beta values, which are consistent with experimental observations. In future high temperature plasmas, the current diffusive mode determines the stability limit for the global mode. (author)

Comparison of parallel viscosity with neoclassical theory

International Nuclear Information System (INIS)

Ida, K.; Nakajima, N.

1996-04-01

Toroidal rotation profiles are measured with charge exchange spectroscopy for the plasma heated with tangential NBI in CHS heliotron/torsatron device to estimate parallel viscosity. The parallel viscosity derived from the toroidal rotation velocity shows good agreement with the neoclassical parallel viscosity plus the perpendicular viscosity. (μ perpendicular = 2 m 2 /s). (author)

Energy confinement in the torsatron URAGAN-3M during the rf-heating mode

International Nuclear Information System (INIS)

Pashnev, V.K.; Burchenko, P.Ya.; Lozin, A.V. and others

2008-01-01

Energy confinement time of plasma in torsatron U-3M was measured both during quasi-stationary study of RF-discharge and after RF-power cut-off. Power absorbed by plasma in the confinement region was estimated. A mechanism which explain the plasma density behavior in the confinement region is proposed

Cellular pharmacodynamics of the cytotoxic guanidino-containing drug CHS 828. Comparison with methylglyoxal-bis(guanylhydrazone).

Science.gov (United States)

Ekelund, S; Sjöholm, A; Nygren, P; Binderup, L; Larsson, R

2001-04-20

N-(6-(4-chlorophenoxy)hexyl)-N'-cyano-N"-4-pyridylguanidine (CHS 828) is a new guanidino-containing compound with antitumoral activity both in vitro and in vivo. Its activity profile differs from those of standard cytotoxic drugs but the mechanism of action is not yet fully understood. CHS 828 is presently in early phase I and II clinical trials. In the present study, the pharmacodynamic effects at the cellular level of CHS 828 was compared to another compound containing two guanidino groups, methylglyoxal-bis(guanylhydrazone) (MGBG). MGBG is known to inhibit the synthesis of polyamines, which are important in, e.g., proliferation and macromolecular synthesis. The concentration-response relationship of CHS 828 closely resembled that of MGBG and the drugs were similar with respect to inhibition of DNA and protein synthesis. On the other hand, CHS 828 induced a significant increase in cellular metabolism while MGBG did not. The cytotoxic effect of MGBG was reversed by the addition of exogenous polyamines, while that of CHS 828 was unaffected. Unlike MGBG, there was also no effect of CHS 828 on the levels of decarboxylating enzymes in the polyamine biosynthesis. In conclusion, CHS 828 does not appear to share any major mechanisms of action with the polyamine synthesis inhibitor MGBG. Further studies will be required to define the exact mechanism of action of CHS 828.

Azimuthal electric fields and ambipolarity in a multiple-helicity torsatron

International Nuclear Information System (INIS)

Hastings, D.E.; Shaing, K.C.

1985-01-01

In a torsatron there are multiple solutions to the ambipolarity relationship for the electric field. If the electric field is small over some region of space then the self-consistent poloidal electric field can be important and lead to potential islands. If the plasma is in the superbanana plateau regime, then slow resonant particles limit the rate of change of the electric field and, hence, give a minimum width for the spatial zone where the plasma is changing roots of the ambipolarity relationship

Ripple transport in helical-axis advanced stellarators - a comparison with classical stellarator/torsatrons

International Nuclear Information System (INIS)

Beidler, C.D.; Hitchon, W.N.G.

1993-08-01

Calculations of the neoclassical transport rates due to particles trapped in the helical ripples of a stellarator's magnetic field are carried out, based on solutions of the bounce-averaged kinetic equation. These calculations employ a model for the magnetic field strength, B, which is an accurate approximation to the actual B for a wide variety of stellarator-type devices, among which are Helical-Axis Advanced Stellarators (Helias) as well as conventional stellarators and torsatrons. Comparisons are carried out in which it is shown that the Helias concept leads to significant reductions in neoclassical transport rates throughout the entire long-mean-free-path regime, with the reduction being particularly dramatic in the ν -1 regime. These findings are confirmed by numerical simulations. Further, it is shown that the behavior of deeply trapped particles in Helias can be fundamentally different from that in classical stellarator/torsatrons; as a consequence, the beneficial effects of a radial electric field on the transport make themselves felt at lower collision frequency than is usual. (orig.)

Development of a conception of the stellarator based on torsatron and modular systems

International Nuclear Information System (INIS)

Georgiyevskiy, A.V.; Rudakov, V.A.; Tolok, V.T.

2003-01-01

The paper presents the historical review of the stellarator conception development on the example of thermonuclear research at the Kharkov Institute of Physics and Technology. The given material covers a period from the time of the large-scale stellarator 'Ukraine' offered by I.V.Kurchatov up to the present. The main attention put to torsatron and modular systems

IBR5 Modulates Temperature-Dependent, R Protein CHS3-Mediated Defense Responses in Arabidopsis.

Directory of Open Access Journals (Sweden)

Jingyan Liu

2015-10-01

Full Text Available Plant responses to low temperature are tightly associated with defense responses. We previously characterized the chilling-sensitive mutant chs3-1 resulting from the activation of the Toll and interleukin 1 receptor-nucleotide binding-leucine-rich repeat (TIR-NB-LRR-type resistance (R protein harboring a C-terminal LIM (Lin-11, Isl-1 and Mec-3 domains domain. Here we report the identification of a suppressor of chs3, ibr5-7 (indole-3-butyric acid response 5, which largely suppresses chilling-activated defense responses. IBR5 encodes a putative dual-specificity protein phosphatase. The accumulation of CHS3 protein at chilling temperatures is inhibited by the IBR5 mutation. Moreover, chs3-conferred defense phenotypes were synergistically suppressed by mutations in HSP90 and IBR5. Further analysis showed that IBR5, with holdase activity, physically associates with CHS3, HSP90 and SGT1b (Suppressor of the G2 allele of skp1 to form a complex that protects CHS3. In addition to the positive role of IBR5 in regulating CHS3, IBR5 is also involved in defense responses mediated by R genes, including SNC1 (Suppressor of npr1-1, Constitutive 1, RPS4 (Resistance to P. syringae 4 and RPM1 (Resistance to Pseudomonas syringae pv. maculicola 1. Thus, the results of the present study reveal a role for IBR5 in the regulation of multiple R protein-mediated defense responses.

A Malus crabapple chalcone synthase gene, McCHS, regulates red petal color and flavonoid biosynthesis.

Directory of Open Access Journals (Sweden)

Deqiang Tai

Full Text Available Chalcone synthase is a key and often rate-limiting enzyme in the biosynthesis of anthocyanin pigments that accumulate in plant organs such as flowers and fruits, but the relationship between CHS expression and the petal coloration level in different cultivars is still unclear. In this study, three typical crabapple cultivars were chosen based on different petal colors and coloration patterns. The two extreme color cultivars, 'Royalty' and 'Flame', have dark red and white petals respectively, while the intermediate cultivar 'Radiant' has pink petals. We detected the flavoniods accumulation and the expression levels of McCHS during petals expansion process in different cultivars. The results showed McCHS have their special expression patterns in each tested cultivars, and is responsible for the red coloration and color variation in crabapple petals, especially for color fade process in 'Radiant'. Furthermore, tobacco plants constitutively expressing McCHS displayed a higher anthocyanins accumulation and a deeper red petal color compared with control untransformed lines. Moreover, the expression levels of several anthocyanin biosynthetic genes were higher in the transgenic McCHS overexpressing tobacco lines than in the control plants. A close relationship was observed between the expression of McCHS and the transcription factors McMYB4 and McMYB5 during petals development in different crabapple cultivars, suggesting that the expression of McCHS was regulated by these transcription factors. We conclude that the endogenous McCHS gene is a critical factor in the regulation of anthocyanin biosynthesis during petal coloration in Malus crabapple.

Proto-CIRCUS tilted-coil tokamak–torsatron hybrid: Design and construction

Energy Technology Data Exchange (ETDEWEB)

Clark, A.W.; Doumet, M.; Hammond, K.C. [Department of Applied Physics and Applied Mathematics, Columbia University, New York, NY 10027 (United States); Kornbluth, Y. [Yeshiva University, New York, NY 10033 (United States); Spong, D.A. [Oak Ridge National Laboratory, Oak Ridge, TN 37830 (United States); Sweeney, R. [Department of Applied Physics and Applied Mathematics, Columbia University, New York, NY 10027 (United States); Volpe, F.A., E-mail: fvolpe@columbia.edu [Department of Applied Physics and Applied Mathematics, Columbia University, New York, NY 10027 (United States)

2014-11-15

Highlights: • A tokamak-like device with tilted toroidal field (TF) coils needs less plasma current than a conventional tokamak. • Rotational transform is partly generated by external coils. Device can be considered a tokamak–torsatron hybrid. • We designed and constructed the first device of this type. • Tilted TF coils are interlinked to each other, which helps to reduce aspect ratio of plasma. • This is a six-coil generalization of CNT stellarator, also at Columbia University, which features two interlinked coils. - Abstract: We present the field-line modeling, design, and construction of a prototype circular-coil tokamak–torsatron hybrid called Proto-CIRCUS. The device has a major radius R = 16 cm and minor radius a < 5 cm. The six “toroidal field” coils are planar as in a tokamak, but they are tilted. This, combined with induced or driven plasma current, is expected to generate rotational transform, as seen in field-line tracing and equilibrium calculations. The device is expected to operate at lower plasma current than a tokamak of comparable size and magnetic field, which might have interesting implications for disruptions and steady-state operation. Additionally, the toroidal magnetic ripple is less pronounced than in an equivalent tokamak in which the coils are not tilted. The tilted coils are interlocked, resulting in a relatively low aspect ratio, and can be moved, both radially and in tilt angle, between discharges. This capability will be exploited for detailed comparisons between calculations and field-line mapping measurements. Such comparisons will reveal whether this relatively simple concept can generate the expected rotational transform.

Plasma engineering analysis of a small torsatron reactor

International Nuclear Information System (INIS)

Lacatski, J.T.; Houlberg, W.A.; Uckan, N.A.

1985-10-01

This study examines the plasma physics and reactor engineering feasibility of a small, medium aspect ratio, high-beta, l = 2, D-T torsatron power reactor, based on the magnetic configuration of the Advanced Toroidal Facility, Oak Ridge National Laboratory. Plasma analyses are performed to assess whether confinement in a small, average radius plasma is sufficient to yield an ignited or high-Q driven device. Much of the physics assessment focuses on an evaluation of the radial electric field created by the nonambipolar particle flux. Detailed transport simulations are done with both fixed and self-consistent evolution of the radial electric field. Basic reactor engineering considerations taken into account are neutron wall loading, maximum magnetic field at the helical coils, coil shield thickness, and tritium breeding blanket-shield thickness

Fluctuations and stability in the Advanced Toroidal Facility (ATF) torsatron

International Nuclear Information System (INIS)

Harris, J.H.; Charlton, L.A.; Bell, J.D.; Bigelow, T.S.; Carreras, B.A.; Colchin, R.J.; Crume, E.C.; Dominguez, N.; Dunlap, J.L.; Dyer, G.R.; England, A.C.; Glowienka, J.C.; Hillis, D.L.; Hiroe, S.; Horton, L.D.; Howe, H.C.; Isler, R.C.; Jernigan, T.C.; Leboeuf, J.N.; Lee, D.K.; Lynch, V.E.; Lyon, J.F.; Menon, M.M.; Murakami, M.; Rasmussen, D.A.; Uckan, T.; Wilgen, J.B.; Wing, W.R.; Bell, G.L.; Crocker, N.A.; Hanson, G.R.; Thomas, C.E.; Wade, M.R.; Ritz, C.P.

1990-01-01

We present the results of experimental and theoretical studies of fluctuations and instabilities in the ATF torsatron, a type of stellarator. Measurements of globally coherent magnetic fluctuations in high-β plasmas with narrow pressure profiles produced by a field error show evidence of self-stabilization ('second stability'); the trends are compatible with theoretical analysis of self-stabilization of resistive curvature-driven instabilities, but there are discrepancies between the absolute experimental and theoretical fluctuation amplitudes. Fluctuation measurements in plasma with broad pressure profiles reveal new phenomena--specifically, toroidally localized magnetic fluctuations, whose amplitudes increase with plasma pressure, and coherent density fluctuations with significant radial width

Theoretical and experimental studies on electric field and confinement in helical systems

International Nuclear Information System (INIS)

Sanuki, H.; Itoh, K.; Todoroki, J.; Ida, K.; Idei, H.; Iguchi, H.; Yamada, H.

1994-06-01

The present study consists of two parts. The first part is oriented to a theoretical model of selfconsistent analysis to determine simultaneously the electric field and loss cone boundary in heliotron/torsatron configurations under the influence of nonclassical particle losses. The second part is referred to the analysis on NBI heated and ECH plasmas in Compact Helical System (CHS) device. A comparison is made between theoretical results and experimental observations. (author)

Forecasting parameters of a the monuclear power plant with a torsatron reactor

International Nuclear Information System (INIS)

Artyugina, I.M.; Semenov, A.A.; Smirnov, A.N.

1982-01-01

A number of problems related to forecasting technical economical factors of thermonuclear electric plant (TNPP) based on the torsatron reactor is considered. Possible methodic approaches to the estimation of TNPP nonstandard equipment construction-mounting works and the results of forecasting the investment structure in TNPP are analysed. The influence of TP basic systems on the total investment value depending on accepted price level is shown. Quantitative estimations of specific investments and electric energy production cost permit to estimate rather optimistically the considered TNPP type and to draw a conclusion on advisability of the further study

Morphological regulation of Aspergillus niger to improve citric acid production by chsC gene silencing.

Science.gov (United States)

Sun, Xiaowen; Wu, Hefang; Zhao, Genhai; Li, Zhemin; Wu, Xihua; Liu, Hui; Zheng, Zhiming

2018-04-02

The mycelial morphology of Aspergillus niger, a major filamentous fungus used for citric acid production, is important for citric acid synthesis during submerged fermentation. To investigate the involvement of the chitin synthase gene, chsC, in morphogenesis and citric acid production in A. niger, an RNAi system was constructed to silence chsC and the morphological mutants were screened after transformation. The compactness of the mycelial pellets was obviously reduced in the morphological mutants, with lower proportion of dispersed mycelia. These morphological changes have caused a decrease in viscosity and subsequent improvement in oxygen and mass transfer efficiency, which may be conducive for citric acid accumulation. All the transformants exhibited improvements in citric acid production; in particular, chsC-3 showed 42.6% higher production than the original strain in the shake flask. Moreover, the high-yield strain chsC-3 exhibited excellent citric acid production potential in the scale-up process.The citric acid yield and the conversion rate of glucose of chsC-3 were both improved by 3.6%, when compared with that of the original strain in the stirred tank bioreactor.

Topics on MHD equilibrium and stability in heliotron / torsatron

International Nuclear Information System (INIS)

Ichiguchi, Katsuji; Nakajima, Noriyoshi; Okamoto, Masao.

1996-10-01

Recent topics on the MHD properties with and without bootstrap current in Heliotron / Torsatron configurations are presented. In a currentless equilibrium with a large Shafranov shift, a high-n ballooning mode can be unstable even in the region with positive gradient of the rotational transform. This is because the local shear in the field line bending term can be reduced by the fact that the local enhancement of the poloidal field varies in the radial direction. Since the local curvature of the field lines depends on the label of the magnetic field line, α, in Heliotron / Torsatron, the eigenvalue ω 2 also depends on α. In the Mercier stable region, the level surfaces of ω 2 of unstable modes form spheroids in the (ψ, θ k , α) space, where ψ and θ k are the label of the flux surface and the radial wave number, while they form cylinders in tokamaks. Such high-n modes cannot be related to low-n modes in this case. In the LHD configuration, bootstrap current depends on the collisionality of the plasma. When the beta value is raised by increasing the temperature with the density fixed, the plasma becomes less collisional and the bootstrap current grows in the direction where the rotational transform is increased. On the contrary, when the beta value is raised by increasing the density with the temperature fixed, the plasma becomes more collisional. While a small amount of the current flows in the same direction as in the above sequence at low beta in this case, the direction of the current reverses at high beta equilibrium. This is because the geometrical factor in the expression of the bootstrap current in the plateau regime has opposite signature to that in the 1/ν regime. The latter equilibrium sequence is more stable in the Mercier criterion than the former one. Thus, the beta should be raised by increasing the density rather than the temperature to obtain stable high beta plasma. (author)

Measurements of flux surfaces in the ATF torsatron

International Nuclear Information System (INIS)

England, A.C.; Colchin, R.J.; Harris, J.H.; Hillis, D.L.; Jernigan, T.C.; Anderson, F.S.B.

1989-01-01

Flux surfaces in the advanced toroidal facility (ATF) torsatron have been measured using electron-beam techniques. The beam was injected toroidally and impinged on a phosphor-coated screen located ∼ 180 degrees from the gun. The gun was mounted on a drive mechanism that enabled the beam to scan the entire cross section of the last closed flux surface in ATF. The screen material was st. steel, coated with ZnO:Zn (P-15 or P-24) phosphor, and the transparency was ∼ 90%. The emitted light was detected with an image-intensified CCD camera that viewed the mesh through a nearby port. The images were displayed directly on a TV monitor and stored on video tape. Frames from the video tape were transferred to a computer, where the image was enhanced and transformed to remove spatial distortions due to the lens and the viewing angle of the camera

Trapped particle confinement studies in L = 2 torsatrons for additional helical coils, radial electric field and finite beta effect

International Nuclear Information System (INIS)

Kato, A.; Nakamura, Y.; Wakatani, M.

1990-07-01

L = 2 torsatrons are studied to improve the high energy trapped particle confinement with additional l = 1 and/or l = 3 helical coils. The winding laws are selected in two ways. One is to realize 'σ - optimization' by the additional helical coils, but this approach loses magnetic well region. The other selection is to produce or deepen the magnetic well by the additional helical coils. L=3 helical coils are usable to this end. In this case the improvement of the trapped particle confinement depends on magnetic axis position. Radial electric field producing sheared rotational motion is also considered to improve the trapped particle confinement in a standard l = 2 torsatron. By excluding cancellation between E x B and ΔB drift motion occurred for the parabolic potential profiles, all deeply trapped particles can be confined in the central region. Degradation of the trapped particle confinement by the Shafranov shift is mitigated by shifting the magnetic axis inside in the vacuum configuration. (author)

Formation and termination of High ion temperature mode in Heliotron/torsatron plasmas

International Nuclear Information System (INIS)

Ida, K.; Kondo, K.; Nagasaki, K.

1997-01-01

Physics of the formation and termination of High ion temperature mode (high T i mode) are studied by controlling density profiles and radial electric field. High ion temperature mode is observed for neutral beam heated plasmas in Heliotron/torsatron plasmas (Heliotron-E). This high T i mode plasma is characterized by a peaked ion temperature profile and is associated with a peaked electron density profile produced by neutral beam fueling with low wall recycling. This high T i mode is terminated by flattening the electron density caused by either gas puffing or second harmonic ECH (core density 'pump-out'). (author)

Stabilisation of ballooning modes in torsatrons with an externally applied toroidal current

International Nuclear Information System (INIS)

Cooper, W.A.

1996-01-01

It has been found that ideal ballooning modes can impose very restrictive volume average β limits in torsatrons much below the typical values close to 5% that are required to be economically realisable as reactor systems and it has been shown that externally applied toroidal currents that are peaked can destabilise the Mercier criterion in this type of configuration. We will show here that if the applied currents are hollow, they can stabilise the ballooning modes without triggering Mercier instabilities and as a result raise the limiting β* from 2% to 5%. (author) 3 figs., 10 refs

Dynamic cerebral autoregulation measured with coherent hemodynamics spectroscopy (CHS)

Science.gov (United States)

Kainerstorfer, Jana M.; Sassaroli, Angelo; Tgavalekos, Kristen T.; Fantini, Sergio

2015-03-01

Coherent Hemodynamics Spectroscopy (CHS) is a novel technique for non-invasive measurements of local microcirculation quantities such as the capillary blood transit times and dynamic autoregulation. The basis of CHS is to measure, for instance with near-infrared spectroscopy (NIRS), peripheral coherent hemodynamic changes that are induced by controlled perturbations in the systemic mean arterial pressure (MAP). In this study, the MAP perturbation was induced by the fast release of two pneumatic cuffs placed around the subject's thighs after they were kept inflated (at 200 mmHg) for two minutes. The resulting transient changes in cerebral oxy- (O) and deoxy- (D) hemoglobin concentrations measured with NIRS on the prefrontal cortex are then described by a novel hemodynamic model, from which quantifiable parameters such as the capillary blood transit time and a cutoff frequency for cerebral autoregulation are obtained. We present results on eleven healthy volunteers in a protocol involving measurements during normal breathing and during hyperventilation, which is known to cause a hypocapnia-induced increase in cerebral autoregulation. The measured capillary transit time was unaffected by hyperventilation (normal breathing: 1.1±0.1 s; hyperventilation: 1.1±0.1 s), whereas the cutoff frequency of autoregulation, which increases for higher autoregulation efficiency, was indeed found to be significantly greater during hyperventilation (normal breathing: 0.017±0.002 Hz; hyperventilation: 0.034±0.005 Hz). These results provide a validation of local cerebral autoregulation measurements with the new technique of CHS.

Equipotential surfaces in the Proto-Cleo Torsatron

International Nuclear Information System (INIS)

Trost, P.; Shohet, J.L.

1984-01-01

Space potential measurements have been made with the use of an emissive probe in the Proto-Cleo Torsatron. The emissive probe surface is heated to a temperature at which thermionic emission of electrons can occur. When the potential of the probe is less than the space potential, the probe predominately emits electrons, thus raising its potential. If the potential of the probe becomes greater than the space potential, the probe emits electrons at a much lower rate than it collects electrons, and thus the probe drops in potential. The dependence of the emitted and collected electron currents on the potential difference provides an accurate method to determine the space potential in the plasma. Space potential measurements have been made with this probe. The data are plotted as equipotential contours. A good correlation is seen between the equipotential measurements and the numerically predicted E.C.R.H. absorption layer, while the E.C.R.H. is on. During the time after the E.C.R.H. has been turned off, there is good correspondence between numerically calculated magnetic surfaces and the equipotential plots

A special correcting winding for the l = 2 torsatron with split-type helical coils

International Nuclear Information System (INIS)

Kotenko, V.G.

2012-01-01

A split-type special correcting winding (split-type SCW) for the l = 2 torsatron toroidal magnetic system with split-type helical coils is considered. The split-type SCW gives the possibility of controlling the position of the magnetic surface configuration in the direction perpendicular to the torus equatorial plane. Numerical simulations were carried out to investigate the influence of the split-type SCW magnetic field on centered and distant relative to the torus surface magnetic surface configuration with a plane magnetic axis, being promising for the fusion reactor. The configuration is realized in the l = 2 torsatron with split-type helical coils and with the coils of an additional toroidal magnetic field. The calculations show that the split-type SCW magnetic field influence on the initial magnetic surface configuration leads mainly to the magnetic surface configuration displacement along the straight z axis of torus rotation. The displacement of ∼0.1a, a is the minor radius of the torus, has no critical effect on the magnetic surface parameters. An idea on the split-type SCW magnetic field structure is obtained by numerical simulations of the effect of this field as a minority magnetic field imposed on the magnetic field of a well-known configuration. The split-type SCW magnetic field is directed, predominantly along the major radius of the torus within its volume. The displacement range of the closed magnetic surface configuration depends on the split-type SCW magnetic field value.

Chalcone Synthase (CHS) Gene Suppression in Flax Leads to Changes in Wall Synthesis and Sensing Genes, Cell Wall Chemistry and Stem Morphology Parameters

Science.gov (United States)

Zuk, Magdalena; Działo, Magdalena; Richter, Dorota; Dymińska, Lucyna; Matuła, Jan; Kotecki, Andrzej; Hanuza, Jerzy; Szopa, Jan

2016-01-01

The chalcone synthase (CHS) gene controls the first step in the flavonoid biosynthesis. In flax, CHS down-regulation resulted in tannin accumulation and reduction in lignin synthesis, but plant growth was not affected. This suggests that lignin content and thus cell wall characteristics might be modulated through CHS activity. This study investigated the possibility that CHS affects cell wall sensing as well as polymer content and arrangement. CHS-suppressed and thus lignin-reduced plants showed significant changes in expression of genes involved in both synthesis of components and cell wall sensing. This was accompanied by increased levels of cellulose and hemicellulose. CHS-reduced flax also showed significant changes in morphology and arrangement of the cell wall. The stem tissue layers were enlarged averagely twofold compared to the control, and the number of fiber cells more than doubled. The stem morphology changes were accompanied by reduction of the crystallinity index of the cell wall. CHS silencing induces a signal transduction cascade that leads to modification of plant metabolism in a wide range and thus cell wall structure. PMID:27446124

Choice of cooling regime of the superconducting magnetic system of the ''Crystal-2'' torsatron

International Nuclear Information System (INIS)

Glasov, B.V.; Druj, O.S.; Kurnosov, V.I.; Skibenko, E.I.; Yuferov, V.B.

1981-01-01

General requirements to a system of cryogenic cooling of superconducting magnetic systems (SMS) are formulated. Distributions of the value of thermal stresses about the temperature range are obtained for basic construction materials of SMS ''Crystal-2'' torsatron. Concrete circuits of SMS cryoprovision are considered. Values of specific and total heat capacity of the system, specific consumption of liquid are determined taking into consideration constructional peculiarities of SMS of''Crystal-2'' plant. Efficiency of different ways of SMS cooling are estimated, dynamical dependences of cooling and heating of SMS of the ''Crystal-2'' plant are obtained taking this into consideration [ru

High beta experiments in CHS

International Nuclear Information System (INIS)

Okamura, S.; Matsuoka, K.; Nishimura, K.

1994-09-01

High beta experiments were performed in the low-aspect-ratio helical device CHS with the volume-averaged equilibrium beta up to 2.1 %. These values (highest for helical systems) are obtained for high density plasmas in low magnetic field heated with two tangential neutral beams. Confinement improvement given by means of turning off gas puffing helped significantly to make high betas. Magnetic fluctuations increased with increasing beta, but finally stopped to increase in the beta range > 1 %. The coherent modes appearing in the magnetic hill region showed strong dependence on the beta values. The dynamic poloidal field control was applied to suppress the outward plasma movement with the plasma pressure. Such an operation gave fixed boundary operations of high beta plasmas in helical systems. (author)

Phosphorus starvation induces post-transcriptional CHS gene silencing in Petunia corolla.

Science.gov (United States)

Hosokawa, Munetaka; Yamauchi, Takayoshi; Takahama, Masayoshi; Goto, Mariko; Mikano, Sachiko; Yamaguchi, Yuki; Tanaka, Yoshiyuki; Ohno, Sho; Koeda, Sota; Doi, Motoaki; Yazawa, Susumu

2013-05-01

The corolla of Petunia 'Magic Samba' exhibits unstable anthocyanin expression depending on its phosphorus content. Phosphorus deficiency enhanced post-transcriptional gene silencing of chalcone synthase - A in the corolla. Petunia (Petunia hybrida) 'Magic Samba' has unstable red-white bicolored corollas that respond to nutrient deficiency. We grew this cultivar hydroponically using solutions that lacked one or several nutrients to identify the specific nutrient related to anthocyanin expression in corolla. The white area of the corolla widened under phosphorus (P)-deficient conditions. When the P content of the corolla grown under P-deficient conditions dropped to 40 corollas until the plants died. Other elemental deficiencies had no clear effects on anthocyanin suppression in the corolla. After phosphate was resupplied to the P-deficient plants, anthocyanin was restored in the corollas. The expression of chalcone synthase-A (CHS-A) was suppressed in the white area that widened under P-suppressed conditions, whereas the expression of several other genes related to anthocyanin biosynthesis was enhanced more in the white area than in the red area. Reddish leaves and sepals developed under the P-deficient condition, which is a typical P-deficiency symptom. Two genes related to anthocyanin biosynthesis were enhanced in the reddish organs. Small interfering RNA analysis of CHS-A showed that the suppression resulted from post-transcriptional gene silencing (PTGS). Thus, it was hypothesized that the enhancement of anthocyanin biosynthetic gene expression due to P-deficiency triggered PTGS of CHS-A, which resulted in white corolla development.

Solve: a non linear least-squares code and its application to the optimal placement of torsatron vertical field coils

International Nuclear Information System (INIS)

Aspinall, J.

1982-01-01

A computational method was developed which alleviates the need for lengthy parametric scans as part of a design process. The method makes use of a least squares algorithm to find the optimal value of a parameter vector. Optimal is defined in terms of a utility function prescribed by the user. The placement of the vertical field coils of a torsatron is such a non linear problem

Papers presented at the 6th H-mode workshop (Seeon, Germany)

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

The 6th H-mode workshop was held at Kloster Seeon (Germany) during the period of September 22-24, 1997. Contribution to this workshop is reported. Reports include. 1. Role of Nonuniform Superthermal Ions for Internal Transport Barriers. 2. Electric Field Bifurcation and Transition in the Core Plasma of CHS. 3. Formation and Termination of High Ion Temperature Mode in Heliotron/torsatron Plasmas. 4. Transition to an Enhanced Internal Transport Barrier. 5. Physics of Collapses - Probabilistic Occurrence of ELMs and Crashes -. (J.P.N.)

RNA interference silencing of CHS greatly alters the growth pattern of apple (Malus x domestica).

Science.gov (United States)

Dare, Andrew P; Hellens, Roger P

2013-08-01

Plants produce a vast array of phenolic compounds which are essential for their survival on land. One major class of polyphenols are the flavonoids and their formation is dependent on the enzyme chalcone synthase (CHS). In a recent study we silenced the CHS genes of apple (Malus × domestica Borkh.) and observed a loss of pigmentation in the fruit skin, flowers and stems. More surprisingly, highly silenced lines were significantly reduced in size, with small leaves and shortened internode lengths. Chemical analysis also revealed that the transgenic shoots contained greatly reduced concentrations of flavonoids which are known to modulate auxin flow. An auxin transport study verified this, with an increased auxin transport in the CHS-silenced lines. Overall, these findings suggest that auxin transport in apple has adapted to take place in the presence of high endogenous concentrations of flavonoids. Removal of these compounds therefore results in abnormal auxin movement and a highly disrupted growth pattern.

Experimental studies of radio frequency waves and confinement in the Auburn Torsatron. Progress report

International Nuclear Information System (INIS)

Swanson, D.G.

1985-01-01

The first year of operation of the Auburn Torsatron has resulted in the majority of the basic operating systems becoming operational or nearly operational. The diagnostic systems now include two microwave interferometers, a monochrometer, several probes and photodiodes. The plasma is produced by any of three sources: electron cyclotron heating with a cw power of 1 kW, low frequency rf heating with power soon to come up to 10 kW cw, and a pulsed washer-stack gun. The magnetic field studies have mapped the field surfaces and several corrections have been made to center the plasma. The ion-cyclotron source and antenna are nearly ready for experiments to begin

Analysis of the energy efficiency of the implementation power electric generated modules in the CHS

Science.gov (United States)

Sukhikh, A. A.; Milyutin, V. A.; Lvova, A. M.

2017-11-01

Application on the Central heat source (CHS) local generation of electricity is primarily aimed at solving problems of own needs of electric energy that not only guarantees the independence of the work of the CHS from external electrical networks, but will prevent the stop of heat supply of consumers and defrosting heating networks in case of accidents in electrical networks caused by natural or anthropogenic factors. Open the prospects of electric power supply stand-alone objects, such commercial or industrial objects on the territory of a particular neighborhood.

Traffic of chitin synthase 1 (CHS-1) to the Spitzenkörper and developing septa in hyphae of Neurospora crassa: actin dependence and evidence of distinct microvesicle populations.

Science.gov (United States)

Sánchez-León, Eddy; Verdín, Jorge; Freitag, Michael; Roberson, Robert W; Bartnicki-Garcia, Salomon; Riquelme, Meritxell

2011-05-01

We describe the subcellular location of chitin synthase 1 (CHS-1), one of seven chitin synthases in Neurospora crassa. Laser scanning confocal microscopy of growing hyphae showed CHS-1-green fluorescent protein (GFP) localized conspicuously in regions of active wall synthesis, namely, the core of the Spitzenkörper (Spk), the apical cell surface, and developing septa. It was also present in numerous fine particles throughout the cytoplasm plus some large vacuoles in distal hyphal regions. Although the same general subcellular distribution was observed previously for CHS-3 and CHS-6, they did not fully colocalize. Dual labeling showed that the three different chitin synthases were contained in different vesicular compartments, suggesting the existence of a different subpopulation of chitosomes for each CHS. CHS-1-GFP persisted in the Spk during hyphal elongation but disappeared from the septum after its development was completed. Wide-field fluorescence microscopy and total internal reflection fluorescence microscopy revealed subapical clouds of particles, suggestive of chitosomes moving continuously toward the Spk. Benomyl had no effect on CHS-1-GFP localization, indicating that microtubules are not strictly required for CHS trafficking to the hyphal apex. Conversely, actin inhibitors caused severe mislocalization of CHS-1-GFP, indicating that actin plays a major role in the orderly traffic and localization of CHS-1 at the apex.

ICRH studies in TJ-IU torsatron

International Nuclear Information System (INIS)

Castejon, F.; Longinov, A.V.; Rodriguez R, L.

1993-01-01

Preliminary studies for Ion Cyclotron Resonance Heating (ICRH) in the frequency range f=3-150 MHz are presented for TJ-IU torsatron. This wide range implies the use of two different theoretical models. The first valid for high frequency, where the WKB approximation is applicable, and the second one which solves the full wave equation in one dimension. The high frequency calculations have been made using a ray tracing code and taking into account the magnetic field and plasma 3-D inhomogeneity. The results obtained in this case are presented in the first paper of this report, being the most important the criterion to avoid Fast Wave (fw)-slow wave (SW) coupling at Lower Hybrid Resonance, near the plasma edge, and the existence of so called Localized Modes. for the low frequency range wave-length is of the size of the plasma radius, therefore, the WKB approximation cannot be used. In this case a 1-D model is used which disregards toroidal effects, to study the main available heating scenarios which are presented in the second work of this report. the studies are made for hydrogen, deuterium and mixed plasmas with and without He 3 minority. Finally, the antenna designs to reach these several scenarios are presented in the third paper. Two different antenna models are provided for SW excitation, one of the current type and the other one of potential type. A third antenna is designed to excite FW which is similar to the current type antenna for SW, but rotated 90 degree Celsius

ICRH studies in TJ-IU torsatron

International Nuclear Information System (INIS)

Castejon, F.

1993-01-01

Preliminary studies for ion Cyclotron Resonance Heating (ICRH) in the frequency range f=3-150 MHz are presented for TJ-IU torsatron. This wide range implies the use of two different theoretical models. The first valid for high frequency, where the WKB approximation is applicable, and the second one which solves the full wave equation in one dimension. The high frequency calculations have been made using a ray tracing code and taking into account the magnetic field and plasma 3-D inhomogeneity. The results obtained in this case are presented in the first paper of this report, being the most important the criterion to avoid Fast Wave (FW)-Slow Wave (SW) coupling at Lower Hybrid Resonance, near the plasma edge, and the existence of so called Localized Modes. For the low frequency range wave-length is of the size of the plasma radius, there fore, the WKB approximation cannot be used. In this case a 1-D model is used which disregards toroidal effects, to study the main available heating scenarios which are presented in the second work of this report. The studies are made for hydrogen, deuterium and mixed plasmas with and without He3 majority. Finally, the antenna designs to reach these several scenarios are presented in the third paper. Two different antenna models are provided for SW excitation, one of the current type and the other one of potential type. A third antenna is designed to excite FW which is similar to the current type antenna for SW, but rotated 90 degree centigree. (Author)11 refs

Application of the Ball-Pen Probe in Two Low-Temperature Magnetised Plasma Devices and in Torsatron TJ-K

Czech Academy of Sciences Publication Activity Database

Adámek, Jiří; Peterka, M.; Gyergyek, T.; Kudrna, P.; Ramisch, M.; Stroth, U.; Cavalier, Jordan; Tichý, M.

2013-01-01

Roč. 53, č. 1 (2013), s. 39-44 ISSN 0863-1042. [International Workshop on Electric Probes in Magnetized Plasmas/9./. Iasi, 21.09.2011-23.09.2011] R&D Projects: GA AV ČR KJB100430901; GA ČR GA202/07/0044 Institutional support: RVO:61389021 Keywords : Ball- pen probe * magnetron * torsatron * CASTOR tokamak * coefficient Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.983, year: 2013 http://onlinelibrary.wiley.com/doi/10.1002/ctpp.201310007/pdf

Oligodeoxynucleotides Can Transiently Up- and Downregulate CHS Gene Expression in Flax by Changing DNA Methylation in a Sequence-Specific Manner

Directory of Open Access Journals (Sweden)

Magdalena Dzialo

2017-05-01

Full Text Available Chalcone synthase (CHS has been recognized as an essential enzyme in the phenylpropanoid biosynthesis pathway. Apart from the leading role in the production of phenolic compounds with many valuable biological activities beneficial to biomedicine, CHS is well appreciated in science. Genetic engineering greatly facilitates expanding knowledge on the function and genetics of CHS in plants. The CHS gene is one of the most intensively studied genes in flax. In our study, we investigated engineering of the CHS gene through genetic and epigenetic approaches. Considering the numerous restrictions concerning the application of genetically modified (GM crops, the main purpose of this research was optimization of the plant's modulation via epigenetics. In our study, plants modified through two methods were compared: a widely popular agrotransformation and a relatively recent oligodeoxynucleotide (ODN strategy. It was recently highlighted that the ODN technique can be a rapid and time-serving antecedent in quick analysis of gene function before taking vector-mediated transformation. In order to understand the molecular background of epigenetic variation in more detail and evaluate the use of ODNs as a tool for predictable and stable gene engineering, we concentrated on the integration of gene expression and gene-body methylation. The treatment of flax with a series of short oligonucleotides homologous to a different part of CHS gene isoforms revealed that those directed to regulatory gene regions (5′- and 3′-UTR activated gene expression, directed to non-coding region (introns caused gen activity reduction, while those homologous to a coding region may have a variable influence on its activity. Gene expression changes were accompanied by changes in its methylation status. However, only certain (CCGG motifs along the gene sequence were affected. The analyzed DNA motifs of the CHS flax gene are more accessible for methylation when located within a Cp

Effects of limiter biasing on the ATF torsatron

International Nuclear Information System (INIS)

Uckan, T.; Baylor, L.R.; Bell, J.D.; Bigelow, T.S.; England, A.C.; Harris, J.H.; Isler, R.C.; Jernigan, T.C.; Lyon, J.F.; Ma, C.H.; Mioduszewski, P.K.; Murakami, M.; Rasmussen, D.A.; Wilgen, J.B.; Aceto, S.C.; Zielinski, J.J.

1992-09-01

Positive limiter biasing on the currentless Advanced Toroidal Facility (ATF) torsatron produces a significant increase in the particle confinement with no improvement in the energy confinement. Experiments have been carried out in 1-T plasmas with ∼400 kill of electron cyclotron heating ECM. Two rail limiters located at the last closed flux surface (LCFS), one at the top and one at the bottom of the device, are biased at positive and negative potentials with respect to the vessel. When the limiters are positively biased at up to 300 V, the density increases sharply to the ECH cutoff value. At the same time, the H α radiation drops, indicating that the particle confinement improves. When the density is kept constant, the H α radiation is further reduced and there is almost no change in the plasma stored energy. Under these conditions, the density profile becomes peaked and the electric field becomes outward-pointing outside the LCFS and more negative inside the LCFS. In contrast, negative biasing yields some reduction of the density and stored energy at constant gas feed, and the plasma potential profile remains the same. Biasing has almost no effect on the intrinsic impurity levels in the plasma

Equilibrium and stability studies for high beta plasmas in torsatron/heliotron devices

International Nuclear Information System (INIS)

Carreras, B.A.; Cooper, W.A.; Charlton, L.A.

1983-01-01

The equilibrium and stability properties of high β plasmas in torsatron/heliotron devices have been investigated. Three numerical approaches have been used to study plasma equilibria for a range of coil configurations. The method of averaging permits fast equilibrium and stability calculations. Two fully 3-D codes, namely the Chodura-Schluter code, and the NEAR code recently developed at ORNL, are used to explore selected regions of parameter space. The resulting equilibria calculated with different methods are in good agreement. This validates the average method approach and enhances its usefulness. Results are presented for configurations with different aspect ratios and number of field periods. The role of the vertical field has also been studied in detail. The main conclusion is that for moderate aspect ratios (Asub(p) <= 8), the self-stabilizing effect of the magnetic axis shift is large enough to open a direct path to the second stability regime. (author)

Degradation properties of the electrostatic assembly PDLLA/CS/CHS nerve conduit

Energy Technology Data Exchange (ETDEWEB)

Xu Haixing [School of Chemical Engineering, Wuhan University of Technology, Wuhan 430070 (China); Yan Yuhua; Wan Tao; Li Shipu, E-mail: yanyuhua8@126.co [Biomedical Materials and Engineering Research Center, Wuhan University of Technology, Wuhan 430070 (China)

2009-08-15

A poly(d,l-lactic acid)/chondroitin sulfate/chitosan (PDLLA/CS/CHS) nerve conduit for repairing nerve defects was prepared by electrostatic assembly and the thermally induced phase separation technique. The hydrophilic characteristics of the PDLLA/CS/CHS assembly nerve conduits were improved markedly. The degradation behavior of the nerve conduit with various assembly layers was evaluated by a pH change, weight loss rate and molecular weight change. The pH of the solution of the nerve conduit could be effectively adjusted by varying the layer numbers and overcoming the acidity-caused auto-acceleration of PDLLA; the nerve conduit can retain its integrity in a phosphate buffer solution after being degraded for 3 months. After such a conduit was implanted in the rat for 3 months, obvious degradation occurred, but the regenerated nerve was integrated and it grew successfully from the proximal to distal nerve stump. All these results implied that the degradation rate of the prepared conduit can adapt to the regeneration of the peripheral nerve, which might be a new derivative of PDLLA-based biodegradable materials for repairing nerve injuries without acidity-caused irritations and acidity-induced auto-accelerating degradation behavior as shown by PDLLA.

Equilibrium and stability studies for high-beta plasmas in torsatron/heliotron devices

International Nuclear Information System (INIS)

Carreras, B.A.; Charlton, L.A.; Cooper, W.A.

1983-01-01

The equilibrium and stability properties of high-#betta# plasmas in torsatron/heliotron devices have been investigated. Three numerical approaches have been used to study plasma equilibria for a range of coil configurations. The method of averaging permits fast equilibrium and stability calculations. Two fully 3-D codes, namely the Chodura-Schluter code, and the NEAR code recently developed at ORNL, are used to explore selected regions of parameter space. The resulting equilibria calculated with different methods are in good agreement. This validates the average method approach and enhances its usefulness. Results are presented for configurations with different aspect ratios and number of field periods. The role of the vertical field has also been studied in detail. The main conclusion is that for moderate aspect ratios (A/sub p/ less than or equal to 8), the self-stabilizing effect of the magnetic-axis shift is large enough to open a direct path to the second-stability regime

Dynamics of the pedestal structure in the edge transport barrier in CHS

International Nuclear Information System (INIS)

Kado, S.; Oishi, T.; Tanaka, S.

2006-10-01

The dynamic behavior of the edge pedestal in the edge transport barrier (ETB) formation discharge (H-mode) in the compact helical system (CHS) is investigated. Edge Harmonic Oscillations (EHOs) having a fundamental frequency of 2-4.5 kHz, depending on the magnetic configuration, and their second harmonic are observed when the density gradient of the pedestal reaches a certain threshold. There are two groups of so-called EHOs in the CHS. One is located in the edge region where the ι=1 surface exists, and the other is in the core region (although we also call it EHO in this paper) around the half radius where the ι=0.5 surface exists. The magnetic probe signal is revealed to reflect the latter mode, showing the poloidal mode number of 2, while that for the edge BES channel is 1. The density build-up saturates simultaneously with the increase of EHOs in the edge BES channel, which suggests that to a considerable extend the mode increases the particle transport. (author)

Efficiencies of the ICRF minority heating in the CHS and LHD plasmas

International Nuclear Information System (INIS)

Murakami, S.; Okamoto, M.; Nakajima, N.; Mutoh, T.

1994-01-01

ICRF minority heatings are investigated in the plasmas of the Compact Helical System (CHS) and the Large Helical Device (LHD) by means of the orbit following Monte Carlo simulation. It is found that the heating efficiency decreases with increase of the absorption power by minority ions and depends strongly on the magnetic field strength and the field configuration. (author)

Edge plasma diagnostics in the compact helical system (CHS) device using fast neutral lithium beam

Energy Technology Data Exchange (ETDEWEB)

Ueda, Mario

1992-05-01

This paper reports the research activities of the author on using fast neutral lithium beam edge plasma diagnostic, at the Japanese National Institute for Fusion Science compact helical system (CHS). (author). 20 figs.

The combination of the antitumoural pyridyl cyanoguanidine CHS 828 and etoposide in vitro–from cytotoxic synergy to complete inhibition of apoptosis

Science.gov (United States)

Martinsson, P; Ekelund, S; Nygren, P; Larsson, R

2002-01-01

The present study was aimed at elucidating the apoptosis inhibitory properties of the cyanoguanidine CHS 828. CHS 828 exhibits impressive cytotoxic activity in vitro and in vivo. Apoptosis is not its main mode of cytotoxic effect, and we have previously proposed a dual mechanism, where CHS 828 inhibits its own cell death pathways. Etoposide on the other hand, is a well-established anticancer agent with documented effect in a number of malignancies, induces apoptosis through extensively studied caspase dependent pathways. Here we studied the combined effect of the two drugs in the human lymphoma cell line U-937 GTB. Cytotoxicity was evaluated as total viability measured by the fluorometric microculture cytotoxicity assay (FMCA). Caspase activity was assessed by colorimetric detection of specific cleavage products for caspases 3, 8 and 9, respectively. Morphology was evaluated in May-Grünwald/Giemsa stained preparations. Interaction analysis based on FMCA results of simple combination exposure revealed impressive synergistic effect on cell kill. Detailed investigations of the kinetics involved showed that short pre-exposure (0–12 h) to CHS 828 enhanced caspase activation by etoposide, while longer pre-exposure (18–48 h) inhibited both caspase activation and apoptotic morphology otherwise induced by etoposide. The present results support the theory that CHS 828 block specific cell death pathways. The synergistic results are promising for future combination trials in animals, however, different dosing schedules should be considered, in order to investigate whether the above findings translate into the in vivo setting. PMID:12359640

Functional Analysis of Developmentally Regulated Genes chs7 and sec22 in the Ascomycete Sordaria macrospora.

Science.gov (United States)

Traeger, Stefanie; Nowrousian, Minou

2015-04-14

During sexual development, filamentous ascomycetes form complex, three-dimensional fruiting bodies for the generation and dispersal of spores. In previous studies, we identified genes with evolutionary conserved expression patterns during fruiting body formation in several fungal species. Here, we present the functional analysis of two developmentally up-regulated genes, chs7 and sec22, in the ascomycete Sordaria macrospora. The genes encode a class VII (division III) chitin synthase and a soluble N-ethylmaleimide-sensitive-factor attachment protein receptor (SNARE) protein, respectively. Deletion mutants of chs7 had normal vegetative growth and were fully fertile but showed sensitivity toward cell wall stress. Deletion of sec22 resulted in a reduced number of ascospores and in defects in ascospore pigmentation and germination, whereas vegetative growth was normal in the mutant. A SEC22-EGFP fusion construct under control of the native sec22 promoter and terminator regions was expressed during different stages of sexual development. Expression of several development-related genes was deregulated in the sec22 mutant, including three genes involved in melanin biosynthesis. Our data indicate that chs7 is dispensable for fruiting body formation in S. macrospora, whereas sec22 is required for ascospore maturation and germination and thus involved in late stages of sexual development. Copyright © 2015 Traeger and Nowrousian.

Edge and internal transport barrier formations in CHS

International Nuclear Information System (INIS)

Okamura, S.; Minami, T.; Akiyama, T.; Fujisawa, A.; Ida, K.; Iguchi, H.; Isobe, M.; Nagaoka, K.; Nakamura, K.; Nishimura, S.; Matsuoka, K.; Matsushita, H.; Nakano, H.; Nishiura, M.; Ohshima, S.; Shimizu, A.; Suzuki, C.; Takahashi, C.; Toi, K.; Yoshimura, Y.; Yoshinuma, M.; Oishi, T.; Kado, S.

2005-01-01

Edge transport barrier (ETB) formation was observed in CHS. Sharp decrease of Hα emission indicates the quick transition of edge particle transport. Increase of the density gradient at the edge was measured by various profile diagnostics and the improvement of the global energy confinement was confirmed based on the stellarator confinement scaling. The heating power threshold exists. The transition and back transition is controlled by the heating power. The local density measurement by the beam emission spectroscopy shows intermittent burst of the low frequency fluctuations during the ETB formation phase. The ETB formation together with the electron temperature increase (electron ITB) in the core region were observed for the NBI discharges without ECH. (author)

Determination of the electronic temperature in the torsatron TJ-I Upgrade by the two filters

Energy Technology Data Exchange (ETDEWEB)

Medina, F.; Ochando, M.

1994-07-01

A Te monitor for the TJ-IU torsatron, based on the two-filters method, has been designed. It will consist of two surface-barrier silicon detectors looking at the same plasma region through berylium filters of different thickness. Plasma electron temperature is deduced from the ratio of the soft-x-ray fluxes transmitted through the two filters. The flexibility in magnetic configuration of TJ-IU plasmas has been taken into account in the mechanical design of this diagnostic. It will be attached to an upper 1 port of the vacuum vessel and the whole system will be movable both, to change the spatial resolution when needed and to enable the scan of the full plasma cross-section to obtain the radial profile of electron temperature in a shot-to-shot basis. (Author) 7 refs.

Determination of the electronic temperature in the torsatron TJ-I Upgrade by the two filters

International Nuclear Information System (INIS)

Medina, F.; Ochando, M.

1994-01-01

A Te monitor for the TJ-IU torsatron, based on the two-filters method, has been designed. It will consist of two surface-barrier silicon detectors looking at the same plasma region through berylium filters of different thickness. Plasma electron temperature is deduced from the ratio of the soft-x-ray fluxes transmitted through the two filters. The flexibility in magnetic configuration of TJ-IU plasmas has been taken into account in the mechanical design of this diagnostic. It will be attached to an upper 1 port of the vacuum vessel and the whole system will be movable both, to change the spatial resolution when needed and to enable the scan of the full plasma cross-section to obtain the radial profile of electron temperature in a shot-to-shot basis. (Author) 7 refs

Determination of the electronic temperature in the torsatron TJ-I Upgrade by the two filters

International Nuclear Information System (INIS)

Medina, F.; Ochando, M.

1994-01-01

A Te monitor for the TJ-IU torsatron, based on the two-filters method, has been designed. It will consist of two surface-barrier silicon detectors looking at the same plasma region through berilium filters of different thickness. Plasma electron temperature is deduced from the ratio of the soft-x-ray fluxes transmitted through the two filters. The flexibility in magnetic configuration of TJ-IU plasmas has been taken into account in the mechanical design of this diagnostic. It will be attached to an upper port of the vacuum vessel and the whole system will be movable both, to change the spatial resolution when needed and to enable the scan of the full plasma cross-section to obtain the radial profile of electron temperature in a shot-to-shot basis. (Author)

Energy confinement scaling from the international stellarator database

Energy Technology Data Exchange (ETDEWEB)

Stroth, U [Max-Planck-Institut fuer Plasmaphysik, Garching (Germany); Murakami, M; Dory, R A; Yamada, H; Okamura, S; Sano, F; Obiki, T

1995-09-01

An international stellarator database on global energy confinement is presented comprising data from the ATF, CHS and Heliotron E heliotron/torsatrons and the W7-A and W7-AS shearless stellarators. Regression expressions for the energy confinement time are given for the individual devices and the combined dataset. A comparison with tokamak L mode confinement is discussed on the basis of various scaling expressions. In order to make this database available to interested colleagues, the structure of the database and the parameter list are explained in detail. More recent confinement results incorporating data from enhanced confinement regimes such as H mode are reported elsewhere. (author).

Edge plasma control using an LID configuration on CHS

Energy Technology Data Exchange (ETDEWEB)

Masuzaki, S.; Komori, A.; Morisaki, T. [National Inst. for Fusion Science, Oroshi, Toki (Japan)] [and others

1997-07-01

A Local Island Divertor (LID) has been proposed to enhance energy confinement through neutral particle control. For the case of the Large Helical Device (LHD), the separatrix of an m/n = 1/1 magnetic island, formed at the edge region, will be utilized as a divertor configuration. The divertor head is inserted in the island, and the island separatrix provides connection between the edge plasma region surrounding the core plasma and the back plate of the divertor head through the field lines. The particle flux and associated heat flux from the core plasma strike the back plate of the divertor head, and thus particle recycling is localized in this region. A pumping duct covers the divertor head to form a closed divertor system for efficient particle exhaust. The advantages of the LID are ease of hydrogen pumping because of the localized particle recycling and avoidance of the high heat load that would be localized on the leading edge of the divertor head. With efficient pumping, the neutral pressure in the edge plasma region will be reduced, and hence the edge plasma temperature will be higher, hopefully leading to a better core confinement region. A LID configuration experiment was done on the Compact Helical System (CHS) to confirm the effect of the LID. The typical effects of the LID configuration on the core plasma are reduction of the line averaged density to a half, and small or no reduction of the stored energy. In this contribution, the experimental results which were obtained in edge plasma control experiments with the LID configuration in the CHS are presented.

Modeling of neutral beam ion loss from CHS plasmas

International Nuclear Information System (INIS)

Darrow, D.S.; Isobe, Mitsutaka; Sasao, Mamiko; Kondo, T.

2000-01-01

Beam ion loss measurements from Compact Helical System (CHS) plasmas under a variety of conditions show a strong loss of ions in the range of pitch angles corresponding to transition orbits at the probe location. A numerical model has been developed which includes the beam ion orbits, and details of the detector, plasma, vessel, and neutral beam geometry. From this, the expected classical (i.e. collisionless single particle orbit) signal at the detector can be computed. Preliminary comparisons between the experimental data and model predictions indicate that the classical behavior of the orbits and the machine geometry are insufficient to explain the observations. (author)

Measurement of impurity emission profiles in CHS Plasma using AXUV photodiode arrays and VUV bandpass filters

International Nuclear Information System (INIS)

Suzuki, C.; Peterson, B.J.; Ida, K.

2004-01-01

We have designed a compact and low-cost diagnostic system for spatiotemporal distributions of specific vacuum ultraviolet (VUV) emission lines from impurities in Compact Helical System (CHS) plasmas. The system consists of 20 channel absolute extreme ultraviolet photodiode arrays combined with interchangeable thin foil filters which have passbands in the VUV region. A compact mounting module which contains all the components including an in-vacuum preamplifier for immediate current-voltage conversion has been designed and successfully fabricated. A preliminary measurement with a single module using an aluminum foil filter has been carried out for monitoring the behavior of oxygen impurity in CHS, and initial results have been obtained. Two identical modules equipped with Versa Module European bus-based analog-digital converters will be available for future tomographic measurements

Use of expression constructs to dissect the functional domains of the CHS/beige protein: identification of multiple phenotypes.

Science.gov (United States)

Ward, Diane McVey; Shiflett, Shelly L; Huynh, Dinh; Vaughn, Michael B; Prestwich, Glenn; Kaplan, Jerry

2003-06-01

The Chediak-Higashi Syndrome (CHS) and the orthologous murine disorder beige are characterized at the cellular level by the presence of giant lysosomes. The CHS1/Beige protein is a 3787 amino acid protein of unknown function. To determine functional domains of the CHS1/Beige protein, we generated truncated constructs of the gene/protein. These truncated proteins were transiently expressed in Cos-7 or HeLa cells and their effect on membrane trafficking was examined. Beige is apparently a cytosolic protein, as are most transiently expressed truncated Beige constructs. Expression of the Beige construct FM (amino acids 1-2037) in wild-type cells led to enlarged lysosomes. Similarly, expression of a 5.5-kb region (amino acids 2035-3787) of the carboxyl terminal of Beige (22B) also resulted in enlarged lysosomes. Expression of FM solely affected lysosome size, whereas expression of 22B led to alterations in lysosome size, changes in the Golgi and eventually cell death. The two constructs could be used to further dissect phenotypes resulting from loss of the Beige protein. CHS or beigej fibroblasts show an absence of nuclear staining using a monoclonal antibody directed against phosphatidylinositol 4,5 bisphosphate [PtdIns(4,5) P2]. Transformation of beige j fibroblasts with a YAC containing the full-length Beige gene resulted in the normalization of lysosome size and nuclear PtdIns(4,5)P2 staining. Expression of the carboxyl dominant negative construct 22B led to loss of nuclear PtdIns(4,5)P2 staining. Expression of the FM dominant negative clone did not alter nuclear PtdIns(4,5) P2 localization. These results suggest that the Beige protein interacts with at least two different partners and that the Beige protein affects cellular events, such as nuclear PtdIns(4,5)P2 localization, in addition to lysosome size.

Observation and interpretation of topological structures in impurity ion radiation profiles from the hot plasma of a torsatron

International Nuclear Information System (INIS)

Zurro, B.; McCarthy, K.J.; Ascasibar, E.; Aragon, F.; Burgos, C.; Lopez, A.; Salas, A.

1997-01-01

Significant features have been observed in impurity ion ultraviolet line emission profiles measured on the TJ-I U torsatron using a fast-scanning detector system with good spatial resolution. These features, which consist of flats and humps, provide evidence for the existence of topological structure in the plasma interior. It is postulated that these structures arise as a result of perturbations in the electron temperature and ion density profiles caused by magnetic islands. We develop a model to show how these structures can give rise to such features in ultraviolet radiation profiles and we use theoretical iota profiles to correlate the positions of the more prominent features with rational iota values. (orig.)

Simultaneous realization of high density edge transport barrier and improved L-mode on CHS

International Nuclear Information System (INIS)

Minami, Takashi; Okamura, Shoichi; Suzuki, Chihiro

2008-10-01

An edge transport barrier (ETB) formation and an improved L-mode (IL mode) have been simultaneously realized in high density region (n-bar e - 1.2x10 20 m -3 ) on Compact Helical System (CHS). When the ETB is formed during the IL mode, the density reduction in the edge region is suppressed by the barrier formation. As a result of the continuous increasing of the temperature by the IL mode, the stored energy during the combined mode increased up to the maximum stored energy (W p - 9.4 kJ) recorded in CHS experiments. The plasma pressure in the peripheral region increases up to three times larger than that of the L-mode, and the large edge plasma pressure gradient is formed accompanying the pedestal structure. That is caused by the anomalous transport reduction that is confirmed from the sharp drop of the density fluctuation in the edge region. The neutral particle reduction in the peripheral region and the metallic impurity accumulation in the core plasma are simultaneously observed during the high density ETB formation. (author)

Changes of the electron density distribution during MHD activity in CHS

International Nuclear Information System (INIS)

Soltwisch, H.; Tanaka, K.

2000-09-01

Density oscillations induced by MHD activities were observed in NBI heated plasmas on CHS by using an HCN laser interferometer. The accompanied changes of the density profiles were also observed. The oscillations are composition of m=0 sawteeth like crash and m=2 sinusoidal oscillations as a post courser of the crash. Possible models of the oscillation structure are examined in order to explain experimental data of the interferometer. Rotating plasma core, which is hollow profile and keeps constant elongation of the flux surface can explain amplitude and phase distribution of the sinusoidal oscillation. (author)

A grander challenge: the case of how Makerere University College of Health Sciences (MakCHS contributes to health outcomes in Africa

Directory of Open Access Journals (Sweden)

Groves Sara

2011-03-01

Full Text Available Abstract Background “Grand challenges” in global health have focused on discovery and development of technologies to save lives. The “grander challenge” involves building institutions, systems, capacity and demand to effectively deliver strategies to improve health. In 2008, Makerere University began a radical institutional change to bring together four schools under one College of Health Sciences. This paper’s objective is to demonstrate how its leadership in training, research, and services can improve health in Uganda and internationally, which lies at the core of the College’s vision. Methods A comprehensive needs assessment involved five task forces that identified MakCHS’s contribution to the Ugandan government health priorities. Data were collected through analysis of key documents; systematic review of MakCHS publications and grants; surveys of patients, students and faculty; and key informant interviews of the College’s major stakeholders. Four pilot projects were conducted to demonstrate how the College can translate research into policy and practice, extend integrated outreach community-based education and service, and work with communities and key stakeholders to address their priority health problems. Results MakCHS inputs to the health sector include more than 600 health professionals graduating per year through 23 degree programs, many of whom assume leadership positions. MakCHS contributions to processes include strengthened approaches to engaging communities, standardized clinical care procedures, and evidence-informed policy development. Outputs include the largest number of outpatients and inpatient admissions in Uganda. From 2005-2009, MakCHS also produced 837 peer-reviewed research publications (67% in priority areas. Outcomes include an expanded knowledge pool, and contributions to coverage of health services and healthy behaviors. Impacts include discovery and applications of global significance, such as

Signal Based Mixing Analysis for the magnetohydrodynamic mode reconstruction from homodyne microwave reflectometry

International Nuclear Information System (INIS)

Ejiri, Akira; Sakakibara, Satoru; Kawahata, Kazuo.

1995-03-01

A new method 'Signal Based Mixing Analysis', to extract the components which are coherent to a certain reference signal from a noisy signal, has been developed. The method is applied to homodyne microwave reflectometry to reconstruct the radial structure of a magnetohydrodynamic (MHD) mode in heliotron/torsatron Compact Helical System (CHS) [K. Matsuoka et al. Plasma Phys. Control. Nuclear Fusion Research 1988 Vol. 2, IAEA, Vienna 411 (1989)]. In CHS plasmas, MHD fluctuations measured with magnetic probes show bursts, in which the amplitude and frequency quasi-periodically vary. The signal based mixing analysis uses a set of functions which have the same amplitude and the harmonic frequency as those of the magnetic fluctuations. The product (mixing) of the signal of reflectometer and the functions yields the amplitude and phase of the coherent components. When the plasma density gradually increases, the measuring position moves radially outward. Thus, the radial structure of MHD modes can be obtained by this method. The analysis indicates several peaks and nodes inside the resonance surface of the MHD mode. In addition, the structure does not propagate radially during a burst. (author)

Structure-activity relationship analysis of cytotoxic cyanoguanidines: selection of CHS 828 as candidate drug

Directory of Open Access Journals (Sweden)

Gullbo Joachim

2009-06-01

Full Text Available Abstract Background N-(6-(4-chlorophenoxyhexyl-N'-cyano-N''-4-pyridyl guanidine (CHS 828 is the first candidate drug from a novel group of anti-tumour agents – the pyridyl cyanoguanidines, shown to be potent compounds interfering with cellular metabolism (inhibition of nicotinamide phosphoribosyl transferase and NF-κB signalling. Substituted cyanoguanidines are also found in anti-hypertensive agents such as the potassium channel opener pinacidil (N-cyano-N'-(4-pyridyl-N''-(1,2,2-trimethylpropylguanidine and histamine-II receptor antagonists (e.g. cimetidine, N-cyano-N'-methyl-N''-[2-[[(5-methylimidazol-4-yl]methyl]thio]ethylguanidine. In animal studies, CHS 828 has shown very promising activity, and phase I and II studies resulted in further development of a with a water soluble prodrug. Findings To study the structural requirements for cyanoguanidine cytotoxicity a set of 19 analogues were synthesized. The cytotoxic effects were then studied in ten cell lines selected for different origins and mechanisms of resistance, using the fluorometric microculture cytotoxicity assay (FMCA. The compounds showed varying cytotoxic activity even though the dose-response curves for some analogues were very shallow. Pinacidil and cimetidine were found to be non-toxic in all ten cell lines. Starting with cyanoguanidine as the crucial core it was shown that 4-pyridyl substitution was more efficient than was 3-pyridyl substitution. The 4-pyridyl cyanoguanidine moiety should be linked by an alkyl chain, optimally a hexyl, heptyl or octyl chain, to a bulky end group. The exact composition of this end group did not seem to be of crucial importance; when the end group was a mono-substituted phenyl ring it was shown that the preferred position was 4-substitution, followed by 3- and, finally, 2-substitution as the least active. Whether the substituent was a chloro, nitro or methoxy substituent seemed to be of minor importance. Finally, the activity patterns in the

Processes arising in the edge and diverted plasmas during ITB formation in the U-3M torsatron

Energy Technology Data Exchange (ETDEWEB)

Chechkin, V V [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Grigor' eva, L I [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Sorokovoy, E L [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Sorokovoy, Ye L [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Slavnyj, A S [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Volkov, Ye D [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Beletskij, A A [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Burchenko, P Ya [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Tsybenko, S A [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Lozin, A V [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Kulaga, A Ye; Letvinov, A P [Institute of Plasma Physics, National Science Center ' Kharkov Institute of Physics and Technology' , Akademicheskaya st. 1, 61108 Kharkov (Ukraine); Masuzaki, S; Yamazaki, K [National Institute for Fusion Science, Oroshi-cho 322-6, Toki-shi 509-5292 (Japan)

2006-05-15

Spontaneous changes in confined plasma parameters have been observed recently in the l = 3/m = 9 Uragan-3M torsatron with an RF produced and heated plasma, these being interpreted as transition to an improved confinement mode due to ITB formation near the {iota} = 1/4 rational magnetic surface. In the work presented joint studies are carried out of changes in some edge and diverted plasma characteristics that accompany ITB formation. It is shown that ITB formation induces a hard E{sub r} bifurcation at the boundary presumably driven by the ion orbit loss. As a result, E{sub r} becomes more negative, and an E{sub r} shear layer occurs, where the low-frequency microturbulence and the turbulence-induced anomalous transport are suppressed, i.e. an ETB is formed. At the pre-bifurcation phase of transition a reduction of fast ion loss takes place. The bifurcation results in an improvement of electron confinement, while the ion loss increases.

Space potential fluctuations during MHD activities in the Compact Helical System (CHS)

International Nuclear Information System (INIS)

Iguchi, H.; Fujisawa, A.; Crowley, T.P.

1998-02-01

Local space potential fluctuations have been measured during MHD activities in a low-beta NBI heated plasma in the Compact Helical System (CHS) by the use of a heavy ion beam probe (HIBP). Two types of MHD modes with accompanying potential oscillations are observed. One appears in periodic bursts with relatively low frequency (< 40 kHz) and large amplitude (20-40 volts), and is localized around the q=2 surface (average minor radius ρ ∼ 0.7). The other appears in continuous and coherent oscillation with higher frequency (105-125 kHz) and smaller amplitude (∼5 volts). This oscillation also has spatial structure. Possible interpretation for the space potential oscillations is presented. (author)

Characteristics of ICR-produced peripheral plasma in the URAGAN-3M torsatron

International Nuclear Information System (INIS)

Besedin, N.T.; Chechkin, V.V.; Fomin, I.P.

1991-01-01

Some plasma parameters outside the confinement volume near the last closed magnetic surface (LCMS) and in the divertor fluxes were studied by probe and microwave techniques during ICR production and heating of the plasma in the Uragan-3M torsatron (1=3, m=9, R o =100cm, a-bar≤11 cm, l (a-bar)≤0.29; B o ≤20kG, n-bar e ≅2x10 12 cm -3 , T i (0)=200-300 eV, T e (0)≅100 eV). When moving around the LCMS, the steepness of the radial density, electron temperature and potential profiles increases with the distance away from the ''rib'' of the LCMS. The quasi-steady radial electric field E r near the LCMS exceeds 100 V/cm and is directed outwards, opposite to the calculated ambipolar electric field inside the confinement volume. It is shown that the total flow of the diverted plasma in the spacing between two helical windings consists of (i) a weakly mobile non-resonant component which is presumably formed at the periphery due to ionization, and (ii) a component whose value and poloidal location are sensitive to resonance conditions for RF power absorption, this flow being apparently formed by a plasma diffusing through the LCMS and/or generated near the LCMS, where the filed E r is localized. Based on plasma parameters measurements after the RF pulse is switched off, a qualitative model of peripheral plasma dynamics after the end of the RF heating is constructed. 23 refs.; 13 figs. (author)

Association of Smoking, Alcohol, and Obesity with Cardiovascular Death and Ischemic Stroke in Atrial Fibrillation: The Atherosclerosis Risk in Communities (ARIC Study and Cardiovascular Health Study (CHS.

Directory of Open Access Journals (Sweden)

Younghoon Kwon

Full Text Available Atrial fibrillation (AF is associated with an increased risk of ischemic stroke and cardiovascular (CV death. Whether modifiable lifestyle risk factors are associated with these CV outcomes in AF is unknown. Among Atherosclerosis Risk in Communities (ARIC study and Cardiovascular Health Study (CHS participants with incident AF, we estimated the risk of composite endpoint of ischemic stroke or CV death associated with candidate modifiable risk factor (smoking, heavy alcohol consumption, or high body mass index [BMI], and computed the C-statistic, net reclassification improvement (NRI, and integrated discrimination improvement (IDI of incorporating each factor into the CHA2DS2-VASc. Among 1222 ARIC (mean age: 63.4 and 756 CHS (mean age: 79.1 participants with incident AF, during mean follow-up of 6.9 years and 5.7 years, there were 332 and 335 composite events respectively. Compared with never smokers, current smokers had a higher incidence of the composite endpoint in ARIC [HR: 1.65 (1.21-2.26] but not in CHS [HR: 1.05 (0.69-1.61]. In ARIC, the addition of current smoking did not improve risk prediction over and above the CHA2DS2-VASc. No significant associations were observed with alcohol consumption or BMI with CVD outcomes in AF patients from either cohort. Smoking is associated with an increased risk of ischemic stroke or CV death in ARIC, which comprised mostly middle-aged to young-old (65-74 years, but not in CHS, which comprised mostly middle-old or oldest-old (≥75 years adults with AF. However, addition of smoking to the CHA2DS2-VASc score did not improve risk prediction of these outcomes.

Apparent wavelength shifts of H-like ions caused by the spectral fine structure observed in CHS plasmas

International Nuclear Information System (INIS)

Nishimura, Shin; Ida, Katsumi

1998-01-01

A new charge exchange spectroscopy (CXS) system viewing the plasma from the upside and the downside simultaneously was installed on the Compact Helical System (CHS) to detect the absolute value of Doppler shift due to poloidal rotation velocity ( i ∼ 100 eV) and in the after-glow recombining phase (T i ∼ 30 eV). The apparent Doppler shift is always red-shift regardless the direction of plasma rotation and is explained as the effect of the spectral fine structure of hydrogen-like ions. (author)

An analytical erosion model for divertor plates and limiter experiments in CHS

International Nuclear Information System (INIS)

Sagara, A.; Noda, N.; Akiyama, R.; Arimoto, H.; Idei, H.; Iguchi, H.; Kaneko, O.; Kohmoto, T.; Kubo, S.; Matsuoka, K.; Morita, S.; Motojima, O.; Nishimura, K.; Okamura, S.; Takahasi, C.; Takita, Y.; Yamada, I.; Matsunami, N.; Rice, J.; Yamada, H.; Shoji, T.; Ueda, M.

1992-01-01

A self-consistent analytical solution for net erosion of a divertor plate which is set perpendicular to magnetic field lines is presented. The primary flux profile of hydrogen and impurities except redepositing particles is externally given as well as the return ratio of sputtered atoms to the plate. In the direction along the divertor trace, all conditions are uniform. The ionization mean free path is assumed constant to simplify equations. The analytical solution is compared with net erosion experiments carried out in compact helical system (CHS) by exposing a graphite target to a neutral beam heated plasma column introduced perpendicularly to the target along the magnetic field lines through a 2 cm slit opend on a graphite limiter. After exposure to 98 discharges, the target surface is analyzed with Rutherford backscattering method. Deposition profiles of Ti and O impurities are very well explained with the analytical predictions. (orig.)

High-mode-number ballooning modes in a heliotron/torsatron system. II. Stability

International Nuclear Information System (INIS)

Nakajima, N.

1996-01-01

In heliotron/torsatron systems that have a large Shafranov shift, the local magnetic shear is found to have no stabilizing effect on high-mode-number ballooning modes at the outer side of the torus, even in the region where the global shear is stellarator-like in nature. The disappearance of this stabilization, in combination with the compression of the flux surfaces at the outer side of the torus, leads at relatively low values of the plasma pressure to significant modifications of the stabilizing effect due to magnetic field-line bending on high-mode-number ballooning modes-specifically, that the field-line bending stabilization can be remarkably suppressed or enhanced. In an equilibrium that is slightly Mercier-unstable or completely Mercier-stable due to peaked pressure profiles, such as those used in standard stability calculations, high-mode-number ballooning modes are destabilized due to these modified stability effects, with their eigenfunctions highly localized along the field line. Highly localized mode structures such as these cause the ballooning mode eigenvalues ω 2 to have a strong field line dependence (i.e., α-variation) through the strong dependence of the local magnetic curvature, such that the level surfaces of ω 2 (ψ,θ k ,α) (≤0) become spheroids in (ψ,θ k ,α) space, where ψ labels flux surfaces and θ k is the radial wave number. Because the spheroidal level surfaces for unstable eigenvalues are surrounded by level surfaces for stable eigenvalues of high-mode-number toroidal Alfvacute en eigenmodes, those high-mode-number ballooning modes never lead to low-mode-number modes. In configuration space, these high-mode-number modes are localized in a single toroidal pitch of the helical coils, and hence they may experience substantial stabilization due to finite Larmor radius effects. copyright 1996 American Institute of Physics

Transition to the improved confinement mode in torsatron U-3M in range of rare collision frequencies

International Nuclear Information System (INIS)

Pashnev, V.K.; Sorokovov, E.L.; Berezhnyj, V.L. and others

2010-01-01

Transition to the mode of improved plasma confinement in U-3M facility earlier was discussed in works [1-3]. In these studies discussed the various processes in the confinement volume and in the peripheral plasma that accompany the transition process. Study of plasma confinement and process of transition into the mode of improved confinement just at rare collisions between plasma particles is very important because future fusion reactor based on a toroidal magnetic trap will operate under plasma parameters with rare collision frequencies ('banana' mode). The peculiarity of experiments on torsatron U-3M is that they are conducted at small density n-bar e ≤ 2 lover case x 10 12 cm -3 and, thereby, the frequency of collisions in the confinement area is in the 'banana' mode [4]. And herewith, time of collisions is essentially smaller (up to several orders for electrons and up to the order for ions) than the lifetime of plasma particles. It ensures maxwellization of distribution function and possibility to compare the obtained results with data from other experiments. The objective of this work is to study the main regularity of transition into the mode of improved confinement. Also it is interesting to compare the results with data from other facilities.

Increased understanding of neoclassical internal transport barrier on CHS

International Nuclear Information System (INIS)

Minami, T.

2002-01-01

The recent progress of the study on neoclassical internal transport barrier (N-ITB) of Compact Helical System (CHS) is reported. This barrier is formed due to the positive electric field and the electric field shear that are created by bifurcation of radial electric field with the electron cyclotron (EC) heating on helical devices. Previously N-ITB was observed for ECH plasma, recently N-ITB barrier was also observed for EC (53.2 GHz 2nd harmonic) heated NBI plasma. The N-ITB of EC heated NBI plasma is formed at the outer location (r/a=0.4-0.6) in comparison with that (r/a=0.3) of ECH plasma, so that the improved confinement region is expanded. The improvement in the ion energy transport is also observed and the ion temperature is increased up to 400 eV along with the electron temperature, that is two times higher than that of the plasma without N-ITB. The particle transport is studied by measuring the peak energy of Titanium Kα line intensity with the soft X-ray CCD camera. The energy is shifted from 4.68 kV to 4.73 kV by forming N-ITB. The improvement of the impurity transport has been confirmed inside N-ITB by comparing the experimental result with the MIST code. (author)

Combinatorial analysis of lupulin gland transcription factors from R2R3Myb, bHLH and WDR families indicates a complex regulation of chs_H1 genes essential for prenylflavonoid biosynthesis in hop (Humulus Lupulus L.

Directory of Open Access Journals (Sweden)

Matoušek Jaroslav

2012-02-01

Full Text Available Abstract Background Lupulin glands of hop produce a specific metabolome including hop bitter acids valuable for the brewing process and prenylflavonoids with promising health-beneficial activities. The detailed analysis of the transcription factor (TF-mediated regulation of the oligofamily of one of the key enzymes, i.e., chalcone synthase CHS_H1 that efficiently catalyzes the production of naringenin chalcone, a direct precursor of prenylflavonoids in hop, constitutes an important part of the dissection of the biosynthetic pathways leading to the accumulation of these compounds. Results Homologues of flavonoid-regulating TFs HlMyb2 (M2, HlbHLH2 (B2 and HlWDR1 (W1 from hop were cloned using a lupulin gland-specific cDNA library from the hop variety Osvald's 72. Using a "combinatorial" transient GUS expression system it was shown that these unique lupulin-gland-associated TFs significantly activated the promoter (P of chs_H1 in ternary combinations of B2, W1 and either M2 or the previously characterized HlMyb3 (M3. The promoter activation was strongly dependent on the Myb-P binding box TCCTACC having a core sequence CCWACC positioned on its 5' end region and it seems that the complexity of the promoter plays an important role. M2B2W1-mediated activation significantly exceeded the strength of expression of native chs_H1 gene driven by the 35S promoter of CaMV, while M3B2W1 resulted in 30% of the 35S:chs_H1 expression level, as quantified by real-time PCR. Another newly cloned hop TF, HlMyb7, containing a transcriptional repressor-like motif pdLNLD/ELxiG/S (PDLNLELRIS, was identified as an efficient inhibitor of chs_H1-activating TFs. Comparative analyses of hop and A. thaliana TFs revealed a complex activation of Pchs_H1 and Pchs4 in combinatorial or independent manners. Conclusions This study on the sequences and functions of various lupulin gland-specific transcription factors provides insight into the complex character of the regulation of the

Effect of radial electric field inhomogeneity on anomalous cross field plasma flux in Heliotron/Torsatron

International Nuclear Information System (INIS)

Yamagishi, Tomejiro; Sanuki, Heiji.

1996-01-01

Anomalous cross field plasma fluxes induced by the electric field fluctuations has been evaluated in a rotating plasma with shear flow in a helical system. The anomalous ion flux is evaluated by the contribution from ion curvature drift resonance continuum in the test particle model. The radial electric field induces the Doppler frequency shift which disappears in the frequency integrated anomalous flux. The inhomogeneity of the electric field (shear flow effect), however, induces a new force term in the flux. The curvature drift resonance also induces a new force term '/ which, however, did not make large influence in the ion flux in the CHS configuration. The shear flow term in the flux combined with the electric field in neoclassical flux reduces to a first order differential equation which governs the radial profile of the electric field. Numerical results indicate that the shear flow effect is important for the anomalous cross field flux and for determination of the radial electric field particularly in the peripheral region. (author)

Equilibrium, stability and transport in L=1 compact helical axis configuration

International Nuclear Information System (INIS)

Kikuchi, Hitoshi; Ueno, Hikaru; Aizawa, Masamitsu; Suzuki, Kiyomitsu; Gesso, Hirokazu; Saito, Katsunori; Kawakami, Ichiro; Shiina, Shoichi

1990-01-01

The L=1 torsatron is modified by two methods to improve the plasma stability. First one is the negative pitch modulation of coil winding. Second is the superposition of a relatively weak L=-1 torsatron field. These modification give rise to a local magnetic well keeping a positive magnetic shear. The equilibrium, stability and transport of plasma in these modified L=1 torsatrons are described and discussed. (author)

Proceedings of US-Japan heliotron-stellarator workshop: Volume 4

International Nuclear Information System (INIS)

1987-01-01

This paper is the fourth of four volumes on the US-Japan Heliotron-Stellarator workshop. It contains talks on the following: Compact torsatron studies; Low aspect ratio torsatron design; Optimized small stellarator designs; Currents in ATF; Computations of 3-D equilibria with islands; and Magnetic surface mapping studies

Edge harmonic oscillations at the density pedestal in the H-mode discharges in CHS Heliotron measured using beam emission spectroscopy and magnetic probe

Energy Technology Data Exchange (ETDEWEB)

Kado, S. [High Temperature Plasma Center, University of Tokyo, Kashiwanoha, Kashiwa, Chiba 277-8568 (Japan)]. E-mail: kado@q.t.u-tokyo.ac.jp; Oishi, T. [School of Engineering, University of Tokyo, Bunkyo-ku, Tokyo 113-8656 (Japan); Yoshinuma, M. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Ida, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Takeuchi, M. [Department of Energy Engineering and Science, Nagoya University, Nagoya 464-8603 (Japan); Toi, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Akiyama, T. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Minami, T. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Nagaoka, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Shimizu, A. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Okamura, S. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Tanaka, S. [School of Engineering, University of Tokyo, Bunkyo-ku, Tokyo 113-8656 (Japan)

2007-06-15

Edge harmonic oscillations (EHO) offer the potential to relax the H-mode pedestal in a tokamak, thus avoiding edge localised modes (ELM). The mode structure of the EHO in CHS was investigated using a poloidal array of beam emission spectroscopy (BES) and a magnetic probe array. The EHO exhibited a peculiar characteristic in which the first, second and third harmonics show the same wavenumber, suggesting that the propagation velocities are different. Change in the phase of higher harmonics at the time when that of the first harmonic is zero can be described as a variation along the (m, n) = (-2, 1) mode structure, though the EHO lies on the {iota} = 1 surface. This behavior leads to an oscillation that exhibits periodic dependence of shape on spatial position.

Differenz als Belastungsprobe. Verhandlungen des deutsch-jüdischen Gesprächs in Bernhard Schlinks Erzählung »Die Beschneidung«

Directory of Open Access Journals (Sweden)

Mirjam Bitter

2015-05-01

Full Text Available Schlinks Erzählung stellt anhand zweier Liebender das Scheitern eines deutsch-jüdischen Gesprächs dar und verhandelt die Frage, wie viele Differenzen eine Beziehung aushält. Die titelgebende Beschneidung tritt dabei nicht nur auf der Handlungsebene auf, wo der Protagonist durch Konversion zum Judentum die Differenz zu seiner jüdischen Freundin zu überwinden hofft. Auch auf metaphorischer Ebene problematisiert die Erzählung die ›Selbstbeschneidung‹ des Protagonisten, der aus Angst vor Tadel von jüdischen Figuren viele seiner Gedanken nicht ausspricht. Als Opfer antideutscher Vorurteile ruft er diverse antisemitische Stereotype auf. Der Beitrag geht der Frage nach, inwiefern die Erzählung damit für solch stereotypes Gedankengut sensibilisiert und subtil gegen einen antisemitischen und revisionistischen Diskurs anschreibt oder inwiefern sich der Text vielmehr in einen solchen Diskurs einschreibt.

A role of neutral hydrogen in CHS plasmas with reheat and collapse and comparison with JIPP T-IIU tokamak plasmas

International Nuclear Information System (INIS)

Morita, S.; Yamada, H.; Iguchi, H.

1992-09-01

Results are described on NBI plasmas of the Compact Helical System (CHS). An increase in the stored energy, which is called plasma 'reheat', is observed with density peaking when gas puffing is turned off in the high density region. A plasma collapse with large increase in radiation loss occurs even in discharges whose Z eff values (typically, less than 2-3) do not show any increase when the gas puffing is continued. Both phenomena are basically explained by the edge electron temperature due to the difference in the amount of edge hydrogen neutrals. After turning off the gas puffing, the central electron density n e0 shows an increase of 80% and the density peaking factor (n e0 /n-bar e ) changes from 1.0 to 2.0, in typical cases, and a high inward velocity of the impurities appears (v = 20 m/s). The accumulation is studied in relation to the poloidal rotation and the edge temperature. These results are compared with results from plasmas with IOC- and H-modes in the JIPPT-IIU tokamak. (author)

Identification of zonal flows and their characteristics on transport barrier in CHS

International Nuclear Information System (INIS)

Fujisawa, A.; Shimizu, A.; Nakano, H.; Ohshima, S.; Iguchi, H.; Yoshimura, Y.; Minami, T.; Itoh, K.; Isobe, M.; Suzuki, C.; Nishimura, S.; Akiyama, T.; Nagaoka, K.; Takahashi, C.; Ida, K.; Toi, K.; Okamura, S.; Matsuoka, K.; Itoh, S.-I.; Diamond, P.H.

2005-01-01

Relation between turbulence and electric field has been one of the central issues related to the transport physics of toroidal plasmas. Recently, zonal flow, axi-symmetric band-like structure (m=n=0) with a finite radial wavelength, has just come up the third element responsible for the plasma transport. Theories and simulations have expected that the zonal flow should be a mechanism to control the saturation level of turbulence and the resultant transport. In CHS, dual heavy ion beam probes (HIBP) succeeded to prove the presence of the zonal flow and to show the dynamics and structure of the zonal flows. The experiment shows a long-distance correlation between radial electric field (or plasma flow) in low frequency range (< ∼1 kHz), together with radial structure of the zonal flow; characteristic radial length of ∼1.5 cm and life time of ∼1.5 ms. Different characteristics of the zonal flow and turbulence was found in states with and without a transport barrier; the zonal flow activity shrinks with an increase in turbulence level after the barrier breaks down. The recent HIBP experiments have just provided further insight into the system of zonal flow and turbulence. A wavelet analysis is performed on the fluctuation on the barrier position in the state with the transport barrier. The analysis reveals a causal relationship between the zonal flow evolution and turbulence level; the zonal flow is found to increase toward the mean flow direction as turbulence level decreases in the frequency range of 100-150kHz. The observation shows the presence of a nonlinear interaction between zonal flow and the turbulence, or a process of the zonal flow to affect the turbulence level. This paper presents surveys on zonal flow, particularly the recent experiments to demonstrate a causal relationship between zonal flow component and turbulence. Besides, other results obtained with a wavelet analysis are presented on the transport barrier; e.g., density and potential

Studies of fast-ion transport induced by energetic particle modes using fast-particle diagnostics with high time resolution in CHS

International Nuclear Information System (INIS)

Isobe, M.; Toi, K.; Suzuki, C.; Nagaoka, K.; Matsushita, H.; Goto, K.

2006-01-01

The purpose of this work is to reveal the effects of the energetic particle mode (EPM) on fast-ion transport and consequent fast-ion loss in the Compact Helical System (CHS). For this purpose, fast particle diagnostics capable of following fast events originating from the EPM (f -5 Tesla at the magnetic probe position. The lost fast-ion probe (LIP) located at the outboard side of the torus indicates that bursting EPMs lead to periodically enhanced losses of co-going fast ions having smaller pitch angles in addition to losses of marginally co-passing fast ions. Coinciding with EPM bursts, the H- light detector viewing the peripheral region at the outboard side also shows large pulsed increases similar to that of the LIP whereas the detector viewing the peripheral region at the inboard side does not. This is also evidence that fast ions are expelled to the outboard side due to the EPM. The charge-exchange neutral particle analyzer indicates that only fast ions whose energy is close to the beam injection energy E b are strongly affected by EPM, suggesting in turn that observed EPMs are excited by fast ions having energy close to E b . (author)

Physical mechanism determining the radial electric field and its radial structure in a toroidal plasma

International Nuclear Information System (INIS)

Ida, Katsumi; Miura, Yukitoshi; Itoh, Sanae

1994-10-01

Radial structures of plasma rotation and radial electric field are experimentally studied in tokamak, heliotron/torsatron and stellarator devices. The perpendicular and parallel viscosities are measured. The parallel viscosity, which is dominant in determining the toroidal velocity in heliotron/torsatron and stellarator devices, is found to be neoclassical. On the other hand, the perpendicular viscosity, which is dominant in dictating the toroidal rotation in tokamaks, is anomalous. Even without external momentum input, both a plasma rotation and a radial electric field exist in tokamaks and heliotrons/torsatrons. The observed profiles of the radial electric field do not agree with the theoretical prediction based on neoclassical transport. This is mainly due to the existence of anomalous perpendicular viscosity. The shear of the radial electric field improves particle and heat transport both in bulk and edge plasma regimes of tokamaks. (author) 95 refs

The chalcone synthase multigene family of Petunia hybrida (V30): differential, light-regulated expression during flower development and UV light induction

International Nuclear Information System (INIS)

Koes, R.E.; Spelt, C.E.; Mol, J.N.M.

1989-01-01

We have analysed the expression of the 8-10 members of the gene family encoding the flavonoid biosynthetic enzyme chalcone synthase (CHS) from Petunia hybrida. During normal plant development only two members of the gene family (CHS-A and CHS-J) are expressed. Their expression is restricted to floral tissues mainly. About 90% of the total CHS mRNA pool is transcribed from CHS-A, wheares CHS-J delivers about 10% in flower corolla, tube and anthers. Expression of CHS-A and CHS-J during flower development is coordinated and (red) light-dependent. In young seedlings and cell suspension cultures expression of CHS-A and CHS-J can be induced with UV light. In addition to CHS-A and CHS-J, expression of another two CHS genes (CHS-B and CHS-G) is induced in young seedlings by UV light, albeit at a low level. In contrast to CHS genes from Leguminoseae, Petunia CHS genes are not inducible by phytopathogen-derived elicitors. Expression of CHS-A and CHS-J is reduced to a similar extent in a regulatory CHS mutant, Petunia hybrida Red Star, suggesting that both genes are regulated by the same trans-acting factors. Comparison of the promoter sequences of CHS-A and CHS-J reveals some striking homologies, which might represent cis-acting regulatory sequences. (author)

Superbanana orbits in stellarator geometries

International Nuclear Information System (INIS)

Derr, J.A.; Shohet, J.L.

1979-04-01

The presence of superbanana orbit types localized to either the interior or the exterior of stellarators and torsatrons is numerically investigated for 3.5 MeV alpha particles. The absence of the interior superbanana in both geometries is found to be due to non-conservation of the action. Exterior superbananas are found in the stellarator only, as a consequence of the existence of closed helical magnetic wells. No superbananas of either type are found in the torsatron

Ballooning Representation Approach to Low-Frequency Instabilities in Stellarators

International Nuclear Information System (INIS)

Dewar, R.L.; Gardner, H.J.; Lewandowski, J.; Persson, M.

1995-01-01

Local ideal MHD ballooning eigenvalues have been calculated on many field lines for heliac and torsatron cases using a parallel implementation of a ballooning code on a Thinking Machines Corporation CM-5 Global eigenvalues have been estimated for the torsatron test case using the ray tracing method of Dewar and Glasser and also by using the TERPSI-CHORE global eigenvalue code, with good agreement. As a preliminary to detailed study of H-1, 3-D visualizations of stability-related quantities have been produced. 6 refs

Molecular characterization and functional analysis of chalcone synthase from Syringa oblata Lindl. in the flavonoid biosynthetic pathway.

Science.gov (United States)

Wang, Yu; Dou, Ying; Wang, Rui; Guan, Xuelian; Hu, Zenghui; Zheng, Jian

2017-11-30

The flower color of Syringa oblata Lindl., which is often modulated by the flavonoid content, varies and is an important ornamental feature. Chalcone synthase (CHS) catalyzes the first key step in the flavonoid biosynthetic pathway. However, little is known about the role of S. oblata CHS (SoCHS) in flavonoid biosynthesis in this species. Here, we isolate and analyze the cDNA (SoCHS1) that encodes CHS in S. oblata. We also sought to analyzed the molecular characteristics and function of flavonoid metabolism by SoCHS1. We successfully isolated the CHS-encoding genomic DNA (gDNA) in S. oblata (SoCHS1), and the gene structural analysis indicated it had no intron. The opening reading frame (ORF) sequence of SoCHS1 was 1170bp long and encoded a 389-amino acid polypeptide. Multiple sequence alignment revealed that both the conserved CHS active site residues and CHS signature sequence were in the deduced amino acid sequence of SoCHS1. Crystallographic analysis revealed that the protein structure of SoCHS1 is highly similar to that of FnCHS1 in Freesia hybrida. The quantitative real-time polymerase chain reaction (PCR) performed to detect the SoCHS1 transcript expression levels in flowers, and other tissues revealed the expression was significantly correlated with anthocyanin accumulation during flower development. The ectopic expression results of Nicotiana tabacum showed that SoCHS1 overexpression in transgenic tobacco changed the flower color from pale pink to pink. In conclusion, these results suggest that SoCHS1 plays an essential role in flavonoid biosynthesis in S. oblata, and could be used to modify flavonoid components in other plant species. Copyright © 2017. Published by Elsevier B.V.

Edge turbulence and transport: Text and ATF modeling

International Nuclear Information System (INIS)

Ritz, C.P.; Rhodes, T.L.; Lin, H.; Rowan, W.L.; Bengtson, R.; Wootton, A.J.; Diamond, P.H.; Ware, A.S.; Thayer, D.R.

1990-01-01

We present experimental results on edge turbulence and transport from the tokamak TEXT and the torsatron ATF. The measured electrostatic fluctuations can explain the edge transport of particles and energy. Certain drive (radiation) and stabilizing (velocity shear) terms are suggested by the results. The experimental fluctuation levels and spectral widths can be reproduced by considering the nonlinear evolution of the reduced MHD equations, incorporating a thermal drive from line radiation. In the tokamak limit (with toroidal electric field) the model corresponds to the resistivity gradient mode, while in the currentless torsatron or stellarator limit it corresponds to a thermally driven drift wave

Molecular and Biochemical Analysis of Chalcone Synthase from Freesia hybrid in flavonoid biosynthetic pathway.

Directory of Open Access Journals (Sweden)

Wei Sun

Full Text Available Chalcone synthase (CHS catalyzes the first committed step in the flavonoid biosynthetic pathway. In this study, the cDNA (FhCHS1 encoding CHS from Freesia hybrida was successfully isolated and analyzed. Multiple sequence alignments showed that both the conserved CHS active site residues and CHS signature sequence were found in the deduced amino acid sequence of FhCHS1. Meanwhile, crystallographic analysis revealed that protein structure of FhCHS1 is highly similar to that of alfalfa CHS2, and the biochemical analysis results indicated that it has an enzymatic role in naringenin biosynthesis. Moreover, quantitative real-time PCR was performed to detect the transcript levels of FhCHS1 in flowers and different tissues, and patterns of FhCHS1 expression in flowers showed significant correlation to the accumulation patterns of anthocyanin during flower development. To further characterize the functionality of FhCHS1, its ectopic expression in Arabidopsis thaliana tt4 mutants and Petunia hybrida was performed. The results showed that overexpression of FhCHS1 in tt4 mutants fully restored the pigmentation phenotype of the seed coats, cotyledons and hypocotyls, while transgenic petunia expressing FhCHS1 showed flower color alteration from white to pink. In summary, these results suggest that FhCHS1 plays an essential role in the biosynthesis of flavonoid in Freesia hybrida and may be used to modify the components of flavonoids in other plants.

Molecular cloning of allelopathy related genes and their relation to HHO in Eupatorium adenophorum.

Science.gov (United States)

Guo, Huiming; Pei, Xixiang; Wan, Fanghao; Cheng, Hongmei

2011-10-01

In this study, conserved sequence regions of HMGR, DXR, and CHS (encoding 3-hydroxy-3-methylglutaryl-CoA reductase, 1-deoxyxylulose-5-phosphate reductoisomerase and chalcone synthase, respectively) were amplified by reverse transcriptase (RT)-PCR from Eupatorium adenophorum. Quantitative real-time PCR showed that the expression of CHS was related to the level of HHO, an allelochemical isolated from E. adenophorum. Semi-quantitative RT-PCR showed that there was no significant difference in expression of genes among three different tissues, except for CHS. Southern blotting indicated that at least three CHS genes are present in the E. adenophorum genome. A full-length cDNA from CHS genes (named EaCHS1, GenBank ID: FJ913888) was cloned. The 1,455 bp cDNA contained an open reading frame (1,206 bp) encoding a protein of 401 amino acids. Preliminary bioinformatics analysis of EaCHS1 revealed that EaCHS1 was a member of CHS family, the subcellular localization predicted that EaCHS1 was a cytoplasmic protein. To the best of our knowledge, this is the first report of conserved sequences of these genes and of a full-length EaCHS1 gene in E. adenophorum. The results indicated that CHS gene is related to allelopathy of E. adenophorum.

Down-regulation of a chitin synthase a gene by RNA interference enhances pathogenicity of Beauveria bassiana ANU1 against Spodoptera exigua (HÜBNER).

Science.gov (United States)

Lee, Jung-Bok; Kim, Hyun Soo; Park, Youngjin

2017-02-01

Chitin synthase (CHS) is an important enzymatic component, which is required for chitin formation in the cuticles and cuticular linings of other tissues in insects. CHSs have been divided into two classes, classes A and B, based on their amino acid sequence similarities and functions. Class A CHS (CHS-A) is specifically expressed in the epidermis and related ectodermal cells such as tracheal cells, while class B CHS (CHS-B) is expressed in gut epithelial cells that produce peritrophic matrices. In this study, we cloned the CHS-A gene from the beet armyworm, Spodoptera exigua (SeCHS-A). The SeCHS-A contains an open reading frame of 4,698 nucleotides, encoding a protein of 1,565 amino acids with a predicted molecular mass of approximately 177.8 kDa. The SeCHS-A mRNA was expressed in all developmental stages and specifically in the epidermis and tracheae tissue by quantitative real-time-PCR analysis. Expression of SeCHS-A gene was suppressed by feeding double-stranded RNA (dsCHS-A, 400 ng/larva) in the third instar larvae of S. exigua. Suppression of the SeCHS-A gene expression significantly increased 35% of mortality on pupation of S. exigua. Also, the third instar larvae fed with dsCHS-A significantly increased susceptibility to entomopathogenic fungi, Beauveria bassiana ANU1 at 3 days after treatment. These results suggest that the SeCHS-A gene plays an important role in development of S. exigua and RNA interference may apply to effective pest control with B. bassiana. © 2017 Wiley Periodicals, Inc.

Factors influencing the work passion of Chinese community health service workers: an investigation in five provinces.

Science.gov (United States)

Luo, Zhenni; Bai, Xue; Min, Rui; Tang, Changmin; Fang, Pengqian

2014-05-01

After the implementation of new healthcare reform, Chinese government paid increasing attention to developing community health service (CHS). The current focus is mainly on cultivating community general practitioners but paying less attention to the working status and occupational demands of in-service CHS workers. Work passion is playing an important role for medical workers. With work passion, CHS workers' team will become more stable and more effective, ensuring the sustainable development of CHS system. At present, the work passion of CHS workers is relatively low. Studying on influencing factors of work passion of CHS workers, promoting their work passion, and making them keep enthusiasm for work are significant. A total of 100 CHS organizations were sampled randomly in 10 cities from 5 Chinese provinces for this study. A total of 3450 CHS workers from these CHS institutions took part in the surveys. Questionnaires were used to collect data, including socio-demographic information, work passion and opinion on influencing causes, and work-related satisfaction. Pearson chi-square statistical method was used to identify the factors related to CHS workers' work passion. Binary logistic regression was performed to determine the significant factors that influence CHS workers' work passion. A total of 38.77% of those who accomplished the questionnaire expressed that they didn't have passion for current work. The related factors that influence CHS workers' work passion are (1) socio-demographic factors such as age, and years of employment, and (2) other work-related factors such as learning and training opportunities, compensation packages, work stress, and personal development opportunities. CHS workers were most dissatisfied with the balance between remuneration and workload, job promotion opportunities. Based on the results, the government should concern for CHS workers' working status and work-related demands, pay more attention and meet their demands for

Correlation between physical and mechanical properties changes of austenitic steel ChS-68 under high dose irradiation

International Nuclear Information System (INIS)

Ershova, O.V.; Shcherbakov, E.N.; Evseev, M.V.; Shihkalev, V.S.; Kozlov, A.V.; Garner, F.

2007-01-01

Full text of publication follows: It is well known that void swelling at high levels exerts significant influence on physical, mechanical and creep properties of austenitic steels. For many fusion or fission reactor concepts it is desirable not only to characterize these relationships but also to develop nondestructive measurements to measure swelling without removing components from the reactor. Previous studies at this institute have shown that swelling can be estimated using changes in elastic moduli via ultrasonic techniques and electrical resistivity via electro-resistive methods. In this study we examined two pin claddings of ChS-68 (Fe-16Cr-15Ni-2Mo-2Mn-Ti-Si irradiated at somewhat different dpa rates in the high-flux BN-600 fast reactor, with temperatures ranging from 370-590 deg. C to maximum doses of 69 and 78 dpa. After removing the fuel, ring specimens were cut and used to conduct tensile tests using a standardized ring-pull test. Changes in density, elastic moduli and electrical resistivity were performed prior to tensile testing. Maximum swelling levels in the two pins reached ∼7 and 12%, with strong consequences observed in mechanical properties. At the higher swelling level there was a total loss of ductility over a significant middle portion of the pin. In both the lower swelling and higher swelling pins there was a clear correlation between the local swelling along the pin length with declining ultimate strength and total elongation, providing clear evidence of void-induced embrittlement. Changes in electrical resistivity and elastic moduli correlated well with predictions based on void swelling at lower irradiation temperatures where precipitates were not a dominant part of the radiation-induced microstructure. At higher temperatures large precipitates of Ni-rich radiation-stable phases are a large portion of the microstructure and void-based predictions of elastic moduli and electrical resistivity do not agree well with the measurements

Characterization of three chalcone synthase-like genes from apple (Malus x domestica Borkh.).

Science.gov (United States)

Yahyaa, Mosaab; Ali, Samah; Davidovich-Rikanati, Rachel; Ibdah, Muhammad; Shachtier, Alona; Eyal, Yoram; Lewinsohn, Efraim; Ibdah, Mwafaq

2017-08-01

Apple (Malus x domestica Brokh.) is a widely cultivated deciduous tree species of significant economic importance. Apple leaves accumulate high levels of flavonoids and dihydrochalcones, and their formation is dependent on enzymes of the chalcone synthase family. Three CHS genes were cloned from apple leaves and expressed in Escherichia coli. The encoded recombinant enzymes were purified and functionally characterized. In-vitro activity assays indicated that MdCHS1, MdCHS2 and MdCHS3 code for proteins exhibiting polyketide synthase activity that accepted either p-dihydrocoumaroyl-CoA, p-coumaroyl-CoA, or cinnamoyl-CoA as starter CoA substrates in the presence of malonyl-CoA, leading to production of phloretin, naringenin chalcone, and pinocembrin chalcone. MdCHS3 coded a chalcone-dihydrochalcone synthase enzyme with narrower substrate specificity than the previous ones. The apparent Km values of MdCHS3 for p-dihydrocoumaryl-CoA and p-coumaryl-CoA were both 5.0 μM. Expression analyses of MdCHS genes varied according to tissue type. MdCHS1, MdCHS2 and MdCHS3 expression levels were associated with the levels of phloretin accumulate in the respective tissues. Copyright © 2017 Elsevier Ltd. All rights reserved.

Factors influencing the turnover intention of Chinese community health service workers based on the investigation results of five provinces.

Science.gov (United States)

Sun, Yu; Luo, Zhenni; Fang, Pengqian

2013-12-01

After the implementation of the new health reform, the Chinese government paid increasing attention to developing its community health service (CHS). The focus is mainly on cultivating community general medical practitioners but paying less attention to the working status and occupational demands of in-service CHS workers. CHS requires a stable team that can provide good service to community residents. At present, the demission rate of CHS workers is high. Studying how to increase the stability of CHS workers is noteworthy. The goal of this study is to ascertain the key factors that influence the CHS worker turnover intention to increase their work satisfaction and stability. A total of 100 CHS organizations were sampled randomly in 10 cities from 5 Chinese provinces for this study. All CHS workers from these organizations took a questionnaire survey. In total, 3,212 valid answer sheets were collected. Pearson Chi square test and Binary logistic regression were used to analyze the related influencing factors that result in CHS worker turnover intention. A total of 38.7% of those who accomplished the questionnaire intended to quit. The influencing factors that result in CHS worker turnover intention are (1) socio-demographic factors such as age, post of duty, professional title, and working seniority, and (2) other work-related factors such as pay packets, learning and training opportunities, promotion and personal development space, and working stress. CHS workers were less satisfied with the balance between payment and work quantity, promotion opportunity, and working conditions. Based on the results, the government should pay more attention to the various demands of CHS workers in service, especially by increasing their income, providing more learning and training opportunities, and increasing the degree of their work satisfaction to avoid turnover intention and ensure the stability of the CHS workforce.

Characterization of direct methanol fuel cell (DMFC) applications with H{sub 2}SO{sub 4} modified chitosan membrane

Energy Technology Data Exchange (ETDEWEB)

Osifo, Peter O.; Masala, Aluwani [Department of Chemical Engineering, Vaal University of Technology, Andries Potgieter Bolevald, P/Bag X021, Vanderbijlpark 1900, Gauteng (South Africa)

2010-08-01

Chitosan (Chs) flakes were prepared from chitin materials that were extracted from the exoskeleton of Cape rock lobsters in South Africa. The Chs flakes were prepared into membranes and the Chs membranes were modified by cross-linking with H{sub 2}SO{sub 4}. The cross-linked Chs membranes were characterized for the application in direct methanol fuel cells. The Chs membrane characteristics such as water uptake, thermal stability, proton resistance and methanol permeability were compared to that of high performance conventional Nafion 117 membranes. Under the temperature range studied 20-60 C, the membrane water uptake for Chs was found to be higher than that of Nafion. Thermal analysis revealed that Chs membranes could withstand temperature as high as 230 C whereas Nafion 117 membranes were stable to 320 C under nitrogen. Nafion 117 membranes were found to exhibit high proton resistance of 284 s cm{sup -1} than Chs membranes of 204 s cm{sup -1}. The proton fluxes across the membranes were 2.73 mol cm{sup -2} s{sup -1} for Chs- and 1.12 mol cm{sup -2} s{sup -1} Nafion membranes. Methanol (MeOH) permeability through Chs membrane was less, 1.4 x 10{sup -6} cm{sup 2} s{sup -1} for Chs membranes and 3.9 x 10{sup -6} cm{sup 2} s{sup -1} for Nafion 117 membranes at 20 C. Chs and Nafion membranes were fabricated into membrane electrode assemblies (MAE) and their performances measure in a free-breathing commercial single cell DMFC. The Nafion membranes showed a better performance as the power density determined for Nafion membranes of 0.0075 W cm{sup -2} was 2.7 times higher than in the case of Chs MEA. (author)

Tandemly arranged chalcone synthase A genes contribute to the spatially regulated expression of siRNA and the natural bicolor floral phenotype in Petunia hybrida.

Science.gov (United States)

Morita, Yasumasa; Saito, Ryoko; Ban, Yusuke; Tanikawa, Natsu; Kuchitsu, Kazuyuki; Ando, Toshio; Yoshikawa, Manabu; Habu, Yoshiki; Ozeki, Yoshihiro; Nakayama, Masayoshi

2012-06-01

The natural bicolor floral traits of the horticultural petunia (Petunia hybrida) cultivars Picotee and Star are caused by the spatial repression of the chalcone synthase A (CHS-A) gene, which encodes an anthocyanin biosynthetic enzyme. Here we show that Picotee and Star petunias carry the same short interfering RNA (siRNA)-producing locus, consisting of two intact CHS-A copies, PhCHS-A1 and PhCHS-A2, in a tandem head-to-tail orientation. The precursor CHS mRNAs are transcribed from the two CHS-A copies throughout the bicolored petals, but the mature CHS mRNAs are not found in the white tissues. An analysis of small RNAs revealed the accumulation of siRNAs of 21 nucleotides that originated from the exon 2 region of both CHS-A copies. This accumulation is closely correlated with the disappearance of the CHS mRNAs, indicating that the bicolor floral phenotype is caused by the spatially regulated post-transcriptional silencing of both CHS-A genes. Linkage between the tandemly arranged CHS-A allele and the bicolor floral trait indicates that the CHS-A allele is a necessary factor to confer the trait. We suppose that the spatially regulated production of siRNAs in Picotee and Star flowers is triggered by another putative regulatory locus, and that the silencing mechanism in this case may be different from other known mechanisms of post-transcriptional gene silencing in plants. A sequence analysis of wild Petunia species indicated that these tandem CHS-A genes originated from Petunia integrifolia and/or Petunia inflata, the parental species of P. hybrida, as a result of a chromosomal rearrangement rather than a gene duplication event. © 2012 The Authors. The Plant Journal © 2012 Blackwell Publishing Ltd.

Altering the expression of two chitin synthase genes differentially affects the growth and morphology of Aspergillus oryzae

DEFF Research Database (Denmark)

Müller, Christian; Hjort, C.M.; Hansen, K.

2002-01-01

In Aspergillus oryzae, one full-length chitin synthase (chsB) and fragments of two other chitin synthases (csmA and chsC) were identified. The deduced amino acid sequence of chsB was similar (87% identity) to chsB from Aspergillus nidulans, which encodes a class III chitin synthase. The sequence...

Plant polyketide synthases: a chalcone synthase-type enzyme which performs a condensation reaction with methylmalonyl-CoA in the biosynthesis of C-methylated chalcones.

Science.gov (United States)

Schröder, J; Raiber, S; Berger, T; Schmidt, A; Schmidt, J; Soares-Sello, A M; Bardshiri, E; Strack, D; Simpson, T J; Veit, M; Schröder, G

1998-06-09

Heterologous screening of a cDNA library from Pinusstrobus seedlings identified clones for two chalcone synthase (CHS) related proteins (PStrCHS1 and PStrCHS2, 87.6% identity). Heterologous expression in Escherichia coli showed that PStrCHS1 performed the typical CHS reaction, that it used starter CoA-esters from the phenylpropanoid pathway, and that it performed three condensation reactions with malonyl-CoA, followed by the ring closure to the chalcone. PstrCHS2 was completely inactive with these starters and also with linear CoA-esters. Activity was detected only with a diketide derivative (N-acetylcysteamine thioester of 3-oxo-5-phenylpent-4-enoic acid) that corresponded to the CHS reaction intermediate postulated after the first condensation reaction. PstrCHS2 performed only one condensation, with 6-styryl-4-hydroxy-2-pyrone derivatives as release products. The enzyme preferred methylmalonyl-CoA against malonyl-CoA, if only methylmalonyl-CoA was available. These properties and a comparison with the CHS from Pinus sylvestris suggested for PstrCHS2 a special function in the biosynthesis of secondary products. In contrast to P. sylvestris, P. strobus contains C-methylated chalcone derivatives, and the methyl group is at the position predicted from a chain extension with methylmalonyl-CoA in the second condensation of the biosynthetic reaction sequence. We propose that PstrCHS2 specifically contributes the condensing reaction with methylmalonyl-CoA to yield a methylated triketide intermediate. We discuss a model that the biosynthesis of C-methylated chalcones represents the simplest example of a modular polyketide synthase.

Feature evaluation of complex hysteresis smoothing and its practical applications to noisy SEM images.

Science.gov (United States)

Suzuki, Kazuhiko; Oho, Eisaku

2013-01-01

Quality of a scanning electron microscopy (SEM) image is strongly influenced by noise. This is a fundamental drawback of the SEM instrument. Complex hysteresis smoothing (CHS) has been previously developed for noise removal of SEM images. This noise removal is performed by monitoring and processing properly the amplitude of the SEM signal. As it stands now, CHS may not be so utilized, though it has several advantages for SEM. For example, the resolution of image processed by CHS is basically equal to that of the original image. In order to find wide application of the CHS method in microscopy, the feature of CHS, which has not been so clarified until now is evaluated correctly. As the application of the result obtained by the feature evaluation, cursor width (CW), which is the sole processing parameter of CHS, is determined more properly using standard deviation of noise Nσ. In addition, disadvantage that CHS cannot remove the noise with excessively large amplitude is improved by a certain postprocessing. CHS is successfully applicable to SEM images with various noise amplitudes. © Wiley Periodicals, Inc.

AcEST: BP917400 [AcEST

Lifescience Database Archive (English)

Full Text Available inition tr|B8CHS5|B8CHS5_9GAMM Outer membrane protein RomA OS=Shewanella piezotolerans WP3 Align length 38 S...rized protein Pc12g037... 33 9.4 >tr|B8CHS5|B8CHS5_9GAMM Outer membrane protein RomA OS=Shewanella piezo

Likelihood analysis of the chalcone synthase genes suggests the role of positive selection in morning glories (Ipomoea).

Science.gov (United States)

Yang, Ji; Gu, Hongya; Yang, Ziheng

2004-01-01

Chalcone synthase (CHS) is a key enzyme in the biosynthesis of flavonoides, which are important for the pigmentation of flowers and act as attractants to pollinators. Genes encoding CHS constitute a multigene family in which the copy number varies among plant species and functional divergence appears to have occurred repeatedly. In morning glories (Ipomoea), five functional CHS genes (A-E) have been described. Phylogenetic analysis of the Ipomoea CHS gene family revealed that CHS A, B, and C experienced accelerated rates of amino acid substitution relative to CHS D and E. To examine whether the CHS genes of the morning glories underwent adaptive evolution, maximum-likelihood models of codon substitution were used to analyze the functional sequences in the Ipomoea CHS gene family. These models used the nonsynonymous/synonymous rate ratio (omega = d(N)/ d(S)) as an indicator of selective pressure and allowed the ratio to vary among lineages or sites. Likelihood ratio test suggested significant variation in selection pressure among amino acid sites, with a small proportion of them detected to be under positive selection along the branches ancestral to CHS A, B, and C. Positive Darwinian selection appears to have promoted the divergence of subfamily ABC and subfamily DE and is at least partially responsible for a rate increase following gene duplication.

Effect of plagiochin E, an antifungal macrocyclic bis(bibenzyl), on cell wall chitin synthesis in Candida albicans

Institute of Scientific and Technical Information of China (English)

Xiu-zhen WU; Ai-xia CHENG; Ling-mei SUN; Hong-xiang LOU

2008-01-01

Aim: To investigate the effect of plagiochin E (PLE), an antifungal macrocyclic bis(bibenzyl) isolated from liverwort Marchantia polymorpha L, on cell wall chitin synthesis in Candida albicans. Methods: The effect of PLE on chitin synthesis in Candida albicans was investigated at the cellular and molecular lev-els. First, the ultrastructural changes were observed under transmission electron microscopy (TEM). Second, the effects of PLE on chitin synthetase (Chs) activi-ties in vitro were assayed using 6-O-dansyl-N-acetylglucosamine as a fluorescent substrate, and its effect on chitin synthesis in situ was assayed by spheroplast regeneration. Finally, real-time RT-PCR was performed to assay its effect on the expression of Chs genes (CHS). Results: Observation under TEM showed that the structure of the cell wall in Candida albicans was seriously damaged, which suggested that the antifungal activity of PLE was associated with its effect on the cell wail. Enzymatic assays and spheroplast regeneration showed that PLE inhibited chitin synthesis in vitro and in situ. The results of the PCR showed that PLE significantly downregulated the expression of CHS1, and upregulated the expression of CHS2 and CHS3. Because different Chs is regulated at different stages of transcription and post-translation, the downregulation of CHS1 would decrease the level of Chs 1 and inhibit its activity, and the inhibitory effects of PLE on Chs2 and Chs3 would be at the post-translational level or by the inhibi-tion on the enzyme-active center. Conclusion: These results indicate that the antifungal activity of PLE would be attributed to its inhibitory effect on cell wall chitin synthesis in Candida albicans.

Expression of chalcone synthase genes in coleoptiles and primary leaves of Secale cereale L. after induction by UV radiation: evidence for a UV-protective role of the coleoptile

International Nuclear Information System (INIS)

Haussühl, K.; Rohde, W.; Weissenböck, G.

1996-01-01

Four chalcone synthase (CHS; EC 2.3.1.74) clones from rye were isolated and characterized. Two of these clones were used for analysis of CHS gene activities in response to ultraviolet and visible radiation in the coleoptile and the primary leaf of the rye seedling. The time-dependence of CHS gene activation and the spatial distribution of CHS were studied by investigation of enzyme activities and CHS mRNA levels, including in situ RNA hybridization. In the primary leaf strong induction of CHS gene activity was localized in the epidermal layers and only marginally found in the mesophyll. The coleoptile showed an even higher response to UV irradiation, but CHS gene activity was evenly distributed throughout the tissues. It is suggested that, in addition to its function as a mechanical protection for the primary leaf during seed germination and seedling emergence through the soil, the coleoptile may also protect the emerging seedling from harmful radiation

Disruption of Bcchs4, Bcchs6 or Bcchs7 chitin synthase genes in Botrytis cinerea and the essential role of class VI chitin synthase (Bcchs6).

Science.gov (United States)

Morcx, Serena; Kunz, Caroline; Choquer, Mathias; Assie, Sébastien; Blondet, Eddy; Simond-Côte, Elisabeth; Gajek, Karina; Chapeland-Leclerc, Florence; Expert, Dominique; Soulie, Marie-Christine

2013-03-01

Chitin synthases play critical roles in hyphal development and fungal pathogenicity. Previous studies on Botrytis cinerea, a model organism for necrotrophic pathogens, have shown that disruption of Bcchs1 and more particularly Bcchs3a genes have a drastic impact on virulence (Soulié et al., 2003, 2006). In this work, we investigate the role of other CHS including BcCHS4, BcCHS6 and BcCHS7 during the life cycle of B. cinerea. Single deletions of corresponding genes were carried out. Phenotypic analysis indicates that: (i) BcCHS4 enzyme is not essential for development and pathogenicity of the fungus; (ii) BcCHS7 is required for pathogenicity in a host dependant manner. For Bcchs6 gene disruption, we obtained only heterokaryotic strains. Indeed, sexual or asexual purification assays were unsuccessful. We concluded that class VI chitin synthase could be essential for B. cinerea and therefore BcCHS6 represents a valuable antifungal target. Copyright © 2012 Elsevier Inc. All rights reserved.

Haloperidol, a Novel Treatment for Cannabinoid Hyperemesis Syndrome.

Science.gov (United States)

Witsil, Joanne C; Mycyk, Mark B

Cannabinoid hyperemesis syndrome (CHS) is typically unresponsive to conventional pharmacologic antiemetics, and patients often require excessive laboratory and radiographic testing and hospital admission. We report 4 cases of CHS that failed standard emergency department therapy but improved significantly after treatment with haloperidol. Although the exact mechanism for CHS remains unclear, dysregulation at cannabinoid type 1 seems to play a role. Recent animal data demonstrate complex interactions between dopamine and cannabinoid type 1 signaling, a potential mechanism for haloperidol success in patients with CHS. Our success with haloperidol in these 4 patients warrants further investigation of haloperidol as an emergency department treatment for CHS.

Chondroitin sulfate template-mediated biomimetic synthesis of nano-flake hydroxyapatite

Science.gov (United States)

He, Dan; Xiao, Xiufeng; Liu, Fang; Liu, Rongfang

2008-11-01

By Ca(NO 3) 2·4H 2O and (NH 4) 3PO 4·3H 2O as reagents and chondroitin sulfate (ChS) as a template, nano-flake hydroxyapatite (HA) is synthesized using a biomimetic method according to the biomineralization theory. HA crystals obtained are characterized in crystalline phase, microstructure, chemical composition and morphology by X-ray diffraction (XRD), Fourier transform infrared spectroscope (FTIR), transmission electron microscopy (TEM) and elemental analysis respectively. UV-vis spectrum is adopted to investigate interactions between functional groups ChS and HA. The results show that HA crystal nucleation and growth take place in chemical interactions between HA crystals and ChS as a template. And elemental analysis indicates that obtained HA contains a small amount of ChS. Furthermore, ChS concentration significantly affects the morphology of HA crystals. Staple-fiber-like HA crystals can be obtained at a low concentration in ChS, and flake-like HA crystals synthesized at a high concentration (≥0.5 wt.%) of ChS as a template.

Chondroitin sulfate template-mediated biomimetic synthesis of nano-flake hydroxyapatite

Energy Technology Data Exchange (ETDEWEB)

He Dan; Xiao Xiufeng; Liu Fang [College of Chemistry and Materials Science, Fujian Normal University, Fuzhou 350007 (China); Liu Rongfang [College of Chemistry and Materials Science, Fujian Normal University, Fuzhou 350007 (China)], E-mail: rfliu@vip.sina.com

2008-11-15

By Ca(NO{sub 3}){sub 2}.4H{sub 2}O and (NH{sub 4}){sub 3}PO{sub 4}.3H{sub 2}O as reagents and chondroitin sulfate (ChS) as a template, nano-flake hydroxyapatite (HA) is synthesized using a biomimetic method according to the biomineralization theory. HA crystals obtained are characterized in crystalline phase, microstructure, chemical composition and morphology by X-ray diffraction (XRD), Fourier transform infrared spectroscope (FTIR), transmission electron microscopy (TEM) and elemental analysis respectively. UV-vis spectrum is adopted to investigate interactions between functional groups ChS and HA. The results show that HA crystal nucleation and growth take place in chemical interactions between HA crystals and ChS as a template. And elemental analysis indicates that obtained HA contains a small amount of ChS. Furthermore, ChS concentration significantly affects the morphology of HA crystals. Staple-fiber-like HA crystals can be obtained at a low concentration in ChS, and flake-like HA crystals synthesized at a high concentration ({>=}0.5 wt.%) of ChS as a template.

Chondrosarcoma: With Updates on Molecular Genetics

Directory of Open Access Journals (Sweden)

Mi-Jung Kim

2011-01-01

Full Text Available Chondrosarcoma (CHS is a malignant cartilage-forming tumor and usually occurs within the medullary canal of long bones and pelvic bones. Based on the morphologic feature alone, a correct diangosis of CHS may be difficult, Therefore, correlation of radiological and clinicopathological features is mandatory in the diagnosis of CHS. The prognosis of CHS is closely related to histologic grading, however, histologic grading may be subjective with high inter-observer variability. In this paper, we present histologic grading system and clinicopathological and radiological findings of conventional CHS. Subtypes of CHSs, such as dedifferentiated, mesenchymal, and clear cell CHSs are also presented. In addition, we introduce updated cytogenetic and molecular genetic findings to expand our understanding of CHS biology. New markers of cell differentiation, proliferation, and cell signaling might offer important therapeutic and prognostic information in near future.

Cholesterol tuning of BK ethanol response is enantioselective, and is a function of accompanying lipids.

Directory of Open Access Journals (Sweden)

Chunbo Yuan

Full Text Available In the search to uncover ethanol's molecular mechanisms, the calcium and voltage activated, large conductance potassium channel (BK has emerged as an important molecule. We examine how cholesterol content in bilayers of 1,2-dioleoyl-3-phosphatidylethanolamine (DOPE/sphingomyelin (SPM and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylethanolamine (POPE/1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylserine (POPS affect the function and ethanol sensitivity of BK. In addition, we examine how manipulation of cholesterol in biological membranes modulates ethanol's actions on BK. We report that cholesterol levels regulate the change in BK channel open probability elicited by 50 mM ethanol. Low levels of cholesterol (<20%, molar ratio supports ethanol activation, while high levels of cholesterol leads to ethanol inhibition of BK. To determine if cholesterol affects BK and its sensitivity to ethanol through a direct cholesterol-protein interaction or via an indirect action on the lipid bilayer, we used the synthetic enantiomer of cholesterol (ent-CHS. We found that 20% and 40% ent-CHS had little effect on the ethanol sensitivity of BK, when compared with the same concentration of nat-CHS. We accessed the effects of ent-CHS and nat-CHS on the molecular organization of DOPE/SPM monolayers at the air/water interface. The isotherm data showed that ent-CHS condensed DOPE/SPM monolayer equivalently to nat-CHS at a 20% concentration, but slightly less at a 40% concentration. Atomic force microscopy (AFM images of DOPE/SPM membranes in the presence of ent-CHS or nat-CHS prepared with LB technique or vesicle deposition showed no significant difference in topographies, supporting the interpretation that the differences in actions of nat-CHS and ent-CHS on BK channel are not likely from a generalized action on bilayers. We conclude that membrane cholesterol influences ethanol's modulation of BK in a complex manner, including an interaction with the channel protein

A comparative study of different methods for the generation of tetra-n-butyl ammonium bromide clathrate hydrate slurry in a cold storage air-conditioning system

International Nuclear Information System (INIS)

Shi, X.J.; Zhang, P.

2013-01-01

Highlights: ► Four kinds of TBAB CHS generation methods are experimentally investigated. ► Accession of CHS into supercooled solution can be helpful to the generation. ► Higher flow rate results in higher energy efficiency of CHS generation. - Abstract: A cold storage air-conditioning system using tetra-n-butyl ammonium bromide (TBAB) clathrate hydrate slurry (CHS) as cold storage medium was built to investigate the high-efficiency method of TBAB CHS generation. In the present study, four kinds of different TBAB CHS generation methods were experimentally investigated and compared, and these methods included continuously cooling, turning off refrigerator while crystals appearing, supercooling release and accession of TBAB CHS into supercooled TBAB aqueous solution. The results showed that continuously cooling would lead to severe adhesion of crystal to the heat exchanger wall, and supercooling release took place with a big stochastic characteristic, hence the first and third method were concluded not reliable. Both the second and fourth methods could maintain the temperature of heat exchanger wall at a relatively higher level, therefore the crystal adhesion to the heat exchanger wall would be reduced significantly, which led to higher coefficient of performance (COP). In addition, accession of TBAB CHS into TBAB supercooled solution could shorten the time of supercooling release, resulting in about 21.8–35.4% shorter generation time than other methods. Moreover, the influence of flow rate on the CHS generation process was investigated, and the results showed that higher flow rate generally resulted in higher system COP

Overview of the US stellarator reactor study

International Nuclear Information System (INIS)

Lyon, J.F.; Gulec, K.; Miller, R.L.; El-Guebaly, L.

1993-01-01

This study, which uses a cost-minimization code that incorporates the ARIES costing and reactor component models with a I-D energy transport calculation, shows that a torsatron reactor could be competitive with a tokamak reactor

Association between time of pay-for-performance for patients and community health services use by chronic patients.

Directory of Open Access Journals (Sweden)

Xi Sun

Full Text Available BACKGROUND: Pay-for-performance for patients is a cost-effective means of improving health behaviours. This study examined the association between the pay time for performance for patients and CHS use by chronic patients. METHODS: A cross-sectional study was undertaken to estimate distribution characteristics of CHS use in 2011 and collect data of socio-demographic characteristics (sex, age, education level, occupation, disposable personal income in 2011, distance between home and community health agency, chronic disease number, and time of pay-for-performance for patients. Participants were 889 rural adults with hypertension or type II diabetes aged 35 and above. Standardized CHS use means chronic patients use CHS at least once per quarter. RESULTS: Patients who received incentives prior to services had 2.724 times greater odds of using standardized CHS than those who received incentives after services (95%CI, 1.986-3.736, P<0.001. For all subgroups (socio-demographic characteristics and chronic disease number, patients who received incentives prior to services were more likely to use standardized CHS than those receiving incentives after services. CONCLUSIONS: Pay time for performance for patients was associated with CHS use by chronic patients. Patients receiving incentive prior to services were more likely to use standardized CHS. And pay time should not be ignored when the policy on pay-for-performance for patients is designed.

Cannabinoid hyperemesis and the cyclic vomiting syndrome in adults: recognition, diagnosis, acute and long-term treatment

Directory of Open Access Journals (Sweden)

Blumentrath, Christian G.

2017-03-01

Full Text Available The cannabinoid hyperemesis syndrome (CHS and the cyclic vomiting syndrome in adults (CVS are both characterized by recurrent episodes of heavy nausea, vomiting and frequently abdominal pain. Both syndromes are barely known among physicians. Literature is inconsistent concerning clinical features which enable differentiation between CVS and CHS. We performed a literature review using the LIVIVO search portal for life sciences to develop a pragmatic approach towards these two syndromes. Our findings indicate that complete and persistent resolution of all symptoms of the disease following cannabis cessation is the only reliable criterion applicable to distinguish CHS from CVS. Psychiatric comorbidities (e.g. panic attacks, depression, history of migraine attacks and rapid gastric emptying may serve as supportive criteria for the diagnosis of CVS. Compulsive bathing behaviour, a clinical observation previously attributed only to CHS patients is equally present in CVS patients. Long-term follow-up is essential in order to clearly separate CHS from CVS. However, long-term follow-up of CVS and CHS cases is seldom. We provide a standard operating procedure applicable to a broad spectrum of health care facilities which addresses the major issues of CVS and CHS: awareness, diagnosis, treatment, and follow-up.

Eletroforese para detecção de hemoglobina fetal em pacientes do ambulatório de hematologia e hemoterapia do Conjunto Hospitalar de Sorocaba (CHS com anemia falciforme e uso de hidroxiuréia

Directory of Open Access Journals (Sweden)

Laura Damada Garcia

2015-10-01

Full Text Available Introdução: As hemoglobinopatias são distúrbios genéticos que se apresentam por padrão de herança recessiva e incluem a anemia falciforme e as síndromes falcêmicas (hemoglobinopatia SC e a S/β-talassemia. Na anemia falciforme as moléculas de adesão dos eritrócritos, leucócitos e plaquetas estão envolvidas na oclusão vascular. Nas síndromes falcêmicas, o quadro costuma ser mais brando. Pesquisas demonstram que o tratamento com hidroxiuréia (HU promove melhora da qualidade de vida dos pacientes que a utilizam. O mesmo tem se mostrado efetivo por aumentar a expressão de hemoglobina fetal (HbF, diminuindo assim as complicações de vaso-oclusão, hemólise e diminuição da expressão de moléculas de adesão. Objetivos: Nesta pesquisa, utilizamos o teste de eletroforese alcalina (pH 8,6 para o monitoramento de expressão da HbF nos pacientes do Ambulatório de Hematologia e Hemoterapia do CHS portadores de anemia falciforme e nos portadores de síndromes falcêmicas em tratamento com HU. Metodologia: Aplicou-se o teste de eletroforese em acetato de celulose em pH alcalino (8,6 e, posteriormente, as fitas de acetato submetidas ao campo elétrico foram coradas por Ponceau, transparentizadas e fixadas em lâminas de microscopia para análise e registro. Resultados: Foram realizados 100 testes cegos em amostras de sangue provenientes dos pacientes do Ambulatório de Anemia Falciforme do CHS, entre os quais analisamos 28 pacientes com anemia falciforme e 12 com síndromes falcêmicas. Na avaliação eletroforética do uso ou não uso de hidroxiuréia nos grupos investigados, observamos que não houve diferença significativa na expressão de HbF (p=0,3173. Além disso, comparamos os índices hematimétricos dos dois grupos e verificamos que os valores médios de VCM e HCM aumentaram em relação à concentração de HU utilizada, embora não tenham sido analisados estatisticamente.

Inhibition of survivin influences the biological activities of canine histiocytic sarcoma cell lines.

Directory of Open Access Journals (Sweden)

Hiroki Yamazaki

Full Text Available Canine histiocytic sarcoma (CHS is an aggressive malignant neoplasm that originates from histiocytic lineage cells, including dendritic cells and macrophages, and is characterized by progressive local infiltration and a very high metastatic potential. Survivin is as an apoptotic inhibitory factor that has major functions in cell proliferation, including inhibition of apoptosis and regulation of cell division, and is expressed in most types of human and canine malignant neoplasms, including melanoma and osteosarcoma. To investigate whether survivin was expressed at high levels in CHS and whether its expression was correlated with the aggressive biological behavior of CHS, we assessed relation between survivin expression and CHS progression, as well as the effects of survivin inhibition on the biological activities of CHS cells. We comparatively analyzed the expression of 6 selected anti-apoptotic genes, including survivin, in specimens from 30 dogs with histiocytic sarcoma and performed annexin V staining to evaluate apoptosis, methylthiazole tetrazolium assays to assess cell viability and chemosensitivity, and latex bead assays to measure changes in phagocytic activities in 4 CHS cell lines and normal canine fibroblasts transfected with survivin siRNA. Survivin gene expression levels in 30 specimens were significantly higher than those of the other 6 genes. After transfection with survivin siRNA, apoptosis, cell growth inhibition, enhanced chemosensitivity, and weakened phagocytic activities were observed in all CHS cell lines. In contrast, normal canine fibroblasts were not significantly affected by survivin knockdown. These results suggested that survivin expression may mediate the aggressive biological activities of CHS and that survivin may be an effective therapeutic target for the treatment of CHS.

Transition from resistive-g to eta-i driven turbulence in stellarator systems

International Nuclear Information System (INIS)

Hong, B.-G.; Horton, W.; Hamaguchi, S.; Wakantani, M.; Yagi, M.; Sugama, H.

1990-02-01

By an electromagnetic incompressible two fluid model describing both ion temperature gradient drift modes (η i modes) and resistive interchange modes (g modes), a new type of η i mode is studied in cylindrical geometry including magnetic shear and an averaged curvature of Heliotron/Torsatron. This η i mode is destabilized by the coupling to the unstable g mode. Finite plasma pressure beta increases the growth rate of this mode and the radial mode width also increases with plasma pressure beta indicating large anomalous transport in the Heliotron/Torsatron configuration. The transport from η i mode exceeds that from resistive g when the mean-free-path exceeds the machine circumference. For plasma beta above two to three times the Suydam limit the m = 1/n = 1 growth rate increases from the η i mode value to the MHD value. 13 refs., 5 figs

Photolabile ruthenium complexes to cage and release a highly cytotoxic anticancer agent.

Science.gov (United States)

Wei, Jianhua; Renfrew, Anna K

2018-02-01

CHS-828 (N-(6-(4-chlorophenoxy)hexyl)-N'-cyano-N″-4-pyridyl guanidine) is an anticancer agent with low bioavailability and high systemic toxicity. Here we present an approach to improve the therapeutic profile of the drug using photolabile ruthenium complexes to generate light-activated prodrugs of CHS-828. Both prodrug complexes are stable in the dark but release CHS-828 when irradiated with visible light. The complexes are water-soluble and accumulate in tumour cells in very high concentrations, predominantly in the mitochondria. Both prodrug complexes are significantly less cyototoxic than free CHS-828 in the dark but their toxicity increases up to 10-fold in combination with visible light. The cellular responses to light treatment are consistent with release of the cytotoxic CHS-828 ligand. Copyright © 2017 Elsevier Inc. All rights reserved.

Control of radial electric field in torus plasma

International Nuclear Information System (INIS)

Ida, K.; Idei, H.; Sanuki, H.

1994-09-01

The radial electric fields is controlled by changing the direction of neutral beam from co to counter to plasma current in tokamak, while it is controlled by the 2nd harmonic ECH and NBI and pellet injection in heliotron/torsatron. (author)

Evolution and functional insights of different ancestral orthologous clades of chitin synthase genes in the fungal tree of life

Directory of Open Access Journals (Sweden)

Mu eLi

2016-02-01

Full Text Available Chitin synthases (CHSs are key enzymes in the biosynthesis of chitin, an important structural component of fungal cell walls that can trigger innate immune responses in host plants and animals. Members of CHS gene family perform various functions in fungal cellular processes. Previous studies focused primarily on classifying diverse CHSs into different classes, regardless of their functional diversification, or on characterizing their functions in individual fungal species. A complete and systematic comparative analysis of CHS genes based on their orthologous relationships will be valuable for elucidating the evolution and functions of different CHS genes in fungi. Here, we identified and compared members of the CHS gene family across the fungal tree of life, including 18 divergent fungal lineages. Phylogenetic analysis revealed that the fungal CHS gene family is comprised of at least 10 ancestral orthologous clades, which have undergone multiple independent duplications and losses in different fungal lineages during evolution. Interestingly, one of these CHS clades (class III was expanded in plant or animal pathogenic fungi belonging to different fungal lineages. Two clades (classes VIb and VIc identified for the first time in this study occurred mainly in plant pathogenic fungi from Sordariomycetes and Dothideomycetes. Moreover, members of classes III and VIb were specifically up-regulated during plant infection, suggesting important roles in pathogenesis. In addition, CHS-associated networks conserved among plant pathogenic fungi are involved in various biological processes, including sexual reproduction and plant infection. We also identified specificity-determining sites, many of which are located at or adjacent to important structural and functional sites that are potentially responsible for functional divergence of different CHS classes. Overall, our results provide new insights into the evolution and function of members of CHS gene

Molecular characterization and expression analysis of chalcone ...

African Journals Online (AJOL)

Chalcone synthase (CHS, EC: 2.3.1.74) is a key enzyme in the flavonoid and anthocyanin biosynthesis pathway. In order to investigate the role of CHS in tree peony flower coloration mechanism, we isolated and characterized the CHS gene from Paeonia suffruticosa cv. Yu Ji Yan Zhuang and analyzed its spatial and ...

A new financial budgetary system for community health services institutions in China.

Science.gov (United States)

You, Chuanmei; Yao, Lan; Fu, Jiakang; Wang, Fang; Wang, Hongqing; Dai, Tao

2011-01-01

The separation of revenue and expenditure budgets (SREB) is a new financial budgetary system that is being implemented in community health services (CHS) institutions in some areas in China. Through literature review, it was found that, derived from the traditional separation of revenue and expenditure budgets (TSREB) implemented in administrative public services units, SREB and TSREB have something in common and yet many more differences. On the basis of some quantitative and qualitative data that were collected by field survey, it was also found that implementation of SREB in CHS institutions brings positive outcomes in terms of the quantity, quality and efficiency of services; residents' satisfaction; and the behavior of CHS institutions. The conclusion can be suggested that SREB, as a system having impact upon the incentives facing CHS institutions and the nature of governmental responsibility for developing CHS in China, will promote CHS institutions to fulfill basic service functions if implemented well. Therefore, it is a system that is worth further development and evaluation. Copyright © 2011 John Wiley & Sons, Ltd.

Analysis of the parsley chalcone-synthase promoter in response to different light qualities

International Nuclear Information System (INIS)

Merkle, T.; Frohnmeyer, H.; Schulze-Lefert, P.; Dangl, J.L.; Hahlbrock, K.; Schaefer, E.

1994-01-01

We examined the chalcone synthase (chs) promoter from parsley [Petroselinum crispum Miller (A.W. Hill)] for the existence of separate promoter elements responsible for transcriptional activation of the chs gene by UV-B and by blue light. A combination of in-vivo foot-printing in parsley cells and light-induced transient expression assays with different chs promoter constructs in parsley protoplasts was used. Dark controls and blue-light-irradiated cells gave identical in-vivo footprints on the chs promoter. Pre-irradiation with blue light prior to a UV-B-light pulse is known to cause a shift in the timing of UV-B-light-induced increase in chs transcription rates. This shift was also manifested on the DNA template, since UV-B-light-induced in-vivo footprints in cells pretreated with blue light were detected earlier than in cells which had been irradiated with a UV-B-light pulse only. Although there was a clear shift in the timing of footprint appearance, the patterns of foot printing did not change. Light-induced transient-expression assays revealed that the shortest tested chs promoter which retained any light responsiveness, was sufficient for mediating both induction by UV light and the blue-light-mediated kinetic shift. These findings argue against a spatial separation of UV-B- and blue-light-responsive elements on the chs promoter. We interpret these data by postulating that the signal transduction pathways originating from the excitation of UV-B- and blue-light receptors merge at the chs promoter, or somewhere between light perception and protein-DNA interaction. (author)

Prediction of Cerebral Hyperperfusion Syndrome with Velocity Blood Pressure Index

Directory of Open Access Journals (Sweden)

Zhi-Chao Lai

2015-01-01

Full Text Available Background: Cerebral hyperperfusion syndrome is an important complication of carotid endarterectomy (CEA. An >100% increase in middle cerebral artery velocity (MCAV after CEA is used to predict the cerebral hyperperfusion syndrome (CHS development, but the accuracy is limited. The increase in blood pressure (BP after surgery is a risk factor of CHS, but no study uses it to predict CHS. This study was to create a more precise parameter for prediction of CHS by combined the increase of MCAV and BP after CEA. Methods: Systolic MCAV measured by transcranial Doppler and systematic BP were recorded preoperatively; 30 min postoperatively. The new parameter velocity BP index (VBI was calculated from the postoperative increase ratios of MCAV and BP. The prediction powers of VBI and the increase ratio of MCAV (velocity ratio [VR] were compared for predicting CHS occurrence. Results: Totally, 6/185 cases suffered CHS. The best-fit cut-off point of 2.0 for VBI was identified, which had 83.3% sensitivity, 98.3% specificity, 62.5% positive predictive value and 99.4% negative predictive value for CHS development. This result is significantly better than VR (33.3%, 97.2%, 28.6% and 97.8%. The area under the curve (AUC of receiver operating characteristic: AUC VBI = 0.981, 95% confidence interval [CI] 0.949-0.995; AUC VR = 0.935, 95% CI 0.890-0.966, P = 0.02. Conclusions: The new parameter VBI can more accurately predict patients at risk of CHS after CEA. This observation needs to be validated by larger studies.

Effect of different periods of chronic heat stress with or without vitamin C supplementation on bone and selected serum parameters of broiler chickens.

Science.gov (United States)

Mosleh, Najmeh; Shomali, Tahoora; Nematollahi, Fahimeh; Ghahramani, Zahra; Ahrari Khafi, Mohammad Saeid; Namazi, Fatemeh

2018-04-01

This study evaluates the effect of different periods of chronic heat stress (CHS) on selected bone and serum parameters of broiler chickens with or without vitamin C administration. Ninety 23-day-old chickens were randomly allocated into seven groups: (1) control, (2) short-term CHS (5 days), (3) short-term CHS + vitamin C (12 g/100 l drinking water of a 50% product), (4) medium-term CHS (10 days), (5) medium-term CHS + vitamin C, (6) long-term CHS (20 days) and (7) long-term CHS + vitamin C. In heat-stressed groups the temperature was increased to 39 ± 1°C for 8 h/day. At the end of the experiment, blood samples were collected and shank, keel and tibia bones were removed. CHS was not associated with a drastic change in serum Ca and corticosterone, or bone characteristics (both cortical and trabecular bones in radiographical and histological evaluation), or birds' performance. Oxidative stress was present especially with short-term CHS. CHS, especially for short or medium periods, showed a tendency to increase serum vitamin C and administration of this vitamin did not make a significant change in its serum levels although it ameliorated oxidative stress. In conclusion, it seems that CHS is not associated with an appreciable change in broiler performance, bone characteristics, or selected serum parameters; and simultaneous vitamin C administration at the dosage of 12 g/100 l in drinking water has no beneficial effect apart from reducing oxidative stress especially in short-term chronically heat-stressed birds.

Prediction of Cerebral Hyperperfusion Syndrome with Velocity Blood Pressure Index.

Science.gov (United States)

Lai, Zhi-Chao; Liu, Bao; Chen, Yu; Ni, Leng; Liu, Chang-Wei

2015-06-20

Cerebral hyperperfusion syndrome is an important complication of carotid endarterectomy (CEA). An >100% increase in middle cerebral artery velocity (MCAV) after CEA is used to predict the cerebral hyperperfusion syndrome (CHS) development, but the accuracy is limited. The increase in blood pressure (BP) after surgery is a risk factor of CHS, but no study uses it to predict CHS. This study was to create a more precise parameter for prediction of CHS by combined the increase of MCAV and BP after CEA. Systolic MCAV measured by transcranial Doppler and systematic BP were recorded preoperatively; 30 min postoperatively. The new parameter velocity BP index (VBI) was calculated from the postoperative increase ratios of MCAV and BP. The prediction powers of VBI and the increase ratio of MCAV (velocity ratio [VR]) were compared for predicting CHS occurrence. Totally, 6/185 cases suffered CHS. The best-fit cut-off point of 2.0 for VBI was identified, which had 83.3% sensitivity, 98.3% specificity, 62.5% positive predictive value and 99.4% negative predictive value for CHS development. This result is significantly better than VR (33.3%, 97.2%, 28.6% and 97.8%). The area under the curve (AUC) of receiver operating characteristic: AUC(VBI) = 0.981, 95% confidence interval [CI] 0.949-0.995; AUC(VR) = 0.935, 95% CI 0.890-0.966, P = 0.02. The new parameter VBI can more accurately predict patients at risk of CHS after CEA. This observation needs to be validated by larger studies.

Two Novel Mutations Identified in an African-American Child with Chediak-Higashi Syndrome

Directory of Open Access Journals (Sweden)

Kerry Morrone

2010-01-01

Full Text Available Background. Chediak-Higashi syndrome (CHS is a rare, autosomal recessive disorder characterized by oculocutaneous albinism, immunodeficiency, coagulopathy and late-onset, progressive neurological dysfunction. It also has an “accelerated phase” characterized by hemophagocytic lymphohistiocytosis (HLH. The disease is caused by mutations in the CHS1/LYST gene located on chromosome 1, which affects lysosome morphology and function. We report the case of an African-American child with CHS in Case. This 16-month old African-American girl presented with fever and lethargy. The proband had pale skin compared to her parents, with light brown eyes, silvery hair and massive hepatosplenomegaly. Her laboratory evaluation was remarkable for pancytopenia, high serum ferritin and an elevated LDH. Bone marrow aspirate revealed large inclusions in granulocytes and erythrophagocytosis consistent with HLH. Genetic evaluation revealed two novel nonsense mutations in the CHS1 gene: c.3622C>T (p.Q1208X and c.11002G>T (p.E3668X. Conclusions. Our patient is one of the few cases of CHS reported in the African American population. We identified 2 nonsense mutations in the CHS1 gene, the first mutation analysis published of an African-American child with Chediak-Higashi Syndrome. These two mutations predict a severe phenotype and thus identification of these mutations has an important clinical significance in CHS.

Transcriptome changes in the phenylpropanoid pathway of Glycine max in response to Pseudomonas syringae infection

Directory of Open Access Journals (Sweden)

Gonzalez Delkin O

2006-11-01

Full Text Available Abstract Background Reports of plant molecular responses to pathogenic infections have pinpointed increases in activity of several genes of the phenylpropanoid pathway leading to the synthesis of lignin and flavonoids. The majority of those findings were derived from single gene studies and more recently from several global gene expression analyses. We undertook a global transcriptional analysis focused on the response of genes of the multiple branches of the phenylpropanoid pathway to infection by the Pseudomonas syringae pv. glycinea with or without the avirulence gene avrB to characterize more broadly the contribution of the multiple branches of the pathway to the resistance response in soybean. Transcript abundance in leaves was determined from analysis of soybean cDNA microarray data and hybridizations to RNA blots with specific gene probes. Results The majority of the genes surveyed presented patterns of increased transcript accumulation. Some increased rapidly, 2 and 4 hours after inoculation, while others started to accumulate slowly by 8 – 12 hours. In contrast, transcripts of a few genes decreased in abundance 2 hours post inoculation. Most interestingly was the opposite temporal fluctuation in transcript abundance between early responsive genes in defense (CHS and IFS1 and F3H, the gene encoding a pivotal enzyme in the synthesis of anthocyanins, proanthocyanidins and flavonols. F3H transcripts decreased rapidly 2 hours post inoculation and increased during periods when CHS and IFS transcripts decreased. It was also determined that all but one (CHS4 family member genes (CHS1, CHS2, CHS3, CHS5, CHS6 and CHS7/8 accumulated higher transcript levels during the defense response provoked by the avirulent pathogen challenge. Conclusion Based on the mRNA profiles, these results show the strong bias that soybean has towards increasing the synthesis of isoflavonoid phytoalexins concomitant with the down regulation of genes required for the

Crystallization of tetra-n-butyl ammonium bromide clathrate hydrate slurry and the related heat transfer characteristics

International Nuclear Information System (INIS)

Shi, X.J.; Zhang, P.

2014-01-01

Highlights: • Crystallization characteristics of TBAB CHS under different thermal conditions were clarified. • Overall heat transfer coefficients before and during the crystallization were obtained. • The crystallization characteristics of TBAB CHS mainly depend on the status of supercooled solution. • Dropping of TBAB CHS can accelerate the supercooling release and crystallization. - Abstract: Tetra-n-butyl ammonium bromide (TBAB) clathrate hydrate slurry (CHS) is a promising phase change material slurry for cold storage and transport in air-conditioning system. This slurry can be generated from the supercooled TBAB aqueous solution. In the present study, TBAB CHS was generated under different thermal conditions, i.e. different initial mass concentrations of TBAB aqueous solution and different supercooling degrees. The crystallization of TBAB CHS and the overall heat transfer coefficient under different thermal conditions were clarified. It was concluded that the crystallization characteristics of TBAB hydrate crystals mainly depended upon the thermal condition of the supercooled TBAB aqueous solution. In addition, the dropping of pre-produced TBAB CHS into supercooled TBAB aqueous solution could immediately induce the crystallization of TBAB hydrate crystals, and the initial type of TBAB hydrate crystals was only related to the status of the supercooled TBAB aqueous solution regardless of the type of the dropped TBAB CHS. Furthermore, the overall heat transfer coefficients before crystallization and during crystallization were also measured. It was found that more hydrate crystals would adhere to the vessel wall at larger supercooling degree and higher mass concentration of aqueous solution, which would deteriorate the heat transfer significantly. Moreover, images of TBAB hydrate crystals under different thermal conditions were recorded in order to help clarifying the crystallization characteristics

Salt tolerance of Glycine max.L induced by endophytic fungus Aspergillus flavus CSH1, via regulating its endogenous hormones and antioxidative system.

Science.gov (United States)

Lubna; Asaf, Sajjad; Hamayun, Muhammad; Khan, Abdul Latif; Waqas, Muhammad; Khan, Muhammad Aaqil; Jan, Rahmatullah; Lee, In-Jung; Hussain, Anwar

2018-07-01

Abiotic stress resistance strategies are powerful approaches to sustainable agriculture because they reduce chemical input and enhance plant productivity. In current study, an endophytic fungus, Aspergillus flavus CHS1 was isolated from Chenopodium album Roots. CHS1 was initially screened for growth promoting activities like siderphore, phosphate solubilization, and the production of indole acetic acid and gibberellins and were further assayed for its ability to promote the growth of mutant Waito-C rice. The results revealed that different plant growth characteristic such as chlorophyll content, root-shoot length, and biomass production were significantly promoted during CHS1 treatment. This growth promotion action was due to the presence of various types of GAs and IAA in the endophyte culture filtrate. Significant up regulation with respect to levels in the control was observed in all endogenous plant GAs, after treatment with CHS1. Furthermore, to evaluate the potential of CHS1 against NaCl stress up to 400 mM, it was tested for its ability to improve soybean plant growth under NaCl stress. In endophyte-soybean interaction, CHS1 association significantly increased plant growth and attenuated the NaCl stress by down regulating ABA and JA synthesis. Similarly, it significantly elevated antioxidant activities of enzymes catalase, polyphenoloxidase, superoxide dismutase and peroxidase as compared to non-inoculated salt stress plants. Thus, CHS1 ameliorated the adverse effect of high NaCl stress and rescued soybean plant growth by regulating the endogenous plant hormones and antioxidative system. We conclude that CHS1 isolate could be exploited to increase salt resistant and yield in crop plants. Copyright © 2018. Published by Elsevier Masson SAS.

Cannabinoid Hyperemesis Syndrome: Case Report of a Paradoxical Reaction with Heavy Marijuana Use

Directory of Open Access Journals (Sweden)

Benjamin Cox

2012-01-01

Full Text Available Cannabinoid hyperemesis syndrome (CHS is a rare constellation of clinical findings that includes a history of chronic heavy marijuana use, severe abdominal pain, unrelenting nausea, and intractable vomiting. A striking component of this history includes the use of hot showers or long baths that help to alleviate these symptoms. This is an underrecognized syndrome that can lead to expensive and unrevealing workups and can leave patients self-medicating their nausea and vomiting with the very substance that is causing their symptoms. Long-term treatment of CHS is abstinence from marijuana use—but the acute symptomatic treatment of CHS has been a struggle for many clinicians. Many standard medications used for the symptomatic treatment of CHS (including ondansetron, promethazine, and morphine have repeatedly been shown to be ineffective. Here we present the use of lorazepam as an agent that successfully and safely treats the tenacious symptoms of CHS. Additionally, we build upon existing hypotheses for the pathogenesis of CHS to try to explain why a substance that has been used for thousands of years is only now beginning to cause this paradoxical hyperemesis syndrome.

The use of additive ceramic hollow spheres on cement slurry to prevent lost circulation in formation `X' having low pressure fracture

Science.gov (United States)

Rita, Novia; Mursyidah, Syahindra, Michael

2018-03-01

When drilling, if the hydrostatic pressure is higher than formation pressure (fracture pressure) it will cause lost circulation during cementing process. To solve this problem, hydrostatic pressure of slurry can be decreased by lowering the slurry density by using some additives. Ceramic Hollow Spheres (CHS) is lightweight additive. This additive comes with low specific gravity so it can lowered the slurry density. When the low-density slurry used in cementing process, it can prevent low circulation and fractured formation caused by cement itself. Class G cement is used in this experiment with the standard density of this slurry is 15.8 ppg. With the addition of CHS, slurry density lowered to 12.5 ppg. CHS not only used to lower the slurry density, it also used to make the same properties with the standard slurry even the density has been lowered. Both thickening time and compressive strength have not change if the CHS added to the slurry. With addition of CHS, thickening time at 70 Bc reached in 03 hours 12 minutes. For the compressive strength, 2000 psi reached in 07 hours 07 minutes. Addition of CHS can save more time in cementing process of X formation.

Lack of TAK1 in dendritic cells inhibits the contact hypersensitivity response induced by trichloroethylene in local lymph node assay

Energy Technology Data Exchange (ETDEWEB)

Yao, Pan; Hongqian, Chu; Qinghe, Meng; Lanqin, Shang; Jianjun, Jiang; Xiaohua, Yang; Xuetao, Wei; Weidong, Hao, E-mail: whao@bjmu.edu.cn

2016-09-15

Trichloroethylene (TCE) is a ubiquitous environmental contaminant. Occupational TCE exposure has been associated with severe, generalized contact hypersensitivity (CHS) skin disorder. The development of CHS depends on innate and adaptive immune functions. Transforming growth factor-β activated kinase-1 (TAK1) controls the survival of dendritic cells (DCs) that affect the immune system homeostasis. We aimed to investigate the role of TAK1 activity in DC on TCE-induced CHS response. Control mice and DC-specific TAK1 deletion mice were treated with 80% (v/v) TCE using local lymph node assay (LLNA) to establish a TCE-induced CHS model. The draining lymph nodes (DLNs) were excised and the lymphocytes were measure for proliferation by BrdU-ELISA, T-cell phenotype analysis by flow cytometry and signaling pathway activation by western blot. The ears were harvested for histopathological analysis. Control mice in the 80% TCE group displayed an inflammatory response in the ears, increased lymphocyte proliferation, elevated regulatory T-cell and activated T-cell percentages, and more IFN-γ producing CD8{sup +} T cells in DLNs. In contrast to control mice, DC-specific TAK1 deletion mice in the 80% TCE group showed an abolished CHS response and this was associated with defective T-cell expansion, activation and IFN-γ production. This effect may occur through Jnk and NF-κB signaling pathways. Overall, this study demonstrates a pivotal role of TAK1 in DCs in controlling TCE-induced CHS response and suggests that targeting TAK1 function in DCs may be a viable approach to preventing and treating TCE-related occupational health hazards. - Highlights: • Lack of TAK1 in DC caused an abolished TCE-induced CHS response. • TAK1 in DCs was essential to maintain the homeostasis of T cells in TCE-induced CHS. • Intact TAK1 in DCs was critical to promote T-cell priming in TCE-induced CHS. • DC-specific TAK1 deficiency abolished the TCE-mediated phosphorylation of Jnk.

Differentiation of human mesenchymal stromal cells cultured on collagen sponges for cartilage repair.

Science.gov (United States)

Sanjurjo-Rodríguez, Clara; Martínez-Sánchez, Adela Helvia; Hermida-Gómez, Tamara; Fuentes-Boquete, Isaac; Díaz-Prado, Silvia; Blanco, Francisco J

2016-11-01

The aim of this study was to evaluate proliferation and chondrogenic differentiation of human bone-marrow mesenchymal stromal cells (hBMSCs) cultured on collagen biomaterials. hBMSCs were seeded on five different collagen (Col) sponges: C1C2 (types I and II Col), C1C2HS (types I and II Col plus heparan sulphate (HS)), C1C2CHS (types I and II Col plus chondroitin sulphate (CHS)), C1-OLH3 (type I Col plus low molecular weight heparin) and C1CHS (type I Col plus CHS). The resulting constructs were analyzed by histological and immunohistochemical staining, molecular biology and electron microscopy. Col released into culture media was measured by a dye-binding method Results: hBMSCs on biomaterials C1C2, C1C2HS and C1C2CHS had more capacity to attach, proliferate and synthesize Col II and proteoglycans in the extracellular matrix (ECM) than on C1-OLH3 and C1CHS. The presence of aggrecan was detected only at the gene level. Total Col liberated by the cells in the supernatants in all scaffold cultures was detected. The level of Col I in the ECM was lower in C1-OLH3 and that of Col II was highest in C1C2 and C1C2HS. Electron microscopy showed differently shaped cells, from rounded to flattened, in all constructs. Col fibers in bundles were observed in C1C2CHS by transmission electron microscopy. The results show that Col I and Col II (C1C2, C1C2HS and C1C2CHS) biomaterials allowed cell proliferation and chondrogenic-like differentiation of hBMSCs at an early stage. Constructs cultured on C1C2HS and C1C2CHS showed better cartilage-like phenotype than the other ones.

Lack of TAK1 in dendritic cells inhibits the contact hypersensitivity response induced by trichloroethylene in local lymph node assay

International Nuclear Information System (INIS)

Yao, Pan; Hongqian, Chu; Qinghe, Meng; Lanqin, Shang; Jianjun, Jiang; Xiaohua, Yang; Xuetao, Wei; Weidong, Hao

2016-01-01

Trichloroethylene (TCE) is a ubiquitous environmental contaminant. Occupational TCE exposure has been associated with severe, generalized contact hypersensitivity (CHS) skin disorder. The development of CHS depends on innate and adaptive immune functions. Transforming growth factor-β activated kinase-1 (TAK1) controls the survival of dendritic cells (DCs) that affect the immune system homeostasis. We aimed to investigate the role of TAK1 activity in DC on TCE-induced CHS response. Control mice and DC-specific TAK1 deletion mice were treated with 80% (v/v) TCE using local lymph node assay (LLNA) to establish a TCE-induced CHS model. The draining lymph nodes (DLNs) were excised and the lymphocytes were measure for proliferation by BrdU-ELISA, T-cell phenotype analysis by flow cytometry and signaling pathway activation by western blot. The ears were harvested for histopathological analysis. Control mice in the 80% TCE group displayed an inflammatory response in the ears, increased lymphocyte proliferation, elevated regulatory T-cell and activated T-cell percentages, and more IFN-γ producing CD8 + T cells in DLNs. In contrast to control mice, DC-specific TAK1 deletion mice in the 80% TCE group showed an abolished CHS response and this was associated with defective T-cell expansion, activation and IFN-γ production. This effect may occur through Jnk and NF-κB signaling pathways. Overall, this study demonstrates a pivotal role of TAK1 in DCs in controlling TCE-induced CHS response and suggests that targeting TAK1 function in DCs may be a viable approach to preventing and treating TCE-related occupational health hazards. - Highlights: • Lack of TAK1 in DC caused an abolished TCE-induced CHS response. • TAK1 in DCs was essential to maintain the homeostasis of T cells in TCE-induced CHS. • Intact TAK1 in DCs was critical to promote T-cell priming in TCE-induced CHS. • DC-specific TAK1 deficiency abolished the TCE-mediated phosphorylation of Jnk.

An assessment of Makerere University College of Health Sciences: optimizing health research capacity to meet Uganda’s priorities

Directory of Open Access Journals (Sweden)

Groves Sara

2011-03-01

Full Text Available Abstract Background Health research is critical to the institutional mission of the Makerere College of Health Sciences (MakCHS. Optimizing the alignment of health research capacity at MakCHS with the health needs and priorities of Uganda, as outlined in the country’s Health Sector Strategic Plan (HSSP, is a deliberate priority, a responsibility, and a significant opportunity for research. To guide this strategic direction, an assessment of MakCHS’s research grants and publication portfolio was conducted. Methods A survey of all new and ongoing grants, as well as all publications, between January 2005 and December 2009 was conducted. Research, training, and education grants awarded to MakCHS’ constituent faculties and departments, were looked for through financial records at the college or by contact with funding organizations. Published manuscripts registered with PubMed, that included MakCHS faculty authors, were also analyzed. Results A total of 58 active grants were identified, of which 18 had been initiated prior to 2005 and there were an average of about eight new grants per year. Most grants funded basic and applied research, with major focus areas being HIV/AIDS (44%, malaria (19%, maternal and child health (14%, tuberculosis (11%, mental health (3%, and others (8%. MakCHS faculty were identified as Principal Investigators (PIs in only 22 (38% active grants. Grant funding details were only available for one third of the active grants at MakCHS. A total of 837 publications were identified, with an average of 167 publications per year, most of which (66% addressed the country’s priority health areas, and 58% had MakCHS faculty or students as first authors. Conclusions The research grants and publications at MakCHS are generally well-aligned with the Ugandan Health Ministry priorities. Greater efforts to establish centralized and efficient grants management procedures are needed. In addition, greater efforts are needed to expand

Phase stabilities of pyrite-related MTCh compounds (M=Ni, Pd, Pt; T=Si, Ge, Sn, Pb; Ch=S, Se, Te): A systematic DFT study

International Nuclear Information System (INIS)

Bachhuber, Frederik; Krach, Alexander; Furtner, Andrea; Söhnel, Tilo; Peter, Philipp; Rothballer, Jan; Weihrich, Richard

2015-01-01

Pyrite-type and related systems appear for a wide range of binary and ternary combinations of transition metals and main group elements that form Zintl type dumbbell anion units. Those representatives with 20 valence electrons exhibit an extraordinary structural flexibility and interesting properties as low-gap semiconductors or thermoelectric and electrode materials. This work is devoted to the systematic exploration of novel compounds within the class of MTCh compounds (M=Ni, Pd, Pt; T=Si, Ge, Sn, Pb; Ch=S, Se, Te) by means of density functional calculations. Their preferred structures are predicted from an extended scheme of colored pyrites and marcasites. To determine their stabilities, competing binary MT 2 and MCh 2 boundary phases are taken into account as well as ternary M 3 T 2 Ch 2 and M 2 T 3 Ch 3 systems. Recently established stability diagrams are presented to account for MTCh ordering phenomena with a focus on a not-yet-reported ordering variant of the NiAs 2 type. Due to the good agreement with experimental data available for several PtTCh systems, the predictions for the residual systems are considered sufficiently accurate. - Graphical abstract: Compositional and structural stability of MTCh compounds is investigated from first principle calculations. A conceptional approach is presented to study and predict novel stable and metastable compounds and structures of low gap semiconductors with TCh dumbbell units that are isoelectronic and structurally related to pyrite (FeS 2 ). - Highlights: • Study of compositional stability of MTCh vs. M 3 T 2 Ch 2 and M 2 T 3 Ch 3 compounds. • Study of structural stability of known and novel MTCh compounds. • Prediction of novel stable and metastable structures and compounds isoelectronic to pyrite, FeS 2

Compound I formation in artichoke (Cynara scolymus L.) peroxidase is modulated by the equilibrium between pentacoordinated and 6-aquo hexacoordinated forms of the heme and by calcium ions.

Science.gov (United States)

Hiner, Alexander N P; Sidrach, Lara; Chazarra, Soledad; Varón, Ramón; Tudela, José; García-Cánovas, Francisco; Rodríguez-López, José Neptuno

2003-07-29

Basic artichoke (Cynara scolymus L.) peroxidase (AKP-C), when purified from the plant, has an unusually intense and sharp Soret absorption peak. The resonance Raman spectrum [López-Molina, D., et al. (2003) J. Inorg. Biochem. 94, 243-254] suggested a mixture of pentacoordinate high-spin (5cHS) and 6-aquo hexacoordinate high-spin (6cHS) ferric heme species. The rate constant (k(1)) of compound I formation with hydrogen peroxide (H(2)O(2)) was also lower than expected. Further stopped-flow studies have shown this reaction to be biphasic: a nonsaturating fast phase and a slow phase with complex H(2)O(2) concentration dependence. Addition of calcium ions (Ca(2+)) changed the absorption spectrum, suggesting the formation of a fully 5cHS species with a k(1) more than 5 orders of magnitude greater than that in the absence of Ca(2+) using the chelator ethylenediaminetetraacetic acid. Ca(2+) titrations gave a dissociation constant for a single Ca(2+) of approximately 20 microM. The circular dichroism spectrum of AKP-C was not significantly altered by Ca(2+), indicating that any structural changes will be minor, but removal of Ca(2+) did suppress the alkaline transition between pH 10 and 11. A kinetic analysis of the reaction of Ca(2+)-free AKP-C with H(2)O(2) supports an equilibrium between a slow-reacting 6cHS form and a more rapidly reacting 5cHS species, the presence of which was confirmed in nonaqueous solution. AKP-C, as purified, is a mixture of Ca(2+)-bound 5cHS, 6-aquo 6cHS, and Ca(2+)-free 5cHS species. The possibility that Ca(2+) concentration could control peroxidase activity in the plant is discussed.

Status of the US stellarator reactor study

International Nuclear Information System (INIS)

Lyon, J.F.; Gulec, K.; Miller, R.L.; El-Guebaly, L.

1994-01-01

Stellarators have significant operational advantages over tokamaks as ignited steady-state reactors. This scoping study, which uses an integrated cost-minimization code that incorporates costing and reactor component models self-consistently with a 1-D energy transport calculation, shows that a torsatron reactor could also be competitive with a tokamak reactor. The projected cost of electricity (COE) estimated using the ARIES costing algorithms is 62.5 mill/kW(e)h in constant 1992 dollars for a 1-GW(e) Compact Torsatron reactor reference case. The COE is relatively insensitive (< 10% variation) over a wide range of assumptions including variations in the maximum field allowed on the coils, the coil elongation, the shape of the density profile, the beta limit, the confinement multiplier, and the presence of a large loss region for alpha particles. The largest variations in the COE occur for variations in the electrical power output demanded and the plasma-coil separation ratio

Phenotypic changes associated with RNA interference silencing of chalcone synthase in apple (Malus × domestica).

Science.gov (United States)

Dare, Andrew P; Tomes, Sumathi; Jones, Midori; McGhie, Tony K; Stevenson, David E; Johnson, Ross A; Greenwood, David R; Hellens, Roger P

2013-05-01

We have identified in apple (Malus × domestica) three chalcone synthase (CHS) genes. In order to understand the functional redundancy of this gene family RNA interference knockout lines were generated where all three of these genes were down-regulated. These lines had no detectable anthocyanins and radically reduced concentrations of dihydrochalcones and flavonoids. Surprisingly, down-regulation of CHS also led to major changes in plant development, resulting in plants with shortened internode lengths, smaller leaves and a greatly reduced growth rate. Microscopic analysis revealed that these phenotypic changes extended down to the cellular level, with CHS-silenced lines showing aberrant cellular organisation in the leaves. Fruit collected from one CHS-silenced line was smaller than the 'Royal Gala' controls, lacked flavonoids in the skin and flesh and also had changes in cell morphology. Auxin transport experiments showed increased rates of auxin transport in a CHS-silenced line compared with the 'Royal Gala' control. As flavonoids are well known to be key modulators of auxin transport, we hypothesise that the removal of almost all flavonoids from the plant by CHS silencing creates a vastly altered environment for auxin transport to occur and results in the observed changes in growth and development. © 2013 The Authors The Plant Journal © 2013 Blackwell Publishing Ltd.

Chitinase and chitin synthase 1: counterbalancing activities in cell separation of Saccharomyces cerevisiae.

Science.gov (United States)

Cabib, E; Silverman, S J; Shaw, J A

1992-01-01

Previous results [E. Cabib, A. Sburlati, B. Bowers & S. J. Silverman (1989) Journal of Cell Biology 108, 1665-1672] strongly suggested that the lysis observed in daughter cells of Saccharomyces cerevisiae defective in chitin synthase 1 (Chs1) was caused by a chitinase that partially degrades the chitin septum in the process of cell separation. Consequently, it was proposed that in wild-type cells, Chs1 acts as a repair enzyme by replenishing chitin during cytokinesis. The chitinase requirement for lysis has been confirmed in two different ways: (a) demethylallosamidin, a more powerful chitinase inhibitor than the previously used allosamidin, is also a much better protector against lysis and (b) disruption of the chitinase gene in chs1 cells eliminates lysis. Reintroduction of a normal chitinase gene, by transformation of those cells with a suitable plasmid, restores lysis. The percentage of lysed cells in strains lacking Chs1 was not increased by elevating the chitinase level with high-copy-number plasmids carrying the hydrolase gene. Furthermore, the degree of lysis varied in different chs1 strains; lysis was abolished in chs1 mutants containing the scs1 suppressor. These results indicate that, in addition to chitinase, lysis requires other gene products that may become limiting.

Evidence for some signal transduction elements involved in UV-light-dependent responses in parsley protoplasts

International Nuclear Information System (INIS)

Frohnmeyer, H.; Bowler, C.; Schäfer, E.

1997-01-01

The signalling pathways used by UV-light are largely unknown. Using protoplasts from a heterotrophic parsley (Petroselinum crispum L.) cell culture that exclusively respond to UV-B light between 300 and 350 nm with a fast induction of genes encoding flavonoid biosynthetic enzymes, information was obtained about the UV-light signal transduction pathway for chalcone synthase (CHS) and phenylalanine ammonia-lyase (PAL) gene expression. Pharmacological effectors which influence intracellular calcium levels, calmodulin and the activity of serine/threonine kinases also changed the UV-light-dependent expression of these genes. This evaluation indicated the participation of these components on the UV-B-mediated signal transduction cascade to CHS. In contrast, neither membrane-permeable cyclic GMP nor the tyrosine kinase inhibitor genistein affected CHS or PAL expression. Similar results were obtained in protoplasts, which have been transiently transformed with CHS-promoter/GUS (β-glucuronidase) reporter fusion constructs. The involvement of calcium and calmodulin was further indicated in a cell-free light-responsive in vitro transcription system from evacuolated parsley protoplasts. In conclusion, there is evidence now that components of the UV-light-dependent pathway leading to the CHS-promoter are different from the previously characterized cGMP-dependent pathway to CHS utilized by phytochrome in soybean (Glycine max) and tomato seedlings (Lycopersicon esculentum). (author)

Overvej cannabinoid hyperemesis-syndrom ved recidiverende opkastninger

DEFF Research Database (Denmark)

Nordholm-Carstensen, Andreas

2014-01-01

Cannabinoid hyperemesis syndrome (CHS) is characterised by unrelenting nausea, recurrent vomiting, abdominal pain and compulsive, hot bathing behaviour. The symptoms contrast the traditional effects associated with cannabis use. We report a "textbook example" of a 26-year-old man with CHS. CHS...... is an important differential diagnosis to consider in patients with similar symptoms and the distinctive symptom relief in hot water. Early recognition may prevent extensive, unnecessary medical examinations and frequent hospital admissions....

Methylation effect on chalcone synthase gene expression determines anthocyanin pigmentation in floral tissues of two Oncidium orchid cultivars.

Science.gov (United States)

Liu, Xiao-Jing; Chuang, Yao-Nung; Chiou, Chung-Yi; Chin, Dan-Chu; Shen, Fu-Quan; Yeh, Kai-Wun

2012-08-01

The anthocyanin-biosynthetic pathway was studied in flowers of Oncidium Gower Ramsey with yellow floral color and mosaic red anthocyanin in lip crests, sepals and petals, and compared with the anthocyanin biosynthesis in flowers of Oncidium Honey Dollp, a natural somatoclone derived from tissue culture of Gower Ramsey, with a yellow perianth without red anthocyanins in floral tissues. HPLC analysis revealed that the red anthocyanin in lip crests of the Gower Ramsey cultivar comprised peonidin-3-O-glucoside, delphinidin-3-O-glucoside and cyanidin-3-O-glucoside, whereas Honey Dollp was devoid of anthocyanin compounds. Among the five anthocyanin-biosynthetic genes, OgCHS was actively expressed in lip crests of Gower Ramsey flowers, but no transcripts of OgCHS were detected in Honey Dollp floral tissues. Transient expression of OgCHS by bombardment confirmed that recovery of the OgCHS gene expression completed the anthocyanin pathway and produced anthocyanin compounds in lip crests of Honey Dollp flowers. Transcription factor genes regulating anthocyanin biosynthesis showed no distinctive differences in the expression level of OgMYB1, OgbHLH and OgWD40 between the two cultivars. A methylation assay revealed that the promoter of OgCHS was not methylated in Gower Ramsey, while a positive methylation effect was present in the upstream promoter region of OgCHS in Honey Dollp. Overall, our results suggest that the failure of anthocyanin accumulation in Honey Dollp floral tissues may be attributed to inactivation of the OgCHS gene resulting from the epigenetic methylation of 5'-upstream promoter region.

Community hospitals – the place of local service provision in a modernising NHS: an integrative thematic literature review

Directory of Open Access Journals (Sweden)

Heaney David

2006-12-01

Full Text Available Abstract Background Recent developments within the United Kingdom's (UK health care system have re-awakened interest in community hospitals (CHs and their role in the provision of health care. This integrative literature review sought to identify and assess the current evidence base for CHs. Methods A range of electronic reference databases were searched from January 1984 to either December 2004 or February 2005: Medline, Embase, Web of Knowledge, BNI, CINAHL, HMIC, ASSIA, PsychInfo, SIGLE, Dissertation Abstracts, Cochrane Library, Kings Fund website, using both keywords and text words. Thematic analysis identified recurrent themes across the literature; narrative analyses were written for each theme, identifying unifying concepts and discrepant issues. Results The search strategy identified over 16,000 international references. We included papers of any study design focussing on hospitals in which care was led principally by general practitioners or nurses. Papers from developing countries were excluded. A review of titles revealed 641 potentially relevant references; abstract appraisal identified 161 references for review. During data extraction, a further 48 papers were excluded, leaving 113 papers in the final review. The most common methodological approaches were cross-sectional/descriptive studies, commentaries and expert opinion. There were few experimental studies, systematic reviews, economic studies or studies that reported on longer-term outcomes. The key themes identified were origin and location of CHs; their place in the continuum of care; services provided; effectiveness, efficiency and equity of CHs; and views of patients and staff. In general, there was a lack of robust evidence for the role of CHs, which is partly due to the ad hoc nature of their development and lack of clear strategic vision for their future. Evidence for the effectiveness and efficiency of the services provided was limited. Most people admitted to CHs

Inhibitory Effects of Culinary Herbs and Spices on the Growth of HCA-7 Colorectal Cancer Cells and Their COX-2 Expression.

Science.gov (United States)

Jaksevicius, Andrius; Carew, Mark; Mistry, Calli; Modjtahedi, Helmout; Opara, Elizabeth I

2017-09-21

It is unclear if the anti-inflammatory properties of culinary herbs and spices (CHS) are linked to their ability to inhibit Colorectal cancer cell (CRC) growth. Furthermore, their therapeutic potential with regards to CRC is unknown. The aim of this study was to establish if the inhibition of HCA-7 CRC cell growth by a selection of culinary herbs and spices (CHS) is linked to the inhibition of the cells' cyclooxygenase-2 (COX-2 )expression, and to investigate their therapeutic potential. CHS inhibited the growth of Human colon adenocarcinoma-7 (HCA-7) cells; the order of potency was turmeric, bay leaf, ginger, sage, and rosemary; their combinations had a synergistic or additive effect on cell growth inhibition. CHS also inhibited COX-2 expression and activity; this action was comparable to that of the specific COX-2 inhibitor Celecoxib. Coincident with COX-2 inhibition was the accumulation of cells in the sub G1 phase of the HCA-7's cell cycle and, using bay leaf and turmeric, the cleavage of caspase 3 and poly (ADP-ribose) polymerase (PARP). This latter effect showed that the effect of these CHS on growth arrest was irreversible, and was comparable to that of the caspase activator Etoposide. This study provides evidence of a link between the inhibition of HCA-7 growth, and its COX-2 expression, by CHS, and their therapeutic potential.

A Gut Gone to Pot: A Case of Cannabinoid Hyperemesis Syndrome due to K2, a Synthetic Cannabinoid

Directory of Open Access Journals (Sweden)

Anene Ukaigwe

2014-01-01

Full Text Available Cannabinoid Hyperemesis Syndrome (CHS was first described in 2004. Due to its novelty, CHS is often unrecognized by clinicians leading to expensive workup of these patients with cyclical symptoms. It may take up to 9 years to diagnose CHS. CHS is characterized by cyclical nausea and vomiting, abdominal pain, and an unusual compulsion to take hot showers in the presence of chronic use of cannabinoids. Cannabicyclohexanol is a synthetic cannabinoid, popularly known as K2 spice. It is a popular marijuana alternative among teenagers and young adults since it is readily available as herbal incense. Unlike marijuana, many users know that K2 is not detected in conventional urine drug screens, allowing those users to conceal their intake from typical detection methods. Serum or urine gas chromatography mass spectrophotometry is diagnostic, though not widely available. Thus, it is imperative for clinicians to recognize CHS, even with negative UDS, to provide cost-effective care. We present a 38-year-old man with a 10-year history of cannabis, and 1-year history of K2 abuse admitted with 1-week history of episodes of nausea, vomiting of clear fluids, and epigastric discomfort. Symptoms are relieved only by hot showers. Extensive laboratory, radiologic, and endoscopic evaluation was unrevealing. CHS was diagnosed, based on proposed criteria by Simonetti et al.

The combined hybrid system: A symbiotic thermal reactor/fast reactor system for power generation and radioactive waste toxicity reduction

International Nuclear Information System (INIS)

Hollaway, W.R.

1991-08-01

If there is to be a next generation of nuclear power in the United States, then the four fundamental obstacles confronting nuclear power technology must be overcome: safety, cost, waste management, and proliferation resistance. The Combined Hybrid System (CHS) is proposed as a possible solution to the problems preventing a vigorous resurgence of nuclear power. The CHS combines Thermal Reactors (for operability, safety, and cost) and Integral Fast Reactors (for waste treatment and actinide burning) in a symbiotic large scale system. The CHS addresses the safety and cost issues through the use of advanced reactor designs, the waste management issue through the use of actinide burning, and the proliferation resistance issue through the use of an integral fuel cycle with co-located components. There are nine major components in the Combined Hybrid System linked by nineteen nuclear material mass flow streams. A computer code, CHASM, is used to analyze the mass flow rates CHS, and the reactor support ratio (the ratio of thermal/fast reactors), IFR of the system. The primary advantages of the CHS are its essentially actinide-free high-level radioactive waste, plus improved reactor safety, uranium utilization, and widening of the option base. The primary disadvantages of the CHS are the large capacity of IFRs required (approximately one MW e IFR capacity for every three MW e Thermal Reactor) and the novel radioactive waste streams produced by the CHS. The capability of the IFR to burn pure transuranic fuel, a primary assumption of this study, has yet to be proven. The Combined Hybrid System represents an attractive option for future nuclear power development; that disposal of the essentially actinide-free radioactive waste produced by the CHS provides an excellent alternative to the disposal of intact actinide-bearing Light Water Reactor spent fuel (reducing the toxicity based lifetime of the waste from roughly 360,000 years to about 510 years)

Cannabinoid Hyperemesis Syndrome: Public Health Implications and a Novel Model Treatment Guideline

Directory of Open Access Journals (Sweden)

Seth Meyer

2017-11-01

Full Text Available Introduction: Cannabinoid hyperemesis syndrome (CHS is an entity associated with cannabinoid overuse. CHS typically presents with cyclical vomiting, diffuse abdominal pain, and relief with hot showers. Patients often present to the emergency department (ED repeatedly and undergo extensive evaluations including laboratory examination, advanced imaging, and in some cases unnecessary procedures. They are exposed to an array of pharmacologic interventions including opioids that not only lack evidence, but may also be harmful. This paper presents a novel treatment guideline that highlights the identification and diagnosis of CHS and summarizes treatment strategies aimed at resolution of symptoms, avoidance of unnecessary opioids, and ensuring patient safety. Methods: The San Diego Emergency Medicine Oversight Commission in collaboration with the County of San Diego Health and Human Services Agency and San Diego Kaiser Permanente Division of Medical Toxicology created an expert consensus panel to establish a guideline to unite the ED community in the treatment of CHS. Results: Per the consensus guideline, treatment should focus on symptom relief and education on the need for cannabis cessation. Capsaicin is a readily available topical preparation that is reasonable to use as first-line treatment. Antipsychotics including haloperidol and olanzapine have been reported to provide complete symptom relief in limited case studies. Conventional antiemetics including antihistamines, serotonin antagonists, dopamine antagonists and benzodiazepines may have limited effectiveness. Emergency physicians should avoid opioids if the diagnosis of CHS is certain and educate patients that cannabis cessation is the only intervention that will provide complete symptom relief. Conclusion: An expert consensus treatment guideline is provided to assist with diagnosis and appropriate treatment of CHS. Clinicians and public health officials should identity and treat CHS

The Memory Alteration Test Discriminates between Cognitively Healthy Status, Mild Cognitive Impairment and Alzheimer's Disease

Science.gov (United States)

Custodio, Nilton; Lira, David; Herrera-Perez, Eder; Nuñez del Prado, Liza; Parodi, José; Guevara-Silva, Erik; Castro-Suarez, Sheila; Montesinos, Rosa; Cortijo, Patricia

2014-01-01

Background/Aims Dementia is a worldwide public health problem and there are several diagnostic tools for its assessment. The aim of this study was to evaluate the performance of the Memory Alteration Test (M@T) to discriminate between patients with early Alzheimer's disease (AD), patients with amnestic mild cognitive impairment (a-MCI), and subjects with a cognitively healthy status (CHS). Methods The discriminative validity was assessed in a sample of 90 patients with AD, 45 patients with a-MCI, and 180 subjects with CHS. Clinical, functional, and cognitive studies were independently performed in a blinded fashion and the gold standard diagnosis was established by consensus on the basis of these results. The test performance was assessed by means of a receiver operating characteristic curve analysis as area under the curve (AUC). Results M@T mean scores were 17.7 (SD = 5.7) in AD, 30.8 (SD = 2.3) in a-MCI, and 44.5 (SD = 3.1) in CHS. A cutoff score of 37 points had a sensitivity of 98.3% and a specificity of 97.8% to differentiate a-MCI from CHS (AUC = 0.999). A cutoff score of 27 points had a sensitivity of 100% and a specificity of 98.9% to differentiate mild AD from a-MCI and from CHS (AUC = 1.000). Conclusions The M@T had a high performance in the discrimination between early AD, a-MCI and CHS. PMID:25298775

Expression of cysLT1 and cysLT2 Receptor in Chronic Hyperplastic Eosinophilic Sinusitis

International Nuclear Information System (INIS)

Ouyang, Yuhui; Kamijo, Atsushi; Murata, Shin-ichi; Okamoto, Atsushi; Endo, Shuichiro; Katoh, Ryohei; Masuyama, Keisuke

2009-01-01

Elevated production of cysteinyl leukotrienes (cysLTs) from sinus tissues and abundant sinus eosinophils are characteristic features of chronic hyperplastic eosinophilic sinusitis (CHS). CysLTs exert their action through G-protein-coupled receptors named cysLTs receptor type I (cysLT1R) and type II (cysLT2R). These expressions of cysLT receptors in the sinus mucosa have yet to be clarified and the relationship between eosinophilia and the expression of these receptors remains obscure. We compared the expressions of cysLT1R and cysLT2R in the sinus mucosa in patients with CHS, non-eosinophilic chronic sinusitis (NECS), and control sinus tissues; and analyzed the correlation between the expression of CysLTRs and the presence of sinus eosinophils by immunohistochemistry and real-time PCR. A significantly higher percentage of eosinophils expressing cysLT2R protein was observed in patients with CHS compared with NECS and controls. In addition, cysLT2R mRNA expression in CHS was significantly higher than in NECS and controls. Furthermore, a positive correlation was observed between cysLT2R mRNA expression and the number of infiltrated eosinophils. In contrast, the cysLT1R mRNA expression did not differ significantly among these groups. The effect of cysLTs on sinus eosinophils may be mediated through the cysLT2R in patients with CHS. These results may suggest the therapeutic benefit of cysLT2R antagonists in CHS

Silybin content and overexpression of chalcone synthase genes in Silybum marianum L. plants under abiotic elicitation.

Science.gov (United States)

El-Garhy, Hoda A S; Khattab, Salah; Moustafa, Mahmoud M A; Abou Ali, Rania; Abdel Azeiz, Ahmed Z; Elhalwagi, Abeer; El Sherif, Fadia

2016-11-01

Silymarin, a Silybum marianum seed extract containing a mixture of flavonolignans including silybin, is being used as an antihepatotoxic therapy for liver diseases. In this study, the enhancing effect of gamma irradiation on plant growth parameters of S. marianum under salt stress was investigated. The effect of gamma irradiation, either as a single elicitor or coupled with salinity, on chalcone synthase (CHS) gene expression and silybin A + B yield was also evaluated. The silybin A + B content in S. marianum fruits was estimated by liquid chromatography-mass spectrometry (LC-MS/MS). An increase in silybin content was accompanied by up-regulation of the CHS1, CHS2 and CHS3 genes, which are involved in the silybin biosynthetic pathway. The highest silybin A + B production (0.77 g/100 g plant DW) and transcript levels of the three studied genes (100.2-, 91.9-, and 24.3-fold increase, respectively) were obtained with 100GY gamma irradiation and 4000 ppm salty water. The CHS2 and CHS3 genes were partially sequenced and submitted to the NCBI database under the accession numbers KT252908.1 and KT252909.1, respectively. Developing new approaches to stimulate silybin biosynthetic pathways could be a useful tool to potentiate the use of plants as renewable resources of medicinal compounds. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Modular Stellarator Reactor conceptual design study

International Nuclear Information System (INIS)

Miller, R.L.; Bathke, C.G.

1983-01-01

A conceptual design study of the Modular Stellarator Reactor is summarized. The physics basis of the approach is elucidated with emphasis on magnetics performance optimization. Key engineering features of the fusion power core are described. Comparisons with an analogous continuous-helical-coil (torsatron) system are made as the basis of a technical and economic assessment

Modular stellarator reactor conceptual design study

International Nuclear Information System (INIS)

Miller, R.L.; Krakowski, R.A.; Bathke, C.G.

1983-01-01

A conceptual design study of the Modular Stellarator Reactor is summarized. The physics basis of the approach is elucidated with emphasis on magnetics performance optimization. Key engineering features of the fusion power core are described. Comparisons with an analogous continuous-helical-coil (torsatron) system are made as the basis of a technical and economic assessment

Distinct UV-B and UV-A/blue light signal transduction pathways induce chalcone synthase gene expression in Arabidopsis cells

International Nuclear Information System (INIS)

Christie, J.M.; Jenkins, G.I.

1996-01-01

UV and blue light control the expression of flavonoid biosynthesis genes in a range of higher plants. To investigate the signal transduction processes involved in the induction of chalcone synthase (CHS) gene expression by UV-B and UV-A/blue light, we examined the, effects of specific agonists and inhibitors of known signaling components in mammalian systems in a photomixotrophic Arabidopsis cell suspension culture. CHS expression is induced specifically by these wavelengths in the cell culture, in a manner similar to that in mature Arabidopsis leaf tissue. Both the UV-B and UV-A/blue phototransduction processes involve calcium, although the elevation of cytosolic calcium is insufficient on its own to stimulate CHS expression. The UV-A/blue light induction of CHS expression does not appear to involve calmodulin, whereas the UV-B response does; this difference indicates that the signal transduction pathways are, at least in part, distinct. We provide evidence that both pathways involve reversible protein phosphorylation and require protein synthesis. The UV-B and UV-A/blue light signaling pathways are therefore different from the phytochrome signal transduction pathway regulating CHS expression in other species

Injectable glycosaminoglycan-protein nano-complex in semi-interpenetrating networks: A biphasic hydrogel for hyaline cartilage regeneration.

Science.gov (United States)

Radhakrishnan, Janani; Subramanian, Anuradha; Sethuraman, Swaminathan

2017-11-01

Articular hyaline cartilage regeneration remains challenging due to its less intrinsic reparability. The study develops injectable biphasic semi-interpenetrating polymer networks (SIPN) hydrogel impregnated with chondroitin sulfate (ChS) nanoparticles for functional cartilage restoration. ChS loaded zein nanoparticles (∼150nm) prepared by polyelectrolyte-protein complexation were interspersed into injectable SIPNs developed by blending alginate with poly(vinyl alcohol) and calcium crosslinking. The hydrogel exhibited interconnected porous microstructure (39.9±5.8μm pore diameter, 57.7±5.9% porosity), 92% swellability and >350Pa elastic modulus. Primary chondrocytes compatibility, chondrocyte-matrix interaction with cell-cell clustering and spheroidal morphology was demonstrated in ChS loaded hydrogel and long-term (42days) proliferation was also determined. Higher fold expression of cartilage-specific genes sox9, aggrecan and collagen-II was observed in ChS loaded hydrogel while exhibiting poor expression of collagen-I. Immunoblotting of aggregan and collagen II demonstrate favorable positive influence of ChS on chondrocytes. Thus, the injectable biphasic SIPNs could be promising composition-mimetic substitute for cartilage restoration at irregular defects. Copyright © 2017 Elsevier Ltd. All rights reserved.

High sensitivity but normal DNA-repair activity after UV irradiation in Epstein-Barr virus-transformed lymphoblastoid cell lines from Chediak-Higashi syndrome

International Nuclear Information System (INIS)

Tanaka, H.; Orii, T.

1980-01-01

We established lymphoblastoid cell lines from 2 children with Chediak-Higashi syndrome (CHS), 2 xeroderma pigmentosum (XP) patients and control donors after transformation of peripheral lymphocytes by Epstein-Barr virus (EBV). We used these lymphoblastoid cell lines to investigate repair activity after ultraviolet irradiation. Cell survival of both CHS lymphoblastoid cell lines after irradiation by UV and treatment by 4-nitroquinoline 1-oxide (4NQO) fell between those of the XP and control cells lines. Unscheduled DNA synthesis of CHS cells after UV irradiation occured at rates similar to those of control cells. (orig.)

Wendelstein VII-A in torsatron mode

International Nuclear Information System (INIS)

Harmeyer, E.; Kisslinger, J.; Rau, F.; Wobig, H.

1985-03-01

Variable shear - positive or negative, up to about 20 percent - can be introduced into the Wendelstein VII-A Stellarator vacuum field configuration by different currents in the two helix systems, and balancing the resulting vertical field. (orig.)

The value of surrogate markers to monitor cholesterol absorption, synthesis and bioconversion to bile acids under lipid lowering therapies.

Science.gov (United States)

Stellaard, Frans; von Bergmann, Klaus; Sudhop, Thomas; Lütjohann, Dieter

2017-05-01

Regulation of cholesterol (Chol) homeostasis is controlled by three main fluxes, i.e. intestinal absorption, de novo synthesis (ChS) and catabolism, predominantly as bile acid synthesis (BAS). High serum total Chol and LDL-Chol concentrations in particular are considered risk factors and markers for the development of atherosclerosis. Pharmaceutical treatments to lower serum Chol have focused on reducing absorption or ChS and increasing BAS. Monitoring of these three parameters is complex involving isotope techniques, cholesterol balance experiments and advanced mass spectrometry based analysis methods. Surrogate markers were explored that require only one single fasting blood sample collection. These markers were validated in specific, mostly physiological conditions and during statin treatment to inhibit ChS. They were also applied under cholesterol absorption restriction, but were not validated in this condition. We retrospectively evaluated the use of serum campesterol (Camp), sitosterol (Sit) and cholestanol (Cholol) as markers for cholesterol absorption, lathosterol (Lath) as marker for ChS and 7α-hydroxycholesterol (7α-OH-Ch) and 27-hydroxycholesterol (27-OH-Ch) as markers for BAS under conditions of Chol absorption restriction. Additionally, their values were corrected for Chol concentration (R_sterol or oxysterols). Thirty-seven healthy male omnivore subjects were studied under treatments with placebo (PLAC), ezetimibe (EZE) to inhibit cholesterol absorption, simvastatin (SIMVA) to reduce cholesterol synthesis and a combination of both (EZE+SIMVA). Results were compared to those obtained in 18 pure vegetarian subjects (vegans) whose dietary Chol intake is extremely low. Relative or fractional Chol absorption (FrChA) was measured with the continuous feeding stable isotope procedure, ChS and BAS with the cholesterol balance method. The daily Chol intake (DICh) was inventoried and the daily Chol absorption (DACh) calculated. Monitoring cholesterol

Ergodization of magnetic surfaces due to finite beta effect in a helical system

International Nuclear Information System (INIS)

Hayashi, Takaya.

1989-04-01

Breaking of magnetic surfaces due to finite beta effect in a l=2 heliotron/torsatron configuration is studied by using a newly developed three dimensional equilibrium code. Breaking can be suppressed by a larger aspect ratio configuration, shaping of magnetic surface (inward shift or prolate shape), pitch modulation of helical coils, or pressure profile control. (author)

Construction and initial operation of the Advanced Toroidal Facility

International Nuclear Information System (INIS)

Bell, G.L.; Bell, J.D.; Benson, R.D.

1989-08-01

The Advanced Toroidal Facility (ATF) torsatron was designed on a physics basis for access to the second stability regime and on an engineering basis for independent fabrication of high-accuracy components. The actual construction, assembly, and initial operation of ATF are compared with the characteristics expected during the design of ATF. 31 refs., 19 figs., 2 tabs

Identification and functional characterization of three type III polyketide synthases from Aquilaria sinensis calli

International Nuclear Information System (INIS)

Wang, Xiaohui; Zhang, Zhongxiu; Dong, Xianjuan; Feng, Yingying; Liu, Xiao; Gao, Bowen; Wang, Jinling; Zhang, Le; Wang, Juan; Shi, Shepo; Tu, Pengfei

2017-01-01

Type III polyketide synthases (PKSs) play an important role in biosynthesis of various plant secondary metabolites and plant adaptation to environmental stresses. Aquilaria sinensis (A. sinensis) is the main plant species for production of agarwood, little is known about its PKS family. In this study, AsCHS1 and two new type III PKSs, AsPKS1 and AsPKS2, were isolated and characterized in A. sinensis calli. The comparative sequence and phylogenetic analysis indicated that AsPKS1 and AsPKS2 belonged to non-CHS group different from AsCHS1. The recombinant AsPKS1 and AsPKS2 produced the lactone-type products, suggesting their different enzyme activities from AsCHS1. Three PKS genes had a tissues-specific pattern in A. sinensis. Moreover, we examined the expression profiles of three PKS genes in calli under different abiotic stresses and hormone treatments. AsCHS1 transcript was most significantly induced by salt stress, AsPKS1 abundance was most remarkably enhanced by CdCl 2 treatment, while AsPKS2 expression was most significantly induced by mannitol treatment. Furthermore, AsCHS1, AsPKS1 and AsPKS2 expression was enhanced upon gibberellins (GA3), methyl jasmonate (MeJA), or salicylic acid (SA) treatment, while three PKS genes displayed low transcript levels at the early stage under abscisic acid (ABA) treatment. In addition, three GFP:PKSs fusion proteins were localized in the cytoplasm and cell wall in Nicotiana benthamiana cells. These results indicated the multifunctional role of three type III PKSs in polyketide biosynthesis, plant resistance to abiotic stresses and signal transduction. - Highlights: • Two new PKS genes (AsPKS1 and AsPKS2) were isolated and characterized from A. sinensis. • The recombinant AsPKS1 and AsPKS2 catalyzed lactone-type products in vitro. • AsCHS1, AsPKS1 and AsPKS2 were involved in plant responses to abiotic stresses and hormone stimuli. • Our results also indicated that AsCHS1, AsPKS1 and AsPKS2 were predominantly localized

Makerere University College of Health Sciences’ role in addressing challenges in health service provision at Mulago National Referral Hospital

Directory of Open Access Journals (Sweden)

Sekandi Juliet

2011-03-01

Full Text Available Abstract Background Mulago National Referral Hospital (MNRH, Uganda’s primary tertiary and teaching hospital, and Makerere University College of Health Sciences (MakCHS have a close collaborative relationship. MakCHS students complete clinical rotations at MNRH, and MakCHS faculty partner with Mulago staff in clinical care and research. In 2009, as part of a strategic planning process, MakCHS undertook a qualitative study to examine care and service provision at MNRH, identify challenges, gaps, and solutions, and explore how MakCHS could contribute to improving care and service delivery at MNRH. Methods Key informant interviews (n=23 and focus group discussions (n=7 were conducted with nurses, doctors, administrators, clinical officers and other key stakeholders. Interviews and focus groups were tape recorded and transcribed verbatim, and findings were analyzed through collaborative thematic analysis. Results Challenges to care and service delivery at MNRH included resource constraints (staff, space, equipment, and supplies, staff inadequacies (knowledge, motivation, and professionalism, overcrowding, a poorly functioning referral system, limited quality assurance, and a cumbersome procurement system. There were also insufficiencies in the teaching of professionalism and communication skills to students, and patient care challenges that included lack of access to specialized services, risk of infections, and inappropriate medications. Suggestions for how MakCHS could contribute to addressing these challenges included strengthening referral systems and peripheral health center capacity, and establishing quality assurance mechanisms. The College could also strengthen the teaching of professionalism, communication and leadership skills to students, and monitor student training and develop courses that contribute to continuous professional development. Additionally, the College could provide in-service education for providers on professionalism

Deep sequencing uncovers commonality in small RNA profiles between transgene-induced and naturally occurring RNA silencing of chalcone synthase-A gene in petunia.

Science.gov (United States)

Kasai, Megumi; Matsumura, Hideo; Yoshida, Kentaro; Terauchi, Ryohei; Taneda, Akito; Kanazawa, Akira

2013-01-30

Introduction of a transgene that transcribes RNA homologous to an endogenous gene in the plant genome can induce silencing of both genes, a phenomenon termed cosuppression. Cosuppression was first discovered in transgenic petunia plants transformed with the CHS-A gene encoding chalcone synthase, in which nonpigmented sectors in flowers or completely white flowers are produced. Some of the flower-color patterns observed in transgenic petunias having CHS-A cosuppression resemble those in existing nontransgenic varieties. Although the mechanism by which white sectors are generated in nontransgenic petunia is known to be due to RNA silencing of the CHS-A gene as in cosuppression, whether the same trigger(s) and/or pattern of RNA degradation are involved in these phenomena has not been known. Here, we addressed this question using deep-sequencing and bioinformatic analyses of small RNAs. We analyzed short interfering RNAs (siRNAs) produced in nonpigmented sectors of petal tissues in transgenic petunia plants that have CHS-A cosuppression and a nontransgenic petunia variety Red Star, that has naturally occurring CHS-A RNA silencing. In both silencing systems, 21-nt and 22-nt siRNAs were the most and the second-most abundant size classes, respectively. CHS-A siRNA production was confined to exon 2, indicating that RNA degradation through the RNA silencing pathway occurred in this exon. Common siRNAs were detected in cosuppression and naturally occurring RNA silencing, and their ranks based on the number of siRNAs in these plants were correlated with each other. Noticeably, highly abundant siRNAs were common in these systems. Phased siRNAs were detected in multiple phases at multiple sites, and some of the ends of the regions that produced phased siRNAs were conserved. The features of siRNA production found to be common to cosuppression and naturally occurring silencing of the CHS-A gene indicate mechanistic similarities between these silencing systems especially in the

Influence of coronal holes on CMEs in causing SEP events

International Nuclear Information System (INIS)

Shen Chenglong; Yao Jia; Wang Yuming; Ye Pinzhong; Wang Shui; Zhao Xuepu

2010-01-01

The issue of the influence of coronal holes (CHs) on coronal mass ejections (CMEs) in causing solar energetic particle (SEP) events is revisited. It is a continuation and extension of our previous work, in which no evident effects of CHs on CMEs in generating SEPs were found by statistically investigating 56 CME events. This result is consistent with the conclusion obtained by Kahler in 2004. We extrapolate the coronal magnetic field, define CHs as the regions consisting of only open magnetic field lines and perform a similar analysis on this issue for 76 events in total by extending the study interval to the end of 2008. Three key parameters, CH proximity, CH area and CH relative position, are involved in the analysis. The new result confirms the previous conclusion that CHs did not show any evident effect on CMEs in causing SEP events. (research papers)

Personalized risk assessment of drug-related harm is associated with health outcomes.

Directory of Open Access Journals (Sweden)

Andrea A Jones

Full Text Available The Independent Scientific Committee on Drugs (ISCD assigned quantitative scores for harm to 20 drugs. We hypothesized that a personalized, ISCD-based Composite Harm Score (CHS would be associated with poor health outcomes in polysubstance users.A prospective community sample (n=293 of adults living in marginal housing was assessed for substance use. The CHS was calculated based on the ISCD index, and the personal substance use characteristics over four weeks. Regression models estimated the association between CHS and physical, psychological, and social health outcomes.Polysubstance use was pervasive (95.8%, as was multimorbid illness (median 3, possible range 0-12. The median CHS was 2845 (interquartile range 1865-3977. Adjusting for age and sex, every 1000-unit CHS increase was associated with greater mortality (odds ratio [OR] 1.47, 95% confidence interval [CI] 1.07-2.01, p = 0.02, and persistent hepatitis C infection (OR 1.29, 95% CI 1.02-1.67, p = 0.04. The likelihood of substance-induced psychosis increased 1.39-fold (95% CI 1.13-1.67, p = 0.001. The amount spent on drugs increased 1.51-fold (1.40-1.62, p < 0.001 and the odds of having committed a crime increased 1.74-fold (1.46-2.10, p < 0.001. Multimorbid illness increased 1.43-fold (95% CI 1.26-1.63, p < 0.001.Greater CHS predicts poorer physical, psychological, and social health, and may be a useful quantitative, personalized measure of risk for drug-related harm.

Cerebrospinal fluid hypovolemia syndrome with benign course

Directory of Open Access Journals (Sweden)

Ramesha K

2010-01-01

Full Text Available Background: The cerebrospinal fluid hypovolemia syndrome (CHS is an under recognized cause of headache. This study was designed to highlight the clinico-radiological and cerebrospinal fluid (CSF picture of CHS and their long-term outcome from a tertiary referral center. Materials and Methods: The CHS was diagnosed on the basis of the criteria proposed by Chung et al. Cases with CSF rhinorrhoea or other CSF leak or head trauma were excluded from the study. Results: The study included eight consecutive cases of CHS diagnosed over the past 7 years from 2001. The mean age at diagnosis was 40.7 years (range, 34-56 years and male-to-female ratio was 1:3. All patients presented with orthostatic headache of subacute onset and normal neurological examination. Magnetic resonance imaging studies of all patients showed hyperintensity of pachymeninges in T2W sequences, venous distension sign, and diffuse pachymeningeal gadolinium enhancement. The descent of the brainstem and subdural effusion were noted in two each (25%. CSF study (n = 5 showed low opening pressure in three (60%, and mild pleocytosis with elevated protein in two each (40%. The mean time to complete recovery with conservative treatment alone was 25.6 days. All radiological signs disappeared with clinical improvement in three patients where follow-up imaging was done. On mean follow-up period of 3.6 years, all were asymptomatic without any recurrence of CHS. Conclusion: CHS can resolve completely with conservative management and intervention with subdural blood patch or surgical repair would be required only if symptoms persist for more than 1 month.

Flavonols and fertilization in Petunia hybrida: localization and mode of action during pollen tube growth

NARCIS (Netherlands)

Ylstra, B.; Busscher, J.; Franken, J.; Hollman, P.C.H.; Mol, J.N.M.; Tunen, van A.J.

1995-01-01

Flavonols form an important class of flavonoids which serve an essential function during plant reproduction. Flavonoid biosynthesis is initiated by the enzyme chalcone synthase (CHS). A high abundance of flavonols and chs mRNA was demonstrated in male and female reproductive organs of Petunia

Metabolic changes in Arabidopsis thaliana plants overexpressing chalcone synthase

NARCIS (Netherlands)

Dao, Thi Thanh Hien

2010-01-01

The study has shown that it is possible to introduce the heterologous CHS gene in Arabidopsis thaliana and common multicopies of transgenes containing plants were obtained. Analysis of the change in metabolome of CHS transgenic plants, high expression transgenic lines can be identified by markers

Multimodal neuromonitoring in pediatric cardiac anesthesia

Directory of Open Access Journals (Sweden)

Alexander J. C. Mittnacht

2014-01-01

Full Text Available Despite significant improvements in overall outcome, neurological injury remains a feared complication following pediatric congenital heart surgery (CHS. Only if adverse events are detected early enough, can effective actions be initiated preventing potentially serious injury. The multifactorial etiology of neurological injury in CHS patients makes it unlikely that one single monitoring modality will be effective in capturing all possible threats. Improving current and developing new technologies and combining them according to the concept of multimodal monitoring may allow for early detection and possible intervention with the goal to further improve neurological outcome in children undergoing CHS.

CHSalign: A Web Server That Builds upon Junction-Explorer and RNAJAG for Pairwise Alignment of RNA Secondary Structures with Coaxial Helical Stacking.

Directory of Open Access Journals (Sweden)

Lei Hua

Full Text Available RNA junctions are important structural elements of RNA molecules. They are formed when three or more helices come together in three-dimensional space. Recent studies have focused on the annotation and prediction of coaxial helical stacking (CHS motifs within junctions. Here we exploit such predictions to develop an efficient alignment tool to handle RNA secondary structures with CHS motifs. Specifically, we build upon our Junction-Explorer software for predicting coaxial stacking and RNAJAG for modelling junction topologies as tree graphs to incorporate constrained tree matching and dynamic programming algorithms into a new method, called CHSalign, for aligning the secondary structures of RNA molecules containing CHS motifs. Thus, CHSalign is intended to be an efficient alignment tool for RNAs containing similar junctions. Experimental results based on thousands of alignments demonstrate that CHSalign can align two RNA secondary structures containing CHS motifs more accurately than other RNA secondary structure alignment tools. CHSalign yields a high score when aligning two RNA secondary structures with similar CHS motifs or helical arrangement patterns, and a low score otherwise. This new method has been implemented in a web server, and the program is also made freely available, at http://bioinformatics.njit.edu/CHSalign/.

Genetic and Imaging Approaches Reveal Pro-Inflammatory and Immunoregulatory Roles of Mast Cells in Contact Hypersensitivity

Directory of Open Access Journals (Sweden)

Nicolas Gaudenzio

2018-06-01

Full Text Available Contact hypersensitivity (CHS is a common T cell-mediated skin disease induced by epicutaneous sensitization to haptens. Mast cells (MCs are widely deployed in the skin and can be activated during CHS responses to secrete diverse products, including some with pro-inflammatory and anti-inflammatory functions. Conflicting results have been obtained regarding pathogenic versus protective roles of MCs in CHS, and this has been attributed in part to the limitations of certain models for studying MC functions in vivo. This review discusses recent advances in the development and analysis of mouse models to investigate the roles of MCs and MC-associated products in vivo. Notably, fluorescent avidin-based two-photon imaging approaches enable in vivo selective labeling and simultaneous tracking of MC secretory granules (e.g., during MC degranulation and MC gene activation by real-time longitudinal intravital microscopy in living mice. The combination of such genetic and imaging tools has shed new light on the controversial role played by MCs in mouse models of CHS. On the one hand, they can amplify CHS responses of mild severity while, on the other hand, can limit the inflammation and tissue injury associated with more severe or chronic models, in part by representing an initial source of the anti-inflammatory cytokine IL-10.

Preparation and characterization of hydroxyapatite/chondroitin sulfate composites by biomimetic synthesis

International Nuclear Information System (INIS)

Xiao Xiufeng; He Dan; Liu Fang; Liu Rongfang

2008-01-01

Based on the principles of biomineralization, flakelike hydroxyapatite/chondroitin sulfate composites were synthesized through biomimetic method using Ca(NO 3 ) 2 .4H 2 O and (NH 4 ) 3 PO 4 .3H 2 O as reagents and chondroitin sulfate as template. The crystalline phase, microstructure, chemical composition, morphology and thermal behavior of the composites obtained in the experiment were characterized by means of X-ray diffraction (XRD), Fourier transform infrared spectroscope (FTIR), transmission electron microscope (TEM), Thermogravimetry-Differential thermal analyzer (TG-DTA) and Elemental analyzer, respectively. The interaction between the functional groups of ChS and HA was investigated by electrical conductivity and UV-vis spectrum. The results demonstrate that the as-prepared powders with small amount of carbonate have the component similar to human bone. It can be concluded that the nucleation and growth of HA crystals occurred through the chemical interactions between the HA crystals and preorganized functional groups of the ChS template. Furthermore, the concentration of ChS significantly affects the morphology of the composites. Short fiberlike crystals could be obtained at a low concentration of ChS, but flakelike crystals could be synthesized using a high concentration (≥0.5 wt%) of ChS as template

Preparation and characterization of hydroxyapatite/chondroitin sulfate composites by biomimetic synthesis

Energy Technology Data Exchange (ETDEWEB)

Xiao Xiufeng; He Dan; Liu Fang [College of Chemistry and Materials Science, Fujian Normal University, Fujian, Fuzhou 350007 (China); Liu Rongfang [College of Chemistry and Materials Science, Fujian Normal University, Fujian, Fuzhou 350007 (China)], E-mail: rfliu@vip.sina.com

2008-12-20

Based on the principles of biomineralization, flakelike hydroxyapatite/chondroitin sulfate composites were synthesized through biomimetic method using Ca(NO{sub 3}){sub 2}.4H{sub 2}O and (NH{sub 4}){sub 3}PO{sub 4}.3H{sub 2}O as reagents and chondroitin sulfate as template. The crystalline phase, microstructure, chemical composition, morphology and thermal behavior of the composites obtained in the experiment were characterized by means of X-ray diffraction (XRD), Fourier transform infrared spectroscope (FTIR), transmission electron microscope (TEM), Thermogravimetry-Differential thermal analyzer (TG-DTA) and Elemental analyzer, respectively. The interaction between the functional groups of ChS and HA was investigated by electrical conductivity and UV-vis spectrum. The results demonstrate that the as-prepared powders with small amount of carbonate have the component similar to human bone. It can be concluded that the nucleation and growth of HA crystals occurred through the chemical interactions between the HA crystals and preorganized functional groups of the ChS template. Furthermore, the concentration of ChS significantly affects the morphology of the composites. Short fiberlike crystals could be obtained at a low concentration of ChS, but flakelike crystals could be synthesized using a high concentration ({>=}0.5 wt%) of ChS as template.

FUZZY LOGIC BASED ENERGY EFFICIENT PROTOCOL IN WIRELESS SENSOR NETWORKS

Directory of Open Access Journals (Sweden)

Zhan Wei Siew

2012-12-01

Full Text Available Wireless sensor networks (WSNs have been vastly developed due to the advances in microelectromechanical systems (MEMS using WSN to study and monitor the environments towards climates changes. In environmental monitoring, sensors are randomly deployed over the interest area to periodically sense the physical environments for a few months or even a year. Therefore, to prolong the network lifetime with limited battery capacity becomes a challenging issue. Low energy adaptive cluster hierarchical (LEACH is the common clustering protocol that aim to reduce the energy consumption by rotating the heavy workload cluster heads (CHs. The CHs election in LEACH is based on probability model which will lead to inefficient in energy consumption due to least desired CHs location in the network. In WSNs, the CHs location can directly influence the network energy consumption and further affect the network lifetime. In this paper, factors which will affect the network lifetime will be presented and the demonstration of fuzzy logic based CH selection conducted in base station (BS will also be carried out. To select suitable CHs that will prolong the network first node dies (FND round and consistent throughput to the BS, energy level and distance to the BS are selected as fuzzy inputs.

Geographic Variation in Household and Catastrophic Health Spending in India: Assessing the Relative Importance of Villages, Districts, and States, 2011-2012.

Science.gov (United States)

Mohanty, Sanjay K; Kim, Rockli; Khan, Pijush Kanti; Subramanian, S V

2018-03-01

Policy Points: Per-capita household health spending was higher in economically developed states and was associated with ability to pay, but catastrophic health spending (CHS) was equally high in both poorer and more developed states in India. Based on multilevel modeling, we found that the largest geographic variation in health spending and CHS was at the state and village levels, reflecting wide inequality in the accessibility to and cost of health care at these levels. Contextual factors at macro and micro political units are important to reduce health spending and CHS in India. In India, health care is a local good, and households are the major source of financing it. Earlier studies have examined diverse determinants of health care spending, but no attempt has been made to understand the geographical variation in household and catastrophic health spending. We used multilevel modeling to assess the relative importance of villages, districts, and states to health spending in India. We used data on the health expenditures of 101,576 households collected in the consumption expenditure schedule (68th round) carried out by the National Sample Survey in 2011-2012. We examined 4 dependent variables: per-capita health spending (PHS), per-capita institutional health spending (PIHS), per-capita noninstitutional health spending (PNHS), and catastrophic health spending (CHS). CHS was defined as household health spending exceeding 40% of its capacity to pay. We used multilevel linear regression and logistic models to decompose the variation in each outcome by state, region, district, village, and household levels. The average PHS was 1,331 Indian rupees (INR), which varied by state-level economic development. About one-fourth of Indian households incurred CHS, which was equally high in both the economically developed and poorer states. After controlling for household level factors, 77.1% of the total variation in PHS was attributable to households, 10.1% to states, 9.5% to

Molecular characterization of a stable antisense chalcone synthase phenotype in strawberry (Fragaria ananassa)

NARCIS (Netherlands)

Lunkenbein, S.; Coiner, H.; Vos, de C.H.; Schaart, J.G.; Boone, M.J.; Krens, F.A.; Schwab, W.; Salentijn, E.M.J.

2006-01-01

An octaploid (Fragaria × ananassa cv. Calypso) genotype of strawberry was transformed with an antisense chalcone synthase (CHS) gene construct using a ripening related CHS cDNA from Fragaria × ananassa cv. Elsanta under the control of the constitutive CaMV 35S promoter via Agrobacterium tumefaciens.

Investigation of a miRNA-Induced Gene Silencing Technique in Petunia Reveals Alterations in miR173 Precursor Processing and the Accumulation of Secondary siRNAs from Endogenous Genes.

Directory of Open Access Journals (Sweden)

Yao Han

Full Text Available MIGS (miRNA-induced gene silencing is a straightforward and efficient gene silencing technique in Arabidopsis. It works by exploiting miR173 to trigger the production of phasiRNAs (phased small interfering RNAs. MIGS can be used in plant species other than Arabidopsis by co-expression of miR173 and target gene fragments fused to an upstream miR173 target site. However, the efficiency and technical mechanisms have not been thoroughly investigated in other plants. In this work, two vectors, pMIGS-chs and pMIGS-pds, were constructed and transformed into petunia plants. The transgenic plants showed CHS (chalcone synthase and PDS (phytoene desaturase gene-silencing phenotypes respectively, indicating that MIGS functions in petunia. MIGS-chs plants were used to investigate the mechanisms of this technique in petunia. Results of 5'- RACE showed that the miR173 target site was cleaved at the expected position and that endogenous CHS genes were cut at multiple positions. Small RNA deep sequencing analysis showed that the processing of Arabidopsis miR173 precursors in MIGS-chs transgenic petunia plants did not occur in exactly the same way as in Arabidopsis, suggesting differences in the machinery of miRNA processing between plant species. Small RNAs in-phase with the miR173 cleavage register were produced immediately downstream from the cleavage site and out-of-phase small RNAs were accumulated at relatively high levels from processing cycle 5 onwards. Secondary siRNAs were generated from multiple sites of endogenous CHS-A and CHS-J genes, indicating that miR173 cleavage induced siRNAs have the same ability to initiate siRNA transitivity as the siRNAs functioning in co-suppression and hpRNA silencing. On account of the simplicity of vector construction and the transitive amplification of signals from endogenous transcripts, MIGS is a good alternative gene silencing method for plants, especially for silencing a cluster of homologous genes with redundant

Idiopathic pulmonary fibrosis with coexisting emphysema : high-resolution CT and clinical correlation

Energy Technology Data Exchange (ETDEWEB)

Kang, Eun Young; Kim, Kyeong Ah; Oh, Yu Whan; Shim, Jae Jeong; Kang, Kyung Ho [Korea Univ. College of Medicine, Seoul (Korea, Republic of)

1997-05-01

To correlate high-resolution CT (HRCT) findings with smoking history and pulmonary function test (PFT) in patients with idiopathic pulmonary fibrosis (IPF) with or without coexisting emphsema. The study included 24 patients who had undergone HRCT and in whom IPF had been confirmed pathologically (n=7) and clinically (n=17). The patients included 19 men and 5 women aged between from 44 and 78(mean 59) years. HRCT findings were reviewed by two radiologists and assessed for the presence and extent of emphysema (CT emphysema score;CES) and honeycombing (CT honeycombing score;CHS). CES and CHS were retrospectively correlated with smoking status and pulmonary function test. Evidence of emphysema was seen on HRCT in 20 fo 24 patients with IPF (83%). CES was 14.3 and CHS was 18.1 in smokers with IPF, as compared with 1.8 and 6.7 in nonsmokers (p<0.01). Pulmonary function tests showed lower percent predicted FEVI (69.3%), FVC (64.7%), TLC (73.7%), and RV (77.3%), a lower percent predicted diffusing capacity of carbon monoxide (58.2%), and normal FEVI/FVC (99.1%). The pulmonary function test in smokers showed higher TLC and RV than in nonsmokers. Eight of nine patients whose CES was higher than their CHS, an seen on HRCT, were smokers and had a smoking history of 33.1 pack-years. Seven of 15 whose CHS was higher than their CES were smokers and had a smoking history of 16.8 pack-years. In patients with a higher CES than CHS pulmonary function test results showed normal TLC(85%) and RV(100.7%); this contrasted with decreased TLC(72%) and RV (68%) in patients whose CHS was higher than their CES. Emphysema is a frequently associated finding in patients with IPF, as seen on HRCT, and emphysema is more frequent and extensive in smokers with IPF than non-smokers. HRCT is useful for detecting emphysema in patients with IPF, and the extent of emphysema on HRCT correlates with the results of the pulmonary function test and smoking status.

Idiopathic pulmonary fibrosis with coexisting emphysema : high-resolution CT and clinical correlation

International Nuclear Information System (INIS)

Kang, Eun Young; Kim, Kyeong Ah; Oh, Yu Whan; Shim, Jae Jeong; Kang, Kyung Ho

1997-01-01

To correlate high-resolution CT (HRCT) findings with smoking history and pulmonary function test (PFT) in patients with idiopathic pulmonary fibrosis (IPF) with or without coexisting emphsema. The study included 24 patients who had undergone HRCT and in whom IPF had been confirmed pathologically (n=7) and clinically (n=17). The patients included 19 men and 5 women aged between from 44 and 78(mean 59) years. HRCT findings were reviewed by two radiologists and assessed for the presence and extent of emphysema (CT emphysema score;CES) and honeycombing (CT honeycombing score;CHS). CES and CHS were retrospectively correlated with smoking status and pulmonary function test. Evidence of emphysema was seen on HRCT in 20 fo 24 patients with IPF (83%). CES was 14.3 and CHS was 18.1 in smokers with IPF, as compared with 1.8 and 6.7 in nonsmokers (p<0.01). Pulmonary function tests showed lower percent predicted FEVI (69.3%), FVC (64.7%), TLC (73.7%), and RV (77.3%), a lower percent predicted diffusing capacity of carbon monoxide (58.2%), and normal FEVI/FVC (99.1%). The pulmonary function test in smokers showed higher TLC and RV than in nonsmokers. Eight of nine patients whose CES was higher than their CHS, an seen on HRCT, were smokers and had a smoking history of 33.1 pack-years. Seven of 15 whose CHS was higher than their CES were smokers and had a smoking history of 16.8 pack-years. In patients with a higher CES than CHS pulmonary function test results showed normal TLC(85%) and RV(100.7%); this contrasted with decreased TLC(72%) and RV (68%) in patients whose CHS was higher than their CES. Emphysema is a frequently associated finding in patients with IPF, as seen on HRCT, and emphysema is more frequent and extensive in smokers with IPF than non-smokers. HRCT is useful for detecting emphysema in patients with IPF, and the extent of emphysema on HRCT correlates with the results of the pulmonary function test and smoking status

Investigation of a miRNA-Induced Gene Silencing Technique in Petunia Reveals Alterations in miR173 Precursor Processing and the Accumulation of Secondary siRNAs from Endogenous Genes.

Science.gov (United States)

Han, Yao; Zhang, Bin; Qin, Xiaoting; Li, Mingyang; Guo, Yulong

2015-01-01

MIGS (miRNA-induced gene silencing) is a straightforward and efficient gene silencing technique in Arabidopsis. It works by exploiting miR173 to trigger the production of phasiRNAs (phased small interfering RNAs). MIGS can be used in plant species other than Arabidopsis by co-expression of miR173 and target gene fragments fused to an upstream miR173 target site. However, the efficiency and technical mechanisms have not been thoroughly investigated in other plants. In this work, two vectors, pMIGS-chs and pMIGS-pds, were constructed and transformed into petunia plants. The transgenic plants showed CHS (chalcone synthase) and PDS (phytoene desaturase) gene-silencing phenotypes respectively, indicating that MIGS functions in petunia. MIGS-chs plants were used to investigate the mechanisms of this technique in petunia. Results of 5'- RACE showed that the miR173 target site was cleaved at the expected position and that endogenous CHS genes were cut at multiple positions. Small RNA deep sequencing analysis showed that the processing of Arabidopsis miR173 precursors in MIGS-chs transgenic petunia plants did not occur in exactly the same way as in Arabidopsis, suggesting differences in the machinery of miRNA processing between plant species. Small RNAs in-phase with the miR173 cleavage register were produced immediately downstream from the cleavage site and out-of-phase small RNAs were accumulated at relatively high levels from processing cycle 5 onwards. Secondary siRNAs were generated from multiple sites of endogenous CHS-A and CHS-J genes, indicating that miR173 cleavage induced siRNAs have the same ability to initiate siRNA transitivity as the siRNAs functioning in co-suppression and hpRNA silencing. On account of the simplicity of vector construction and the transitive amplification of signals from endogenous transcripts, MIGS is a good alternative gene silencing method for plants, especially for silencing a cluster of homologous genes with redundant functions.

Comparative study of early liquid resuscitation in controlled and uncontrolled hemorrhagic shock

Directory of Open Access Journals (Sweden)

He-ming YANG

2012-01-01

Full Text Available Objective  To compare the effects of routine liquid resuscitation on hemorrhagic shock in uncontrolled and controlled states for exploring the strategy of liquid resuscitation. Methods  Twenty-eight healthy male SD rats were randomly divided into three groups: control (n=8, controlled hemorrhagic shock (CHS, n=10, and uncontrolled hemorrhagic shock (UHS, n=10. In the CHS and UHS groups, the rats were made to bleed from the femoral artery till the blood pressure declined to 30 mmHg within 15 minutes. Thereafter, the roots of the rat tails in the three groups were cut. The trunks of the tails were ligated to stop the bleeding in the control and CHS groups, but it was not ligated in the UHS group, and no treatment was given. Imitating war condition, the animals were divided into three phases: pre-hospital period (30–90 minutes, hospital period (90–150 minutes, and recovery period (150 minutes to 72 hours. The blood pressure was maintained at 60mmHg in the pre-hospital period by transfusion. The bleeding point was ligated in the hospital period, and the blood pressure was maintained at 90mmHg by blood and fluid transfusions. In the recovery period, the observation time was maintained up to 72 hours. The mean arterial pressure (MAP, central venous pressure (CVP, heart function, blood gas analysis, hematocrit, and blood lactic acid were determined. The amount of bleeding, quantity of infusions, and survival time of animals were observed and recorded. Results  Based on the design of the experiment, the MAP of rats in the CHS and UHS groups was maintained at 60mmHg and 90mmHg in the pre-hospital period and hospital period by liquid resuscitation, respectively. There was no significant difference in the MAP and CVP between the CHS and UHS groups. However, the hematocrit of the rats in the UHS group in the pre-hospital period was clearly lower than that in the CHS group. Starting from the pre-hospital period, blood lactic acid content increased

Theory of anomalous transport in toroidal helical plasmas

International Nuclear Information System (INIS)

Itoh, K.; Itoh, S.; Fukuyama, A.

1992-03-01

Theoretical model of the anomalous transport in Torsatron/Heliotron plasmas is developed, based on the current-diffusive interchange instability which is destabilized due to the averaged magnetic hill near edge. Analytic formula of transport coefficient is derived. This model explains the high edge transport, the power degradation and energy confinement scaling law and the enhanced heat-pulse thermal conduction. (author)

Progress in modular-stellarator fusion-power-reactor conceptual designs

International Nuclear Information System (INIS)

Sviatoslavsky, I.N.; Van Sciver, S.W.; Kulcinski, G.L.

1982-01-01

Recent encouraging experimental results on stellarators/torsatrons/heliotrons (S/T/H) have revived interest in these concepts as possible fusion power reactors. The use of modular coils to generate the stellarator topology has added impetus to this renewed interest. Studies of the modular coil approach to stellarators by UW-Madison and Los Alamos National Laboratory are summarized in this paper

Poloidal rotation velocity measurement in toroidal plasmas via microwave reflectometry

International Nuclear Information System (INIS)

Pavlichenko, O.S.; Skibenko, A.I.; Fomin, I.P.; Pinos, I.B.; Ocheretenko, V.L.; Berezhniy, V.L.

2001-01-01

Results of experiment modeling backscattering of microwaves from rotating plasma layer perturbed by fluctuations are presented. It was shown that auto- and crosscorrelation of reflected power have a periodicity equal to rotation period. Such periodicity was observed by microwave reflectometry in experiments on RF plasma production on U-3M torsatron and was used for measurement of plasma poloidal rotation velocity. (author)

Novel method of aligning ATF-1 coils

International Nuclear Information System (INIS)

Rome, J.A.; Harris, J.H.; Neilson, G.H.; Jernigan, T.C.

1983-08-01

The coils for the Advanced Toroidal Facility (ATF-1) torsatron may be easily aligned before the machine is placed under vacuum. This is done by creating nulls in the magnetic field by energizing the coils in various configurations. All of the nulls in vertical bar B vector vertical bar occur on the z-axis. When the nulls coincide, the coils are properly aligned

Target enzyme mutations are the molecular basis for resistance towards pharmacological inhibition of nicotinamide phosphoribosyltransferase

DEFF Research Database (Denmark)

Olesen, Uffe H; Petersen, Jakob G; Garten, Antje

2010-01-01

CHS-828 and TP201565 as competitive inhibitors of NAMPT through docking studies and by NAMPT precipitation from cellular lysate by an analogue of TP201565 linked to sepharose. The NAMPT precipitation could be inhibited by addition of APO866. CONCLUSION: We found that CHS-828 and TP201565...

Lack of TAK1 in dendritic cells inhibits the contact hypersensitivity response induced by trichloroethylene in local lymph node assay.

Science.gov (United States)

Yao, Pan; Hongqian, Chu; Qinghe, Meng; Lanqin, Shang; Jianjun, Jiang; Xiaohua, Yang; Xuetao, Wei; Weidong, Hao

2016-09-15

Trichloroethylene (TCE) is a ubiquitous environmental contaminant. Occupational TCE exposure has been associated with severe, generalized contact hypersensitivity (CHS) skin disorder. The development of CHS depends on innate and adaptive immune functions. Transforming growth factor-β activated kinase-1 (TAK1) controls the survival of dendritic cells (DCs) that affect the immune system homeostasis. We aimed to investigate the role of TAK1 activity in DC on TCE-induced CHS response. Control mice and DC-specific TAK1 deletion mice were treated with 80% (v/v) TCE using local lymph node assay (LLNA) to establish a TCE-induced CHS model. The draining lymph nodes (DLNs) were excised and the lymphocytes were measure for proliferation by BrdU-ELISA, T-cell phenotype analysis by flow cytometry and signaling pathway activation by western blot. The ears were harvested for histopathological analysis. Control mice in the 80% TCE group displayed an inflammatory response in the ears, increased lymphocyte proliferation, elevated regulatory T-cell and activated T-cell percentages, and more IFN-γ producing CD8(+) T cells in DLNs. In contrast to control mice, DC-specific TAK1 deletion mice in the 80% TCE group showed an abolished CHS response and this was associated with defective T-cell expansion, activation and IFN-γ production. This effect may occur through Jnk and NF-κB signaling pathways. Overall, this study demonstrates a pivotal role of TAK1 in DCs in controlling TCE-induced CHS response and suggests that targeting TAK1 function in DCs may be a viable approach to preventing and treating TCE-related occupational health hazards. Copyright © 2016 Elsevier Inc. All rights reserved.

Effect of gene-targeted mutation in TNF receptor (p55) on contact hypersensitivity and ultraviolet B-induced immunosuppression

Energy Technology Data Exchange (ETDEWEB)

Kondo, Seiji; Wang, Binghe; Fujisawa, Hiroshi [Univ. of Toronto, Ontario (Canada)] [and others

1995-10-15

Tumor necrosis factor {alpha} (TNF-{alpha}) is a pleiotropic proinflammatory cytokine. TNF-{alpha} has been implicated in the pathogenesis of delayed-type hypersensitivity reactions such as allergic contact hypersensitivity and has been suggested as a mediator of ultraviolet B (UVB)-induced immunosuppression. Conflicting reports, however, exist concerning the effects of TNF-{alpha} on contact hypersensitivity (CHS). To determine the role of TNF-{alpha} in the generation and regulation of CHS, gene-targeted mutant mice lacking TNF-receptor (p55) gene (TNF-R1(-) mice) were treated with dinitrofluorobenzene (DNFB) to induce CHS. TNF-R1(-) mice showed significant hyperresponsiveness in CHS (152.8 {+-} 20.9%, p < 0.025) compared with normal syngeneic mice (C57BL/6) assessed by ear swelling. To determine whether UVB can induce suppression in TNF-R1(-) mice, mice were irradiated on the shaved abdomen with 96 ml/cm{sup 2} UVB and 3 days later they were painted with 0.5% DNFB (sensitization dose), followed 5 days later with 0.2% DNFB to the left ear (challenge dose). Significant suppression of CHS was observed both locally (sensitization on irradiated site) and systemically (sensitization on unirradiated site) in UVB-irradiated TNF-R1(-) mice as well as in normal mice. To rule out possible signaling through p75 TNF-R, the mice were treated with anti-TNF-{alpha} Ab (V1q), which can neutralize any TNF effects through either receptor. V1q had no effect on these phenomena observed in TNF-R1(-) mice. These results suggest that TNF-{alpha} plays a regulatory role in CHS but is not required to induce UVB-mediated immunosuppression. 45 refs., 5 figs.

The Longitudinal Evolution of Equatorial Coronal Holes

Science.gov (United States)

Krista, Larisza D.; McIntosh, Scott W.; Leamon, Robert J.

2018-04-01

In 2011, three satellites—the Solar-Terrestrial RElations Observatory A & B, and the Solar Dynamics Observatory (SDO)—were in a unique spatial alignment that allowed a 360° view of the Sun. This alignment lasted until 2014, the peak of solar cycle 24. Using extreme ultraviolet images and Hovmöller diagrams, we studied the lifetimes and propagation characteristics of coronal holes (CHs) in longitude over several solar rotations. Our initial results show at least three distinct populations of “low-latitude” or “equatorial” CHs (below 65^\\circ latitude). One population rotates in retrograde direction and coincides with a group of long-lived (over sixty days) CHs in each hemisphere. These are typically located between 30° and 55^\\circ , and display velocities of ∼55 m s‑1 slower than the local differential rotation rate. A second, smaller population of CHs rotate prograde, with velocities between ∼20 and 45 m s‑1. This population is also long-lived, but observed ±10° from the solar equator. A third population of CHs are short-lived (less than two solar rotations), and they appear over a wide range of latitudes (±65°) and exhibit velocities between ‑140 and 80 m s‑1. The CH “butterfly diagram” we developed shows a systematic evolution of the longer-lived holes; however, the sample is too short in time to draw conclusions about possible connections to dynamo-related phenomena. An extension of the present work to the 22 years of the combined SOHO–SDO archives is necessary to understand the contribution of CHs to the decadal-scale evolution of the Sun.

Prevalência dos riscos cardiovasculares em escolares e adolescentes obesos acompanhados no ambulatório de endocrinologia pediátrica do Conjunto Hospitalar de Sorocaba (CHS

Directory of Open Access Journals (Sweden)

Karlla Karollynna de Fátima Gaiotto

2015-10-01

Full Text Available Crianças e adolescentes obesos têm alto risco de desenvolver doençascardiovasculares na idade adulta. Assim, a detecção de fatores de risco e educaçãodos pacientes na infância é de extrema importância para o prognóstico, já que nesseperíodo a mudança dos hábitos de vida demonstra grande redução na incidência egravidade de doenças cardíacas. Desta forma, o objetivo do projeto foi avaliarrepercussões metabólicas associadas à obesidade nos pacientes atendidos noambulatório de endocrinologia pediátrica do CHS e seu impacto nos riscoscardiovasculares. Para isto foi realizada a análise do perfil bioquímico,antropométrico e níveis pressóricos de escolares e adolescentes obesos com idadeentre 07 e 18 anos no período de agosto de 2014 a maio de 2015 e calculada aprevalência para cada variável analisada. Dos 49 pacientes, 57,1% nasceram compeso adequado, 46,9% praticam atividade física insuficiente, 42,9% apresentamobesidade na família, 59,1% apresentam parentes obesos com algumacomorbidade, 81,3% se encaixam no percentil acima de 99 para o IMC, 90,55%apresentam circunferência de cintura acima de 71 cm, 44,1% foram consideradoshipertensos, 20,4% apresentaram alterações no perfil glicêmico, 34,7% possuemcolesterol total aumentado, 59,2% estão com HDL inferior ao desejável, 40,9%estão com níveis alterados de LDL, 49% apresentaram valores de VLDL elevado e30,6% apresentaram triglicérides aumentados. A análise dos dados deste estudopermite inferir que o IMC, pressão arterial, circunferência abdominal, colesterol total,HDL colesterol e triglicérides são aqueles cujos valores são mais expressivos, demonstrando as consequências diretas da obesidade no aumento do risco deeventos cardiovasculares futuros.

Function Model for Community Health Service Information

Science.gov (United States)

Yang, Peng; Pan, Feng; Liu, Danhong; Xu, Yongyong

In order to construct a function model of community health service (CHS) information for development of CHS information management system, Integration Definition for Function Modeling (IDEF0), an IEEE standard which is extended from Structured Analysis and Design(SADT) and now is a widely used function modeling method, was used to classifying its information from top to bottom. The contents of every level of the model were described and coded. Then function model for CHS information, which includes 4 super-classes, 15 classes and 28 sub-classed of business function, 43 business processes and 168 business activities, was established. This model can facilitate information management system development and workflow refinement.

Art and experience

NARCIS (Netherlands)

Gerwen, R.C.H.M. van

1996-01-01

This three-part dissertation is on the double role of experience in art: as a subject matter, and as the vehicle for our evaluations. It argues (Part three, Chs. 7, 8) for the inclusion within contemporary analytical ‘cognitivism’ (Part one, Chs. 1-3) of certain arguments from the founding fathers

Sensitivity to Sunburn Is Associated with Susceptibility to Ultraviolet Radiation–Induced Suppression of Cutaneous Cell–Mediated Immunity

Science.gov (United States)

Kelly, Deirdre A.; Young, Antony R.; McGregor, Jane M.; Seed, Paul T.; Potten, Christopher S.; Walker, Susan L.

2000-01-01

Skin cancer incidence is highest in white-skinned people. Within this group, skin types I/II (sun sensitive/tan poorly) are at greater risk than skin types III/IV (sun tolerant/tan well). Studies in mice demonstrate that ultraviolet radiation (UVR)-induced suppression of cell-mediated immune function plays an important role in the development of skin cancer and induces a susceptibility to infectious disease. A similar role is suspected in humans, but we lack quantitative human data to make risk assessments of ambient solar exposure on human health. This study demonstrates that ambient levels of solar UVR, typically experienced within 1 h of exposure to noonday summer sunlight, can suppress contact hypersensitivity (CHS) responses in healthy white-skinned humans in vivo (n = 93). There was a linear relationship between increase in erythema and suppression of CHS (P sunburn (two minimal erythema doses [2 MED]) was sufficient to suppress CHS in all volunteers by 93%. However, a single suberythemal exposure of either 0.25 or 0.5 MED suppressed CHS responses by 50 and 80%, respectively, in skin types I/II, whereas 1 MED only suppressed CHS by 40% in skin types III/IV. The two- to threefold greater sensitivity of skin types I/II for a given level of sunburn may play a role in their greater sensitivity to skin cancer. PMID:10662801

Timely Endocytosis of Cytokinetic Enzymes Prevents Premature Spindle Breakage during Mitotic Exit.

Directory of Open Access Journals (Sweden)

Cheen Fei Chin

2016-07-01

Full Text Available Cytokinesis requires the spatio-temporal coordination of membrane deposition and primary septum (PS formation at the division site to drive acto-myosin ring (AMR constriction. It has been demonstrated that AMR constriction invariably occurs only after the mitotic spindle disassembly. It has also been established that Chitin Synthase II (Chs2p neck localization precedes mitotic spindle disassembly during mitotic exit. As AMR constriction depends upon PS formation, the question arises as to how chitin deposition is regulated so as to prevent premature AMR constriction and mitotic spindle breakage. In this study, we propose that cells regulate the coordination between spindle disassembly and AMR constriction via timely endocytosis of cytokinetic enzymes, Chs2p, Chs3p, and Fks1p. Inhibition of endocytosis leads to over accumulation of cytokinetic enzymes during mitotic exit, which accelerates the constriction of the AMR, and causes spindle breakage that eventually could contribute to monopolar spindle formation in the subsequent round of cell division. Intriguingly, the mitotic spindle breakage observed in endocytosis mutants can be rescued either by deleting or inhibiting the activities of, CHS2, CHS3 and FKS1, which are involved in septum formation. The findings from our study highlight the importance of timely endocytosis of cytokinetic enzymes at the division site in safeguarding mitotic spindle integrity during mitotic exit.

Cloning and sequence analysis of chitin synthase gene fragments of Demodex mites.

Science.gov (United States)

Zhao, Ya-e; Wang, Zheng-hang; Xu, Yang; Xu, Ji-ru; Liu, Wen-yan; Wei, Meng; Wang, Chu-ying

2012-10-01

To our knowledge, few reports on Demodex studied at the molecular level are available at present. In this study our group, for the first time, cloned, sequenced and analyzed the chitin synthase (CHS) gene fragments of Demodex folliculorum, Demodex brevis, and Demodex canis (three isolates from each species) from Xi'an China, by designing specific primers based on the only partial sequence of the CHS gene of D. canis from Japan, retrieved from GenBank. Results show that amplification was successful only in three D. canis isolates and one D. brevis isolate out of the nine Demodex isolates. The obtained fragments were sequenced to be 339 bp for D. canis and 338 bp for D. brevis. The CHS gene sequence similarities between the three Xi'an D. canis isolates and one Japanese D. canis isolate ranged from 99.7% to 100.0%, and those between four D. canis isolates and one D. brevis isolate were 99.1%-99.4%. Phylogenetic trees based on maximum parsimony (MP) and maximum likelihood (ML) methods shared the same clusters, according with the traditional classification. Two open reading frames (ORFs) were identified in each CHS gene sequenced, and their corresponding amino acid sequences were located at the catalytic domain. The relatively conserved sequences could be deduced to be a CHS class A gene, which is associated with chitin synthesis in the integument of Demodex mites.

In situ localization of chalcone synthase mRNA in pea root nodule development.

NARCIS (Netherlands)

Yang, W.C.; Canter Cremers, H.C.J.; Hogendijk, P.; Katinakis, P.; Wijffelman, C.A.; Franssen, H.J.; Kammen, van A.; Bisseling, T.

1992-01-01

In this paper studies on the role of flavonoids in pea root nodule development are reported. Flavonoid synthesis was followed by localizing chalcone synthase (CHS) mRNA in infected pea roots and in root nodules. In a nodule primordium, CHS mRNA is present in all cells of the primordium. Therefore it

IL-1β-Dependent Activation of Dendritic Epidermal T Cells in Contact Hypersensitivity

DEFF Research Database (Denmark)

Nielsen, Morten M; Lovato, Paola; Macleod, Amanda S

2014-01-01

Substances that penetrate the skin surface can act as allergens and induce a T cell-mediated inflammatory skin disease called contact hypersensitivity (CHS). IL-17 is a key cytokine in CHS and was originally thought to be produced solely by CD4(+) T cells. However, it is now known that several cell...

Metabolic engineering of the morphology of Aspergillus oryzae by altering chitin synthesis

DEFF Research Database (Denmark)

Muller, C.; Mcintyre, Mhairi; Hansen, Kim

2002-01-01

Morphology and alpha-amylase production during submerged cultivation were examined in a wild-type strain (A1560) and in strains of Aspergillus oryzae in which chitin synthase B (chsB) and chitin synthesis myosin A (csmA) have been disrupted (ChsB/G and CM101). In a flowthrough cell, the growth...

Purinergic responses of chondrogenic stem cells to dynamic loading

Directory of Open Access Journals (Sweden)

Gađanski Ivana

2013-01-01

Full Text Available In habitually loaded tissues, dynamic loading can trigger ATP (adenosine 5’- triphosphate release to extracellular environment, and result in calcium signaling via ATP binding to purine P2 receptors1. In the current study we have compared purinergic responses (ATP release of two types of cells: bovine chondrocytes (bCHs and human mesenchymal stem cells (hMSC that were encapsulated in agarose and subjected to dynamic loading. Both cell types were cultured under chondrogenic conditions, and their responses to loading were evaluated by ATP release assay in combination with connexin (Cx-sensitive fluorescent dye (Lucifer Yellow - LY and a Cx-hemichannel blocker (Flufenamic acid - FFA. In response to dynamic loading, chondrogenic hMSCs released significantly higher amounts of ATP (5-fold in comparison to the bCHs early in culture (day 2. Triggering of LY uptake in the bCHs and hMSCs by dynamic loading implies opening of the Cx-hemichannels. However, the number of LY-positive cells in hMSC-constructs was 2.5-fold lower compared to the loaded bCH-constructs, suggesting utilization of additional mechanisms of ATP release. Cx-reactive sites were detected in both bCHs and hMSCs-constructs. FFA application led to reduced ATP release both in bCHs and hMSCs, which confirms the involvement of connexin hemichannels, with more prominent effects in bCHs than in hMSCs, further implying the existence of additional mechanism of ATP release in chondrogenic hMSCs. Taken together, these results indicate stronger purinergic response to dynamic loading of chondrogenic hMSCs than primary chondrocytes, by activation of connexin hemichannels and additional mechanisms of ATP release. [Projekat Ministrastva nauke Republike Srbije, ON174028 i br. III41007

A Cooperative Harmony Search Algorithm for Function Optimization

Directory of Open Access Journals (Sweden)

Gang Li

2014-01-01

Full Text Available Harmony search algorithm (HS is a new metaheuristic algorithm which is inspired by a process involving musical improvisation. HS is a stochastic optimization technique that is similar to genetic algorithms (GAs and particle swarm optimizers (PSOs. It has been widely applied in order to solve many complex optimization problems, including continuous and discrete problems, such as structure design, and function optimization. A cooperative harmony search algorithm (CHS is developed in this paper, with cooperative behavior being employed as a significant improvement to the performance of the original algorithm. Standard HS just uses one harmony memory and all the variables of the object function are improvised within the harmony memory, while the proposed algorithm CHS uses multiple harmony memories, so that each harmony memory can optimize different components of the solution vector. The CHS was then applied to function optimization problems. The results of the experiment show that CHS is capable of finding better solutions when compared to HS and a number of other algorithms, especially in high-dimensional problems.

Improvement of skin condition by oral administration of collagen hydrolysates in chronologically aged mice.

Science.gov (United States)

Wang, Zhenbin; Wang, Qing; Wang, Lin; Xu, Weidong; He, Yuanqing; Li, Yunliang; He, Song; Ma, Haile

2017-07-01

Collagen hydrolysates (CHs) have been demonstrated to have positive effects on skin photoaging by topical application or oral ingestion. However, there has been little research on their influence on skin chronological aging. In this study, 9-month-old female ICR mice were given normal AIN-93M diets containing CHs (2.5, 5 and 10% w/w) from Nile tilapia scale. After 6 months, the collagen content and antioxidant enzyme (superoxide dismutase and glutathione peroxidase) activities increased significantly (P skin did not change (P > 0.05). The color, luster and quantity of hair were obviously ameliorated. Moreover, the structure of epidermis and dermis, the density and distribution of collagen fibers and the ratio of type I to type III collagen were improved in a dose-dependent manner as shown by histochemical staining. Oral ingestion of CHs increased the collagen content and antioxidant enzyme activities and improved the appearance and structure of skin. These results suggest the potential of CHs as an anti-skin-aging ingredient in nutraceuticals or functional foods. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Oral rehabilitation of patients with Chediak-Higashi syndrome using zygoma and root form implant-supported fixed prostheses: A report of two patients.

Science.gov (United States)

Alzoubi, Fawaz; Bedrossian, Edmond; Wong, Allen

2016-12-01

Chediak-Higashi syndrome (CH-S) is a rare genetic immunodeficiency disorder. Fewer than 500 individuals with CH-S have been reported worldwide in the past 20 years. The dental management of patients in whom CH-S has been diagnosed has been rarely reported and only in the form of a case report. All reports addressed the severe periodontal disease found in those patients, and most studies concluded that periodontal treatment had an unfavorable prognosis. As a result, complete edentulism at an early age because of severe periodontal disease is expected. The purpose of this report was to present 2 patients with CH-S seeking oral rehabilitation after early tooth loss and severe bone resorption as a manifestation of severe periodontal disease. The treatment used bilateral zygoma implants and an all-on-4 concept. The complications encountered and management with a 5-year post-surgery follow-up are also presented. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

Cloning and sequence analysis of chitin synthase gene fragments of Demodex mites*

Science.gov (United States)

Zhao, Ya-e; Wang, Zheng-hang; Xu, Yang; Xu, Ji-ru; Liu, Wen-yan; Wei, Meng; Wang, Chu-ying

2012-01-01

To our knowledge, few reports on Demodex studied at the molecular level are available at present. In this study our group, for the first time, cloned, sequenced and analyzed the chitin synthase (CHS) gene fragments of Demodex folliculorum, Demodex brevis, and Demodex canis (three isolates from each species) from Xi’an China, by designing specific primers based on the only partial sequence of the CHS gene of D. canis from Japan, retrieved from GenBank. Results show that amplification was successful only in three D. canis isolates and one D. brevis isolate out of the nine Demodex isolates. The obtained fragments were sequenced to be 339 bp for D. canis and 338 bp for D. brevis. The CHS gene sequence similarities between the three Xi’an D. canis isolates and one Japanese D. canis isolate ranged from 99.7% to 100.0%, and those between four D. canis isolates and one D. brevis isolate were 99.1%–99.4%. Phylogenetic trees based on maximum parsimony (MP) and maximum likelihood (ML) methods shared the same clusters, according with the traditional classification. Two open reading frames (ORFs) were identified in each CHS gene sequenced, and their corresponding amino acid sequences were located at the catalytic domain. The relatively conserved sequences could be deduced to be a CHS class A gene, which is associated with chitin synthesis in the integument of Demodex mites. PMID:23024043

FORMATION OF CORONAL HOLES ON THE ASHES OF ACTIVE REGIONS

International Nuclear Information System (INIS)

Karachik, Nina V.; Pevtsov, Alexei A.; Abramenko, Valentyna I.

2010-01-01

We investigate the formation of isolated non-polar coronal holes (CHs) on the remnants of decaying active regions (ARs) at the minimum/early ascending phase of sunspot activity. We follow the evolution of four bipolar ARs and measure several parameters of their magnetic fields including total flux, imbalance, and compactness. As regions decay, their leading and following polarities exhibit different dissipation rates: loose polarity tends to dissipate faster than compact polarity. As a consequence, we see a gradual increase in flux imbalance inside a dissipating bipolar region, and later a formation of a CH in place of more compact magnetic flux. Out of four cases studied in detail, two CHs had formed at the following polarity of the decaying bipolar AR, and two CHs had developed in place of the leading polarity field. All four CHs contain a significant fraction of magnetic field of their corresponding AR. Using potential field extrapolation, we show that the magnetic field lines of these CHs were closed on the polar CH at the North, which at the time of the events was in imbalance with the polar CH at the South. This topology suggests that the observed phenomenon may play an important role in transformation of toroidal magnetic field to poloidal field, which is a key step in transitioning from an old solar cycle to a new one. The timing of this observed transition may indicate the end of solar cycle 23 and the beginning of cycle 24.

"From resistance to challenge": child health service nurses experiences of how a course in group leadership affected their management of parental groups.

Science.gov (United States)

Lefèvre, Åsa; Lundqvist, Pia; Drevenhorn, Eva; Hallström, Inger

2017-01-01

All parents in Sweden are invited to child health service (CHS) parental groups, however only 49% of the families participate. The way the parental groups are managed has been shown to be of importance for how parents experience the support and CHS nurses describe feeling insecure when running the groups. Lack of facilitation, structure and leadership might jeopardise the potential benefit of such support groups. This study describes CHS nurses' experiences of how a course in group leadership affected the way they ran their parental groups. A course in group leadership given to 56 CHS nurses was evaluated in focus group interviews 5-8 months after the course. The nurses felt strengthened in their group leader role and changed their leadership methods. The management of parental groups was after the course perceived as an important work task and the nurses included time for planning, preparation and evaluation, which they felt improved their parental groups. Parental participation in the activities in the group had become a key issue and they used their new exercises and tools to increase this. They expressed feeling more confident and relaxed in their role as group leaders and felt that they could adapt their leadership to the needs of the parents. Specific training might strengthen the CHS nurses in their group leader role and give them new motivation to fulfil their work with parental groups.  Clinical Trials.gov ID: NCT02494128.

Chondrosarcoma of the femur with histology-imaging correlation of tumor growth--preliminary observations concerning periosteal new bone formation and soft tissue extension.

Science.gov (United States)

Steiner, German C; Schweitzer, Mark E; Kenan, Samuel; Abdelwahab, Ibrahim F

2011-01-01

The objective of this study was, in chondrosarcoma (CHS) of the femur, to evaluate by radiologic-pathologic correlation, the degree of tumor growth, cortical destruction, periosteal reaction, and soft tissue extension present. Eight cases of histologically proven CHS of the femur were studied. All cases were resected, evaluated histologically with coronal slabs, and compared with radiographs and magnetic resonance imaging (MRI) scans. In two resected specimens, the tumors were studied in more detail; along with coronal slabs, axial sections of the remaining anterior and posterior halves of both tumors were taken, and the bone specimens were X-rayed and examined histologically. CHS initially involved the medullary cavity and subsequently destroyed the cortex; first, by endosteal scalloping and, second, by subsequent invasion and destruction of the cortex. During this process, there was periosteal new bone formation (PNBF), with increased cortical thickness, the degree of which often correlated with the degree of cortical destruction. In the areas of cortical thickening of three cases, a "grey line" was seen on MRI that separated the cortex from the periosteal new bone; the line, in reality,is a space between the two structures. The presence of this line suggests that the tumor does not extend beyond the cortex. PNBF occurred in all cases and varied in thickness. It frequently developed independent of direct periosteal tumor involvement. The periosteum of one case contained porotic bone with interposed marrow fat, which was easily misinterpreted as tumor extension on MRI. Expansion and remodeling of the femoral diaphysis in CHS, with widening of the medullary cavity, is usually due to extensive cortical destruction with PNBF. Soft tissue extension was present in five cases and apparently occurred by two different mechanisms: direct tumor destruction of the cortex and periosteum, with extension into the soft tissues; and subtle MRI occult tumor permeation through the

Out-of-pocket expenditure and catastrophic health spending on maternal care in public and private health centres in India: a comparative study of pre and post national health mission period.

Science.gov (United States)

Mohanty, Sanjay K; Kastor, Anshul

2017-09-18

The National Health Mission (NHM), one of the largest publicly funded maternal health programs worldwide was initiated in 2005 to reduce maternal, neo-natal and infant mortality and out-of-pocket expenditure (OOPE) on maternal care in India. Though evidence suggests improvement in maternal and child health, little is known on the change in OOPE and catastrophic health spending (CHS) since the launch of NHM. The aim of this paper is to provide a comprehensive estimate of OOPE and CHS on maternal care by public and private health providers in pre and post NHM periods. The unit data from the 60th and 71st rounds of National Sample Survey (NSS) is used in the analyses. Descriptive statistics is used to understand the differentials in OOPE and CHS. The CHS is estimated based on capacity to pay, derived from household consumption expenditure, the subsistence expenditure (based on state specific poverty line) and household OOPE on maternal care. Data of both rounds are pooled to understand the impact of NHM on OOPE and CHS. The log-linear regression model and the logit regression models adjusted for state fixed effect, clustering and socio-economic and demographic correlates are used in the analyses. Women availing themselves of ante natal, natal and post natal care (all three maternal care services) from public health centres have increased from 11% in 2004 to 31% by 2014 while that from private health centres had increased from 12% to 20% during the same period. The mean OOPE on all three maternal care services from public health centres was US$60 in pre-NHM and US$86 in post-NHM periods while that from private health center was US$170 and US$300 during the same period. Controlling for socioeconomic and demographic correlates, the OOPE on delivery care from public health center had not shown any significant increase in post NHM period. The OOPE on delivery care in private health center had increased by 5.6 times compared to that from public health centers in pre NHM

2007-2008 Weapon Systems

Science.gov (United States)

2007-01-01

240 Tactical Operations Center ( TOC ) .......................................................................242 Tactical Unmanned Aerial...4QFY06: CHS-3 contract transferred from AMCOM Acq Ctr to CECOM Acq Ctr as a result of the PD CHS move from PM TOCs /AMDCCS to PM TRCS in FY06...SALES None CONTRACTORS IRB Bays manufacturer: General Dynamics Santa Barbara Sistemas (Kaiserslautern, Germany) Logistic support: AM General (Livonia, MI

An antithetic variate to facilitate upper-stem height measurements for critical height sampling with importance sampling

Science.gov (United States)

Thomas B. Lynch; Jeffrey H. Gove

2013-01-01

Critical height sampling (CHS) estimates cubic volume per unit area by multiplying the sum of critical heights measured on trees tallied in a horizontal point sample (HPS) by the HPS basal area factor. One of the barriers to practical application of CHS is the fact that trees near the field location of the point-sampling sample point have critical heights that occur...

Active trajectory control for a heavy ion beam probe on the compact helical system

International Nuclear Information System (INIS)

Fujisawa, A.; Iguchi, H.; Lee, S.; Crowley, T.P.; Hamada, Y.; Hidekuma, S.; Kojima, M.

1996-05-01

A 200 keV heavy ion beam probe (HIBP) on the Compact Helical System torsatron/heliotron uses a newly proposed method in order to control complicated beam trajectories in non-axisymmetrical devices. As a result, the HIBP has successfully measured potential profiles of the toroidal helical plasma. The article will describe the results of the potential profile measurements, together with the HIBP hardware system and procedures to realize the method. (author)

Relationships between field-based measures of strength and power and golf club head speed.

Science.gov (United States)

Read, Paul J; Lloyd, Rhodri S; De Ste Croix, Mark; Oliver, Jon L

2013-10-01

Increased golf club head speed (CHS) has been shown to result in greater driving distances and is also correlated with golf handicap. The purpose of this study was to investigate the relationships between field-based measures of strength and power and golf CHS with a secondary aim to determine the reliability of the selected tests. A correlation design was used to assess the following variables: anthropometrics, squat jump (SJ) height and squat jump peak power (SJPP), unilateral countermovement jump (CMJ) heights (right leg countermovement jump and left leg countermovement jump [LLCMJ]), bilateral CMJ heights, countermovement jump peak power (CMJPP), and medicine ball seated throw (MBST) and medicine ball rotational throw (MBRT). Fouty-eight male subjects participated in the study (age: 20.1 ± 3.2 years, height: 1.76 ± 0.07 m, mass: 72.8 ± 7.8 kg, handicap: 5.8 ± 2.2). Moderate significant correlations were reported between CHS and MBRT (r = 0.67; p golf athletes using the proposed battery of field tests. Additionally, movements that are more concentrically dominant in nature may display stronger relationships with CHS due to MBST and SJ displaying the highest explained variance after a stepwise linear regression.

Occurrence of triclosan in plasma of wild Atlantic bottlenose dolphins (Tursiops truncatus) and in their environment

Energy Technology Data Exchange (ETDEWEB)

Fair, Patricia A., E-mail: pat.fair@noaa.go [National Oceanic and Atmospheric Administration, National Ocean Services, Center for Coastal Environmental Health and Biomolecular Research, 219 Fort Johnson Road, Charleston, SC 29412-9110 (United States); Lee, H -B [Aquatic Ecosystem Protection Research Division, Environment Canada, 867 Lakeshore Road, Burlington, ON L7R 4A6 (Canada); Adams, Jeff [National Oceanic and Atmospheric Administration, National Ocean Services, Center for Coastal Environmental Health and Biomolecular Research, 219 Fort Johnson Road, Charleston, SC 29412-9110 (United States); Darling, Colin; Pacepavicius, Grazina; Alaee, Mehran [Aquatic Ecosystem Protection Research Division, Environment Canada, 867 Lakeshore Road, Burlington, ON L7R 4A6 (Canada); Bossart, Gregory D [Center for Coastal Research, Marine Mammal Research and Conservation Program, Harbor Branch Oceanographic Institute at Florida Atlantic University, 5600 U.S. 1 North, Ft. Pierce, FL 34946 (United States); Henry, Natasha [National Oceanic and Atmospheric Administration, National Ocean Services, Center for Coastal Environmental Health and Biomolecular Research, 219 Fort Johnson Road, Charleston, SC 29412-9110 (United States); Muir, Derek [Aquatic Ecosystem Protection Research Division, Environment Canada, 867 Lakeshore Road, Burlington, ON L7R 4A6 (Canada)

2009-08-15

The presence of triclosan, a widely-used antibacterial chemical, is currently unknown in higher trophic-level species such as marine mammals. Blood plasma collected from wild bottlenose dolphins (Tursiops truncatus) in Charleston, SC (CHS) (n = 13) and Indian River Lagoon, FL (IRL) (n = 13) in 2005 was analyzed for triclosan. Plasma concentrations in CHS dolphins ranged from 0.12 to 0.27 ng/g wet weight (mean 0.18 ng/g), with 31% of the sampled individuals having detectable triclosan. The mean IRL dolphin plasma concentrations were 0.072 ng/g wet weight (range 0.025-0.11 ng/g); 23% of the samples having detectable triclosan. In the CHS area, triclosan effluent values from two WWTP were both 190 ng/L and primary influents were 2800 ng/L and 3400 ng/L. Triclosan values in CHS estuarine surface water samples averaged 7.5 ng/L (n = 18) ranging from 4.9 to 14 ng/L. This is the first study to report bioaccumulation of anthropogenic triclosan in a marine mammal highlighting the need for further monitoring and assessment. - Triclosan in bottlenose dolphin plasma and their environment.

Occurrence of triclosan in plasma of wild Atlantic bottlenose dolphins (Tursiops truncatus) and in their environment

International Nuclear Information System (INIS)

Fair, Patricia A.; Lee, H.-B.; Adams, Jeff; Darling, Colin; Pacepavicius, Grazina; Alaee, Mehran; Bossart, Gregory D.; Henry, Natasha; Muir, Derek

2009-01-01

The presence of triclosan, a widely-used antibacterial chemical, is currently unknown in higher trophic-level species such as marine mammals. Blood plasma collected from wild bottlenose dolphins (Tursiops truncatus) in Charleston, SC (CHS) (n = 13) and Indian River Lagoon, FL (IRL) (n = 13) in 2005 was analyzed for triclosan. Plasma concentrations in CHS dolphins ranged from 0.12 to 0.27 ng/g wet weight (mean 0.18 ng/g), with 31% of the sampled individuals having detectable triclosan. The mean IRL dolphin plasma concentrations were 0.072 ng/g wet weight (range 0.025-0.11 ng/g); 23% of the samples having detectable triclosan. In the CHS area, triclosan effluent values from two WWTP were both 190 ng/L and primary influents were 2800 ng/L and 3400 ng/L. Triclosan values in CHS estuarine surface water samples averaged 7.5 ng/L (n = 18) ranging from 4.9 to 14 ng/L. This is the first study to report bioaccumulation of anthropogenic triclosan in a marine mammal highlighting the need for further monitoring and assessment. - Triclosan in bottlenose dolphin plasma and their environment.

[What determines the market shares of the health funds in Israeli localities?].

Science.gov (United States)

Shmueli, Amir; Engelcin-Nissan, Esti

2011-08-01

Four health funds operate nationally in Israel, but their local market shares vary dramatically across localities. To identify the main localities' characteristics which affect the size of the market shares of the various health funds. A total of 60 Localities with more than 20,000 inhabitants were chosen. The following Localities' characteristics were retrieved for the year 2004: the market shares of the four health funds, average income, standardized mortality ratio (SMR), periphery index, the age structure, the distance from the nearest general hospital, the share of Arab population, and size. Four market share equations were estimated using SURE (seemingly unrelated regressions estimation), allowing for inter-equation correlations. The results show that the market shares of the different health funds are affected by different factors. Clalit Health Services' (CHS) share increases with the distance from Tel Aviv and SMR, and decreases with the level of mean income and the distance from the nearest CHS hospital. Leumit's market share increases only with the distance from a CHS's hospital. The market share of Maccabi Healthcare Services is higher in central localities, Jewish localities, small cities and further away from a non-CHS hospital. Meuhedet's market share is higher in big cities, rich and healthy localities, and in Localities which are further away from CHS's hospitals. These findings indicate that the presence of the health funds in different Localities varies according to the Localities' characteristics. There appears to be a market segmentation and "specialization" of certain health funds in specific populations, and of the other health funds in the rest of the population.

Guanidino-containing drugs in cancer chemotherapy: biochemical and clinical pharmacology.

Science.gov (United States)

Ekelund, S; Nygren, P; Larsson, R

2001-05-15

The pharmacology and clinical application of three guanidino-containing compounds are reviewed in this commentary with special focus on a new member of this group of drugs, CHS 828 [N-(6-(4-chlorophenoxy)hexyl)-N'-cyano-N"-4-pyridylguanidine]. m-Iodobenzylguanidine (MIBG) and methylglyoxal bis(guanylhydrazone) (MGBG) have been extensively studied, preclinically as well as clinically, and have established use as anticancer agents. MIBG has structural similarities to the neurotransmitter, norepinephrine, and MGBG is a structural analog of the natural polyamine spermidine. CHS 828 is a pyridyl cyanoguanidine newly recognized as having cytotoxic effects when screening antihypertensive compounds. Apart from having the guanidino groups in common, there are many differences between these drugs in both structure and their mechanisms of action. However, they all inhibit mitochondrial function, a seemingly unique feature among chemotherapeutic drugs. In vitro in various cell lines and primary cultures of patient tumor cells and in vivo in various tumor models, CHS 828 has cytotoxic properties unlike any of the standard cytotoxic drugs with which it has been compared. Among these are non-cross-resistance to standard drugs and pronounced activity in tumor models acknowledged to be highly drug-resistant. Similar to MIBG, CHS 828 induces an early increase in extracellular acidification, due to stimulation of the glycolytic flux. Furthermore, ATP levels decrease, and the syntheses of DNA and protein are shut off after approximately 30 hr of exposure, indicating active cell death. CHS 828 is now in early clinical trials, the results of which are eagerly awaited.

Pannexin channels mediate the acquisition of myogenic commitment in C2C12 reserve cells promoted by P2 receptor activation

Science.gov (United States)

Riquelme, Manuel A.; Cea, Luis A.; Vega, José L.; Puebla, Carlos; Vargas, Aníbal A.; Shoji, Kenji F.; Subiabre, Mario; Sáez, Juan C.

2015-01-01

The acquisition of myoblast commitment to the myogenic linage requires rises in intracellular free Ca2+ concentration ([Ca2+]i). Putative cell membrane pathways involved in these [Ca2+]i increments are P2 receptors (P2Rs) as well as connexin (Cx) and/or pannexin (Panx) hemichannels and channels (Cx HChs and Panx Chs), respectively, which are known to permeate Ca2+. Reserve cells (RCs) are uncommitted myoblasts obtained from differentiated C2C12 cell cultures, which acquire commitment upon replating. Regarding these cells, we found that extracellular ATP increases the [Ca2+]i via P2Rs. Moreover, ATP increases the plasma membrane permeability to small molecules and a non-selective membrane current, both of which were inhibited by Cx HCh/Panx1Ch blockers. However, RCs exposed to divalent cation-free saline solution, which is known to activate Cx HChs (but not Panx Chs), did not enhance membrane permeability, thus ruling out the possible involvement of Cx HChs. Moreover, ATP-induced membrane permeability was inhibited with blockers of P2Rs that activate Panx Chs. In addition, exogenous ATP induced the expression of myogenic commitment and increased MyoD levels, which was prevented by the inhibition of P2Rs or knockdown of Panx1 Chs. Similarly, increases in MyoD levels induced by ATP released by RCs were inhibited by Panx Ch/Cx HCh blockers. Myogenic commitment acquisition thus requires a feed-forward mechanism mediated by extracellular ATP, P2Rs, and Panx Chs. PMID:26000275

Technical aspects in understanding effects of gamma irradiation on flower colour changes in Dendrobium Sonia

International Nuclear Information System (INIS)

Sakinah Ariffin; Azhar Mohammad; Ratnam, W.

2012-01-01

Colour is one of the most important traits in orchids and has created great interest in breeding programmes. Gamma irradiation is an alternative way for generation of somaclonal variation for new flower colours. Phenotypic changes are usually observed during screening and selection of mutants. Understanding of targeted gene expression level and evaluation of the changes facilitate in the development of functional markers for selection of desired flower colour mutants. Four Dendrobium orchid sequences (NCBI accessions: AM490639, AY41319, FM209429 and DQ462460) were selected to design gene specific primers based on information for chalcone synthase (CHS) from NCBI database. Quantitative real-time PCR (qPCR) was used to understand flower colour expression quantitatively derived from the CHS gene activities in different flower tissues (petal and sepal) from control Dendrobium Sonia (red purple), mutant DS 35-1/M (purple pink) and mutant DS 35-WhiteA. It was found that expression of CHS gene was highest in sepals of white flowers and lowest in both sepals and petals of purple pink flowers. Genomic DNA was amplified and PCR products were sequenced, aligned and compared. Sequence variations of CHS partial gene in Dendrobium Sonia mutants with different flower colour showed that two protein positions have been changed as compared to the control. These non-synonymous mutations may have contributed to the colour alterations in the white and purple pink mutants. This paper describes important procedures to quantify gene expression such as RNA isolation (quantity and quality), cDNA synthesis and primer design steps for CHS genes. (author)

Trans-fatty acid consumption and heart rate variability in two separate cohorts of older and younger adults

Science.gov (United States)

Soares-Miranda, Luisa; Stein, Phyllis K; Imamura, Fumiaki; Sattelmair, Jacob; Lemaitre, Rozenn N; Siscovick, David S; Mota, Jorge; Mozaffarian, Dariush

2014-01-01

Background Trans-fatty acid (TFA) consumption is associated with risk of coronary heart disease, and trans-18:2, but not trans-18:1, in red blood cells membranes has been associated with sudden cardiac arrest. Abnormal heart rate variability (HRV) reflects autonomic dysfunction and predicts cardiac death. Relationships between TFA consumption and HRV remain under-studied. We determined whether total TFA consumption, as well as trans-18:1 and trans-18:2 TFA consumption, were independently associated with HRV in two independent cohorts in the US and Portugal. Methods and Results In two independent cohorts of older US adults (Cardiovascular Health Study ([CHS], age=72±5yrs, 1989/1995) and young Portuguese adults (Porto, age=19±2yrs, 2008/2010), we assessed habitual TFA intake by food frequency questionnaires in CHS (separately estimating trans-18:1 and trans-18:2) and multiple 24-hour recalls in Porto (estimating total TFA only, which in a subset correlated with circulating trans-18:2, but not trans-18:1, suggesting that we captured the former). HRV was assessed using 24-hour Holters in CHS (N=1,076) and repeated short-term (5-min) ECGs in Porto (N=160). We used multivariate-adjusted linear regression to relate TFA consumption to HRV cross-sectionally (CHS, Porto) and longitudinally (CHS). In CHS, higher trans-18:2 consumption was associated with lower 24-hour standard-deviation-of-all-normal-to-normal-intervals (SDNN) both cross-sectionally (−12%, 95%CI=6–19%, p=0.001) and longitudinally (−15%, 95%CI=4–25 %, p= 0.009), and lower 24-hour SDANN and SDNN-index (pHRV, in particular time-domain indices (SDNN, SDANN, SDNN-index; pHRV in both older and young adults. Trans-18:1 consumption is associated with more favorable HRV indices in older adults. Our results support the need to investigate potential HRV related mechanisms whereby trans-18:2 may increase arrhythmic risk. PMID:22772898

Endocytic recycling via the TGN underlies the polarized hyphal mode of life.

Science.gov (United States)

Hernández-González, Miguel; Bravo-Plaza, Ignacio; Pinar, Mario; de Los Ríos, Vivian; Arst, Herbert N; Peñalva, Miguel A

2018-04-01

Intracellular traffic in Aspergillus nidulans hyphae must cope with the challenges that the high rates of apical extension (1μm/min) and the long intracellular distances (>100 μm) impose. Understanding the ways in which the hyphal tip cell coordinates traffic to meet these challenges is of basic importance, but is also of considerable applied interest, as fungal invasiveness of animals and plants depends critically upon maintaining these high rates of growth. Rapid apical extension requires localization of cell-wall-modifying enzymes to hyphal tips. By combining genetic blocks in different trafficking steps with multidimensional epifluorescence microscopy and quantitative image analyses we demonstrate that polarization of the essential chitin-synthase ChsB occurs by indirect endocytic recycling, involving delivery/exocytosis to apices followed by internalization by the sub-apical endocytic collar of actin patches and subsequent trafficking to TGN cisternae, where it accumulates for ~1 min before being re-delivered to the apex by a RAB11/TRAPPII-dependent pathway. Accordingly, ChsB is stranded at the TGN by Sec7 inactivation but re-polarizes to the apical dome if the block is bypassed by a mutation in geaAgea1 that restores growth in the absence of Sec7. That polarization is independent of RAB5, that ChsB predominates at apex-proximal cisternae, and that upon dynein impairment ChsB is stalled at the tips in an aggregated endosome indicate that endocytosed ChsB traffics to the TGN via sorting endosomes functionally located upstream of the RAB5 domain and that this step requires dynein-mediated basipetal transport. It also requires RAB6 and its effector GARP (Vps51/Vps52/Vps53/Vps54), whose composition we determined by MS/MS following affinity chromatography purification. Ablation of any GARP component diverts ChsB to vacuoles and impairs growth and morphology markedly, emphasizing the important physiological role played by this pathway that, we propose, is central

Laying performance, digestibility and plasma hormones in laying hens exposed to chronic heat stress as affected by betaine, vitamin C, and/or vitamin E supplementation.

Science.gov (United States)

Attia, Youssef A; Abd El-Hamid, Abd El-Hamid E; Abedalla, Ahmed A; Berika, Marfat A; Al-Harthi, Mohammed A; Kucuk, Osman; Sahin, Kazim; Abou-Shehema, Baha M

2016-01-01

Heat stress had a negative effect on laying hens' performance, thus this research was to study the influences of betaine (Bet, 1000 mg/kg betaine), vitamin C (VC, 200 mg/kg ascorbic acid), and vitamin E (VE, 150 mg/kg α-Tocopherol acetate) and their possible combinations on egg production, digestibility of nutrients, plasma hormones and reproductive organs of dual-purpose hens exposed to chronic heat stress. Two hundred and eighty eight hens and thirty-six cocks from 32 to 48 weeks of age were divided into nine treatment groups of four replicates, each containing eight hens and one cock. One group was kept under thermo-natural condition and the eight others were kept under chronic heat stress (CHS). One of these eight was used as a negative control, while the others were supplemented with VC, VE and/or betaine and their possible combinations. Body weights, laying rate, feed intake, and feed conversion ratio in hens reared under CHS rooster without any supplementation during 32 to 48 weeks of impairment (P = 0.0052) were recorded. Hens reared under heat stress and fed a diet supplemented with either Bet, VC, VE or combination of the supplements increased production traits. However, hens supplemented with VC showed the greatest production traits. Plasma glucose, estradiol-17 (E2), progesterone (P4), tri-iodothyronine (T3) and thyroxine (T4) decreased in hens reared under CHS and fed a diet with no supplementation compared to the other treatments (P = 0.001). Liver weights, spleen weights, thyroid gland weights, ovary weights, oviduct weights and oviduct lengths were lowest in hens reared under CHS and fed a diet with no supplementation (P = 0.0480). In conclusion, dual purpose hens reared under CHS and supplemented with VC at 200 mg/kg diet and Bet at 1000 mg/kg enhanced the laying performance and combated CHS.

Improved confinement and related physics study in Compact Helical System

International Nuclear Information System (INIS)

Okamura, S.; Akiyama, T.; Fujisawa, A.; Ida, K.; Iguchi, H.; Isobe, M.; Minami, T.; Nagaoka, K.; Nakamura, K.; Nishimura, S.; Matsuoka, K.; Matsushita, H.; Nakano, H.; Ohshima, S.; Shimizu, A.; Suzuki, C.; Takahashi, C.; Toi, K.; Yoshimura, Y.; Yoshinuma, M.; Oishi, T.; Kado, S.

2005-01-01

Recent experimental results in Compact Helical System (CHS) will be presented focusing on the improved confinement and physics study of electric field and turbulence in helical plasmas. Among various improved confinement modes found in CHS experiments, the edge transport barrier (ETB) formation is an important topic, which we have been studying intensively for these years. The discharges of CHS with ETB have characteristics very similar to H-mode discharges in tokamaks and W7-AS stellarator. We observe a sharp drop of Hα emission signal, increase of plasma density together with an increase of local density gradient at the plasma edge, so we call our ETB discharges as H-mode. The power threshold for the transition is clearly observed which is again similar to standard H-mode discharges, i.e., the threshold increases with the density and magnetic field. Unique feature of CHS H-mode is the dependence on the magnetic field configuration. We examined H-mode discharges for the configurations with magnetic axis shift and the magnetic quadrupole control. The transition appeared for a wide range of configurations with the rotational transform at the plasma edge (iota(a)) below and above unity. There is a general dependence of power threshold: higher power needed for the inward shifted configuration (with lower value of iota(a)) and lower power for outward shift. The absolute power threshold of CHS H-mode for the outward shifted configuration is very close to the tokamak H-mode with a divertor configuration. Other topics of confinement studies in CHS will be also presented. We have a unique diagnostic system of two heavy ion beam probes. It is unique in stellarator research and also for all toroidal confinement research including many tokamaks in the world. As well as fruitful result of electric field measurements, that is one of key elements for stellarator physics, this diagnostic measures turbulence in the plasma, which gives essential information for the study of

Validity of Self-reported Healthcare Utilization Data in the Community Health Survey in Korea

Science.gov (United States)

Rim, Hwayoung; Lee, Kunsei; Chang, Sounghoon; Hovell, Melbourne F; Kim, Young-Taek; Kim, Yuna; Kang, Gilwon; Tak, Yangju; Im, Jeehye

2011-01-01

To evaluate the sensitivity and specificity of Community Health Survey (CHS), we analyzed data from 11,217 participants aged ≥ 19 yr, in 13 cities and counties in 2008. Three healthcare utilization indices (admission, outpatient visits, dental visits) as comparative variables and the insurance benefit claim data of the Health Insurance Review & Assessment Service as the gold-standard were used. The sensitivities of admission, outpatient visits, and dental visits in CHS were 54.8%, 52.1%, and 61.0%, respectively. The specificities were 96.4%, 85.6%, and 82.7%, respectively. This is the first study to evaluate the validity of nationwide health statistics resulting from questionnaire surveys and shows that CHS needs a lot of efforts to reflect the true health status, health behavior, and healthcare utilization of the population. PMID:22065895

Immobilized Lentivirus Vector on Chondroitin Sulfate-Hyaluronate Acid-Silk Fibroin Hybrid Scaffold for Tissue-Engineered Ligament-Bone Junction

Directory of Open Access Journals (Sweden)

Liguo Sun

2014-01-01

Full Text Available The lack of a fibrocartilage layer between graft and bone remains the leading cause of graft failure after anterior cruciate ligament (ACL reconstruction. The objective of this study was to develop a gene-modified silk cable-reinforced chondroitin sulfate-hyaluronate acid-silk fibroin (CHS hybrid scaffold for reconstructing the fibrocartilage layer. The scaffold was fabricated by lyophilizing the CHS mixture with braided silk cables. The scanning electronic microscopy (SEM showed that microporous CHS sponges were formed around silk cables. Each end of scaffold was modified with lentiviral-mediated transforming growth factor-β3 (TGF-β3 gene. The cells on scaffold were transfected by bonded lentivirus. In vitro culture demonstrated that mesenchymal stem cells (MSCs on scaffolds proliferated vigorously and produced abundant collagen. The transcription levels of cartilage-specific genes also increased with culture time. After 2 weeks, the MSCs were distributed uniformly throughout scaffold. Deposited collagen was also found to increase. The chondral differentiation of MSCs was verified by expressions of collagen II and TGF-β3 genes in mRNA and protein level. Histology also confirmed the production of cartilage extracellular matrix (ECM components. The results demonstrated that gene-modified silk cable-reinforced CHS scaffold was capable of supporting cell proliferation and differentiation to reconstruct the cartilage layer of interface.

[The quality of professional life and the pride in working in public health. The results of a survey].

Science.gov (United States)

Clúa Espuny, J L; Aguilar Martín, C

1998-09-30

To find what factors explain best the pride of belonging to a public health enterprise. A descriptive crossover study. One primary care CHS. Staff of 363 from Tortosa's Primary Care administrative staff. All the employees were sent a self-filling questionnaire on the quality of their professional life. 232 returned the questionnaire filled in (63.9%). They showed an average value for the overall quality of professional life (5.40 +/- 2.09). The general profile covered the following perceptions taken together: sufficient intrinsic motivation; in a work-place with sufficient responsibility, training and social support; associated with enough work-load; with some emotional support from the managers; having some inconveniences caused by work. The pride in belonging to the CHS was high (6.86 +/- 2.50), with those over 45 giving a significantly higher average reply. Among doctors, pride was significantly lower. The multiple regression model identified three significant variables which explained 67.5% of the variability in the pride of belonging to the CHS: recognition of effort, being properly trained for their current job and length of service. a) Professionals are quite proud of belonging to the CHS. b) Their perception of the quality of professional life is average.

Conformal higher spin scattering amplitudes from twistor space

Energy Technology Data Exchange (ETDEWEB)

Adamo, Tim [Blackett Laboratory, Imperial College, London, SW7 2AZ (United Kingdom); Hähnel, Philipp; McLoughlin, Tristan [School of Mathematics, Trinity College Dublin, College Green, Dublin 2 (Ireland)

2017-04-04

We use the formulation of conformal higher spin (CHS) theories in twistor space to study their tree-level scattering amplitudes, finding expressions for all three-point (MHV)-bar amplitudes and all MHV amplitudes involving positive helicity conformal gravity particles and two negative helicity higher spins. This provides the on-shell analogue for the covariant coupling of CHS fields to a conformal gravity background. We discuss the restriction of the theory to a ghost-free unitary subsector, analogous to restricting conformal gravity to general relativity with a cosmological constant. We study the flat-space limit and show that the restricted amplitudes vanish, supporting the conjecture that in the unitary sector the S-matrix of CHS theories is trivial. However, by appropriately rescaling the amplitudes we find non-vanishing results which we compare with chiral flat-space higher spin theories.

Cellular dynamics in the draining lymph nodes during sensitization and elicitation phases of contact hypersensitivity

DEFF Research Database (Denmark)

Larsen, Jeppe Madura; Geisler, Carsten; Nielsen, Martin Weiss

2007-01-01

BACKGROUND: The different role of various immunological effector cells in contact hypersensitivity (CHS) is receiving increased attention. During the past decade, the involvement of different cell types in CHS has been investigated by the use of antibody-induced depletion of specific subtypes...... of immunological cells and by studying knockout mice lacking one or more of these immunological cell populations. OBJECTIVES: To develop a method for studying the collective cellular dynamics of immune cells in the draining lymph nodes during CHS in intact animals. PATIENTS/METHODS: Mice were sensitized and....../or challenged with 2,4-dinitrofluorobenzene or oxazolone. Using multi-parameter flow cytometry we determined the proliferation, activation state, and absolute number of helper T cells, cytotoxic T cells, B cells, and natural killer cells in the draining lymph nodes. RESULTS: The presented method can be applied...

Conformal higher spin scattering amplitudes from twistor space

International Nuclear Information System (INIS)

Adamo, Tim; Hähnel, Philipp; McLoughlin, Tristan

2017-01-01

We use the formulation of conformal higher spin (CHS) theories in twistor space to study their tree-level scattering amplitudes, finding expressions for all three-point (MHV)-bar amplitudes and all MHV amplitudes involving positive helicity conformal gravity particles and two negative helicity higher spins. This provides the on-shell analogue for the covariant coupling of CHS fields to a conformal gravity background. We discuss the restriction of the theory to a ghost-free unitary subsector, analogous to restricting conformal gravity to general relativity with a cosmological constant. We study the flat-space limit and show that the restricted amplitudes vanish, supporting the conjecture that in the unitary sector the S-matrix of CHS theories is trivial. However, by appropriately rescaling the amplitudes we find non-vanishing results which we compare with chiral flat-space higher spin theories.

Coronal hole evolution from multi-viewpoint data as input for a STEREO solar wind speed persistence model

Science.gov (United States)

Temmer, Manuela; Hinterreiter, Jürgen; Reiss, Martin A.

2018-03-01

We present a concept study of a solar wind forecasting method for Earth, based on persistence modeling from STEREO in situ measurements combined with multi-viewpoint EUV observational data. By comparing the fractional areas of coronal holes (CHs) extracted from EUV data of STEREO and SoHO/SDO, we perform an uncertainty assessment derived from changes in the CHs and apply those changes to the predicted solar wind speed profile at 1 AU. We evaluate the method for the time period 2008-2012, and compare the results to a persistence model based on ACE in situ measurements and to the STEREO persistence model without implementing the information on CH evolution. Compared to an ACE based persistence model, the performance of the STEREO persistence model which takes into account the evolution of CHs, is able to increase the number of correctly predicted high-speed streams by about 12%, and to decrease the number of missed streams by about 23%, and the number of false alarms by about 19%. However, the added information on CH evolution is not able to deliver more accurate speed values for the forecast than using the STEREO persistence model without CH information which performs better than an ACE based persistence model. Investigating the CH evolution between STEREO and Earth view for varying separation angles over ˜25-140° East of Earth, we derive some relation between expanding CHs and increasing solar wind speed, but a less clear relation for decaying CHs and decreasing solar wind speed. This fact most likely prevents the method from making more precise forecasts. The obtained results support a future L5 mission and show the importance and valuable contribution using multi-viewpoint data.

Preparation and characterisation of irradiated crab chitosan and New Zealand Arrow squid pen chitosan

International Nuclear Information System (INIS)

Shavandi, Amin; Bekhit, Adnan A.; Bekhit, Alaa El-Din A.; Sun, Zhifa; Ali, M. Azam

2015-01-01

The properties of chitosan from Arrow squid (Nototodarus sloanii) pen (CHS) and commercial crab shell (CHC) were investigated using FTIR, DSC, SEM and XRD before and after irradiation at the dose of 28 kGy in the presence or absence of 5% water. Also, the viscosity, deacetylation degree, water and oil holding capacities, colour and antimicrobial activities of the chitosan samples were determined. Irradiation decreased (P < 0.05) the viscosity of CHC from 0.21 to 0.03 Pa s and of CHS from 1.71 to 0.23 Pa s. The inclusion of water had no effect on the viscosity of irradiated chitosan. Irradiation did not affect the degree of deacetylation of CHC, but increased the deacetylation degree of CHS from 72.78 to 82.29% in samples with 5% water. Water and oil holding capacities of CHS (1197.30% and 873.3%, respectively) were higher (P < 0.05) than those found in CHC (340.70% and 264.40%, respectively). The water and oil holding capacities were decreased for both types of chitosan irradiation, but were not affected by the addition of water. Squid pen chitosan was whiter in colour (White Index = 90.06%) compared to CHC (White Index = 83.70%). Generally, the CHC samples (control and irradiated) exhibited better antibacterial activity compared to CHS, but the opposite was observed with antifungal activity. - Highlights: • Chitosan prepared from Arrow squid pens (Nototodarus sloanii). • Chitosan samples were gamma irradiated at 28 kGy. • Squid pen chitosan showed high fat and water uptake capacities compared to crab shell chitosan. • Gamma irradiation enhanced the DDA of squid pen chitosan but not crab shell chitosan.

Coronal hole evolution from multi-viewpoint data as input for a STEREO solar wind speed persistence model

Directory of Open Access Journals (Sweden)

Temmer Manuela

2018-01-01

Full Text Available We present a concept study of a solar wind forecasting method for Earth, based on persistence modeling from STEREO in situ measurements combined with multi-viewpoint EUV observational data. By comparing the fractional areas of coronal holes (CHs extracted from EUV data of STEREO and SoHO/SDO, we perform an uncertainty assessment derived from changes in the CHs and apply those changes to the predicted solar wind speed profile at 1 AU. We evaluate the method for the time period 2008–2012, and compare the results to a persistence model based on ACE in situ measurements and to the STEREO persistence model without implementing the information on CH evolution. Compared to an ACE based persistence model, the performance of the STEREO persistence model which takes into account the evolution of CHs, is able to increase the number of correctly predicted high-speed streams by about 12%, and to decrease the number of missed streams by about 23%, and the number of false alarms by about 19%. However, the added information on CH evolution is not able to deliver more accurate speed values for the forecast than using the STEREO persistence model without CH information which performs better than an ACE based persistence model. Investigating the CH evolution between STEREO and Earth view for varying separation angles over ∼25–140° East of Earth, we derive some relation between expanding CHs and increasing solar wind speed, but a less clear relation for decaying CHs and decreasing solar wind speed. This fact most likely prevents the method from making more precise forecasts. The obtained results support a future L5 mission and show the importance and valuable contribution using multi-viewpoint data.

Dynamics of r.f. production of Stellarator plasmas in the ion cyclotron range of frequency

International Nuclear Information System (INIS)

Moiseenko, V.E.; Lysoivan, A.I.; Kasilov, S.V.; Plyusnin, V.V.

1995-01-01

The present study investigated numerically the process of r.f. production of plasma in the URAGAN-3M torsatron in the frequency range below the ion cyclotron frequency (ω ci ). The dynamics of r.f. plasma build-up at the stages of neutral gas burnout and plasma heating were studied using a zero-dimensional transport code, in which the plasma confinement law was determined by large helical device scaling. Two models for input r.f. power were used. In the first case, the r.f. power absorbed by the electrons was computed by a one-dimensional r.f. code solving Maxwell's boundary problem equations. The mechanisms of electron heating through direct excitation of the slow wave (SW) by antennae as well as the conversion of fast wave (FW) into SW in the vicinity of Alfven resonance (scenario of Alfven heating) were taken into account in the computations. In the second case, an 'ideal' model of r.f. power deposition onto the electrons as a linear function of plasma density was employed. A noticeable difference in plasma production dynamics computed for these two cases was found. Better agreement with experimental data obtained from the URAGAN-3M torsatron was found for the first case resulting from combination of the one-dimensional r.f. and zero-dimensional transport codes. ((orig.))

Study of neoclassical transport in the 1/ν regime for a research fusion reactor

International Nuclear Information System (INIS)

Kalyuzhnyj, V.N.; Kasilov, S.V.; Nemov, V.V.

2005-01-01

In frame of the concept of a steady-state operated research fusion reactor (RFR) in papers [1-4] the RFR with an increased plasma-wall detachment was proposed with the purpose to enable not only the production but also a long-term confinement of a self-sustained plasma at the existing technology level. In connection with complication of the corresponding magnetic configuration an investigation of the neoclassical transport is desirable for such systems. In the present work neoclassical transport for a magnetic configuration of l=2 torsatron type variant of RFR system with an additional opposite toroidal magnetic field is investigated numerically. A so-called 1/ν transport regime, in which the transport coefficients are increased with reduction of particle collision frequency ν is considered. For calculating of transport coefficients a technique, based on integration along magnetic field lines in a given stellarator magnetic field is used. The magnetic field of helical windings is calculated by Biot-Savart law. The obtained transport coefficients are presented in a standard form containing a factor depending on the magnetic field geometry. From analysis of the received results follows that in respect of the neoclassical transport the proposed magnetic configuration turns out to be closer to configuration of the classical stellarator (with helical winding), than to configuration of the classical torsatron/geliotron. (author)

Expression of Genes Related to Phenylpropanoid Biosynthesis in Different Organs of Ixeris dentata var. albiflora.

Science.gov (United States)

Lee, Sang-Hoon; Park, Yun-Ji; Park, Sang Un; Lee, Sang-Won; Kim, Seong-Cheol; Jung, Chan-Sik; Jang, Jae-Ki; Hur, Yoonkang; Kim, Yeon Bok

2017-05-30

Members of the genus Ixeris have long been used in traditional medicines as stomachics, sedatives, and diuretics. Phenylalanine ammonia-lyase (PAL), cinnamate-4-hydroxylase (C4H), 4-coumarate: coenzyme-A (CoA) ligase (4CL), chalcone synthase (CHS), and dihydroflavonol 4-reductase (DFR) are important enzymes in the phenylpropanoid pathway. In this study, we analyzed seven genes from Ixeris dentata var. albiflora that are involved in phenylpropanoid biosynthesis, using an Illumina/Solexa HiSeq 2000 platform. The amino acid sequence alignments for IdPAL s, IdC4H, Id4CL s, IdCHS , and IdDFR showed high identity to sequences from other plants. We also investigated transcript levels using quantitative real-time PCR, and analyzed the accumulation of phenylpropanoids in different organs of I. dentata var. albiflora using high-performance liquid chromatography. The transcript levels of IdC4H, Id4CL1 , IdCHS , and IdDFR were highest in the leaf. The catechin, chlorogenic acid, ferulic acid, and quercetin contents were also highest in the leaf. We suggest that expression of IdC4H, Id4CL1 , IdCHS , and IdDFR is associated with the accumulation of phenylpropanoids. Our results may provide baseline information for elucidating the mechanism of phenylpropanoid biosynthesis in different organs of I. dentata var. albiflora .

Children who face development risks due to maternal addiction during pregnancy require extra medical and psychosocial resources.

Science.gov (United States)

Rangmar, Jenny; Lilja, Maria; Köhler, Marie; Reuter, Antonia

2018-05-21

This study examined medical and psychosocial risk factors in children born to women with addiction problems during pregnancy and the children's needs for extra medical and psychosocial resources. Swedish midwives routinely screen pregnant women for drugs and alcohol and refer women with addictions to the Maternity and Child Healthcare Resource Team. We investigated the medical records of 127 children (51% girls) whose mothers were referred to the Resource Team from 2009-2015. Additional data were obtained from local child healthcare services (CHS), which provide routine paediatric care. More than three-quarters (76%) of the children had prenatal exposure to alcohol and drugs and 17% were born with withdrawal symptoms. The mothers had a high rate of psychiatric diagnoses (38%) and were more likely to smoke after delivery and less likely to breastfeed than the general population. However, adherence to the CHS programme was generally high. Additional visits to the nurse, referrals to specialists, collaboration meetings and reports of concerns to social services decreased when the children began attending ordinary CHS centres. Children born to women with addictions during pregnancy faced a high risk of developmental problems and should be offered additional CHS resources to minimise negative long-term consequences. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

Cloning and sequence analysis of chitin synthase gene fragments of Demodex mites*

OpenAIRE

Zhao, Ya-e; Wang, Zheng-hang; Xu, Yang; Xu, Ji-ru; Liu, Wen-yan; Wei, Meng; Wang, Chu-ying

2012-01-01

To our knowledge, few reports on Demodex studied at the molecular level are available at present. In this study our group, for the first time, cloned, sequenced and analyzed the chitin synthase (CHS) gene fragments of Demodex folliculorum, Demodex brevis, and Demodex canis (three isolates from each species) from Xi’an China, by designing specific primers based on the only partial sequence of the CHS gene of D. canis from Japan, retrieved from GenBank. Results show that amplification was succe...

PODAAC-CHS3A-2PM01

Data.gov (United States)

National Aeronautics and Space Administration — The SLSTR Skin Sea Surface Temperature (SST) is one of the mission primary products from the Sea and Land Surface Temperature Radiometer (SLSTR) instrument on board...

Chédiak-Higashi syndrome: presentation of seven cases

Directory of Open Access Journals (Sweden)

Eugénia Maria Grilo Carnide

Full Text Available CONTEXT: Chédiak-Higashi Syndrome (CHS is a rare autosomal recessive disease characterized by recurrent infections, giant cytoplasmic granules, and oculocutaneous albinism. OBJECTIVE: To describe clinical and laboratory findings from CHS patients. DESIGN: Case report. SETTING: The patients were admitted into the Allergy and Immunology Unit of the Instituto da Criança, a tertiary public care institution. CASES REPORT: Seven patients had oculocutaneous albinism, recurrent infections and giant cytoplasmic granules in the leukocytes. One patient had low IgG levels and three showed impaired bactericidal activity of neutrophils. Six patients died of infectious complications during the accelerated phase. Therapy included ascorbic acid and antibiotics. Chemotherapy was used for the accelerated phase in two patients. Bone marrow transplantation (BMT was proposed for one patient. DISCUSSION: The authors emphasize the need for early diagnosis and therapy of CHS. BMT should be indicated before the accelerated phase of the disease has developed.

Experimental investigation on TBAB clathrate hydrate slurry flows in a horizontal tube: Forced convective heat transfer behaviors

Energy Technology Data Exchange (ETDEWEB)

Wenji, Song [Guangzhou Institute of Energy Conversion, CAS, No. 2 Nengyuan Road, Tianhe District, Guangzhou 510640 (China); Key Laboratory of Renewable Energy and Gas Hydrate, CAS, No. 2 Nengyuan Road, Tianhe District, Guangzhou 510640 (China); Graduate School of Chinese Academy of Sciences, Beijing 100039 (China); Rui, Xiao; Chong, Huang; Shihui, He; Kaijun, Dong; Ziping, Feng [Guangzhou Institute of Energy Conversion, CAS, No. 2 Nengyuan Road, Tianhe District, Guangzhou 510640 (China); Key Laboratory of Renewable Energy and Gas Hydrate, CAS, No. 2 Nengyuan Road, Tianhe District, Guangzhou 510640 (China)

2009-11-15

Tetra-n-butyl-ammonium bromide (TBAB) clathrate hydrate slurry (CHS) is one kind of secondary refrigerants, which is promising to be applied into air-conditioning or latent-heat transportation systems as a thermal storage or cold carrying medium for energy saving. It is a solid-liquid two phase mixture which is easy to produce and has high latent heat and good fluidity. In this paper, the heat transfer characteristics of TBAB slurry were investigated in a horizontal stainless steel tube under different solid mass fractions and flow velocities with constant heat flux. One velocity region of weakened heat transfer was found. Moreover, TBAB CHS was treated as a kind of Bingham fluids, and the influences of the solid particles, flow velocity and types of flow on the forced convective heat transfer coefficients of TBAB CHS were investigated. At last, criterial correlations of Nusselt number for laminar and turbulent flows in the form of power function were summarized, and the error with experimental results was within {+-}20%. (author)

Measuring Hope Among Children Affected by Armed Conflict: Cross-Cultural Construct Validity of the Children's Hope Scale.

Science.gov (United States)

Haroz, Emily E; Jordans, Mark; de Jong, Joop; Gross, Alden; Bass, Judith; Tol, Wietse

2017-06-01

We investigated the cross-cultural construct validity of hope, a factor associated with mental health protection and promotion, using the Children's Hope Scale (CHS). The sample ( n = 1,057; 48% girls) included baseline data from three cluster-randomized controlled trials with children affected by armed conflict ( n = 329 Burundi; n = 403 Indonesia; n = 325 Nepal). The confirmatory factor analysis in each country indicated good fit for the hypothesized two-factor model. Analysis by gender indicated that configural invariance was supported and that scalar invariance was demonstrated in Indonesia. However, metric and scalar invariance were not supported in Burundi and Nepal. In country comparisons, configural and metric invariance were met, but scalar invariance was not supported. Evidence from this study supports the use of the CHS within various sociocultural settings and across genders, but direct comparisons of CHS scores across groups should be done with caution. Rigorous evaluations of the measurement properties of mental health protective and promotive factors are necessary to inform both research and practice.

Development and Testing of Atomic Beam-Based Plasma Edge Diagnostics in the CIEMAT Fusion Devices

International Nuclear Information System (INIS)

Tafalla, D.; Tabares, F.L.; Ortiz, P.; Herrero, V.J.; Tanarro, I.

1998-01-01

In this report the development of plasma edge diagnostic based on atomic beam techniques fir their application in the CIEMAT fusion devices is described. The characterisation of the beams in laboratory experiments at the CSIC, together with first results in the Torsatron TJ-II are reported. Two types of beam diagnostics have been developed: a thermal (effusive) Li and a supersonic, pulsed He beams. This work has been carried out in collaboration between the institutions mentioned above under partial financial support by EURATOM. (Author) 17 refs

New STS molecular markers for assessment of genetic diversity and DNA fingerprinting in hop (Humulus lupulus L.).

Science.gov (United States)

Patzak, Josef; Vrba, Lukás; Matousek, Jaroslav

2007-01-01

Molecular markers have been increasingly used in genetic studies of crop species for their applicability in breeding programs. In this work, we report on the development of new sequence-tagged site (STS) markers based on sequence information from several identified hop (Humulus lupulus L.) genes. We demonstrate the usefulness of these STS markers and compare them to SSRs for identifying hop genotypes and estimating genetic diversity in a collection of 68 hop cultivars from around the world. We found 3 individual gene variants (A, B, C) of the chs_H1 gene in this collection. The most frequent gene variant, B (AJ304877), was not detected in Mt. Hood, Glacier, and Horizon (US) cultivars. Gene variant A came from an American germplasm through wild hops. We found length polymorphism in intron 1 of the chs2 gene, and 4 different amplified markers were detected in PCRs. The chs3 gene was found in only one third of the cultivars. None of the variants of the studied CHS genes were found in Humulus japonicus. We detected 5 major gene variants of DNA-binding protein in the collection of H. lupulus cultivars and 2 others in H. japonicus. We also found 3 individual gene variants of an endochitinase gene. The distribution of gene variants did not correlate with any resistance. We proved that developed STS markers can be successfully used for the analysis of genetic diversity and can substitute and supplement SSR markers in hop.

Health and Environmental Risk Assessment Project for bottlenose dolphins Tursiops truncatus from the southeastern USA. II. Environmental aspects.

Science.gov (United States)

Reif, John S; Schaefer, Adam M; Bossart, Gregory D; Fair, Patricia A

2017-07-24

Bottlenose dolphins Tursiops truncatus are the most common apex predators found in coastal and estuarine ecosystems along the southeastern coast of the USA, where these animals are exposed to multiple chemical pollutants and microbial agents. In this review, we summarize the results of investigations of environmental exposures evaluated in 360 free-ranging dolphins between 2003 and 2015. Bottlenose dolphins inhabiting the Indian River Lagoon, Florida (IRL, n = 246), and coastal waters of Charleston, South Carolina (CHS, n = 114), were captured, given comprehensive health examinations, and released as part of a multidisciplinary and multi-institutional study of individual and population health. High concentrations of persistent organic pollutants including legacy contaminants (DDT and other pesticides, polychlorinated biphenyl compounds) as well as 'emerging' contaminants (polybrominated diphenyl ethers, perfluorinated compounds) were detected in dolphins from CHS, with lower concentrations in the IRL. Conversely, the concentrations of mercury in the blood and skin of IRL dolphins were among the highest reported worldwide and approximately 5 times as high as those found in CHS dolphins. A high prevalence of resistance to antibiotics commonly used in humans and animals was detected in bacteria isolated from fecal, blowhole, and/or gastric samples at both sites, including methicillin-resistant Staphylococcus aureus (MRSA) at CHS. Collectively, these studies illustrate the importance of long-term surveillance of estuarine populations of bottlenose dolphins and reaffirm their important role as sentinels for marine ecosystems and public health.

Primary central chondrosarcoma of long bone, limb girdle and trunk: Analysis of 174 cases by numerical scoring on histology.

Science.gov (United States)

Konishi, Eiichi; Nakashima, Yasuaki; Mano, Masayuki; Tomita, Yasuhiko; Nagasaki, Ikumitsu; Kubo, Toshikazu; Araki, Nobuhito; Haga, Hironori; Toguchida, Junya; Ueda, Takafumi; Sakuma, Toshiko; Imahori, Masaya; Morii, Eiichi; Yoshikawa, Hideki; Tsukamoto, Yoshitane; Futani, Hiroyuki; Wakasa, Kenichi; Hoshi, Manabu; Hamada, Shinshichi; Takeshita, Hideyuki; Inoue, Takeshi; Aono, Masanari; Kawabata, Kenji; Murata, Hiroaki; Katsura, Kanade; Urata, Yoji; Ueda, Hideki; Yanagisawa, Akio

2015-09-01

The aims of this study were: (i) to elucidate clinicopathological characteristics of pcCHS of long bones (L), limb girdles (LG) and trunk (T) in Japan; (ii) to investigate predictive pathological findings for outcome of pcCHS of L, LG and T, objectively; and (iii) to elucidate a discrepancy of grade between biopsy and resected specimens. Clinicopathological profiles of 174 pcCHS (79 male, 95 female), of L, LG, and T were retrieved. For each case, a numerical score was given to 18 pathological findings. The average age was 50.5 years (15-80 years). Frequently involved sites were femur, humerus, pelvis and rib. The 5-year and 10-year disease-specific survival (DSS) rates [follow-up: 1-258 months (average 65.5)] were 87.0% and 80.4%, respectively. By Cox hazards analysis on pathological findings, age, sex and location, histologically higher grade and older age were unfavorable predictors, and calcification was a favorable predictor in DSS. The histological grade of resected specimen was higher than that of biopsy in 37.7% (26/69 cases). In conclusion, higher histological grade and older age were predictors for poor, but calcification was for good prognosis. Because there was a discrepancy in grade between biopsy and resected specimens, comprehensive evaluation is necessary before definitive operation for pcCHS. © 2015 The Authors. Pathology International published by Japanese Society of Pathology and Wiley Publishing Asia Pty Ltd.

Effect of deletion of chitin synthase genes on mycelial morphology and culture viscosity in Aspergillus oryzae

DEFF Research Database (Denmark)

Müller, Christian; Hansen, K.; Szabo, Peter

2003-01-01

The objective of this study was to quantify the effect of disrupting two chitin synthases, chsB and csmA, on the morphology and rheology during batch cultivation of Aspergillus oryzae. The rheological properties were characterized in batch cultivations at different biomass concentrations (from 3...... broth was significantly affected by the biomass concentration, the morphology, and also by pH. The chsB disruption strain had lower consistency index K values for all biomass concentrations investigated, which is a desirable trait for industrial Aspergillus fermentations. (C) 2003 Wiley Periodicals, Inc....

Clinical, laboratory and molecular signs of immunodeficiency in patients with partial oculo-cutaneous albinism.

Science.gov (United States)

Dotta, Laura; Parolini, Silvia; Prandini, Alberto; Tabellini, Giovanna; Antolini, Maddalena; Kingsmore, Stephen F; Badolato, Raffaele

2013-10-17

Hypopigmentation disorders that are associated with immunodeficiency feature both partial albinism of hair, skin and eyes together with leukocyte defects. These disorders include Chediak Higashi (CHS), Griscelli (GS), Hermansky-Pudlak (HPS) and MAPBP-interacting protein deficiency syndromes. These are heterogeneous autosomal recessive conditions in which the causal genes encode proteins with specific roles in the biogenesis, function and trafficking of secretory lysosomes. In certain specialized cells, these organelles serve as a storage compartment. Impaired secretion of specific effector proteins from that intracellular compartment affects biological activities. In particular, these intracellular granules are essential constituents of melanocytes, platelets, granulocytes, cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Thus, abnormalities affect pigmentation, primary hemostasis, blood cell counts and lymphocyte cytotoxic activity against microbial pathogens. Among eight genetically distinct types of HPS, only type 2 is characterized by immunodeficiency. Recently, a new subtype, HPS9, was defined in patients presenting with immunodeficiency and oculocutaneous albinism, associated with mutations in the pallidin-encoding gene, PLDN.Hypopigmentation together with recurrent childhood bacterial or viral infections suggests syndromic albinism. T and NK cell cytotoxicity are generally impaired in patients with these disorders. Specific clinical and biochemical phenotypes can allow differential diagnoses among these disorders before molecular testing. Ocular symptoms, including nystagmus, that are usually evident at birth, are common in patients with HPS2 or CHS. Albinism with short stature is unique to MAPBP-interacting protein (MAPBPIP) deficiency, while hemophagocytic lymphohistiocytosis (HLH) mainly suggests a diagnosis of CHS or GS type 2 (GS2). Neurological disease is a long-term complication of CHS, but is uncommon in other syndromic albinism. Chronic

Neoclassical transport and radial electric fields in TJ-K

International Nuclear Information System (INIS)

Rahbarnia, K.; Greiner, F.; Ramisch, M.; Stroth, U.; Greiner, F.

2003-01-01

The neoclassical transport is investigated in the torsatron TJ-K, which is operated with a low-temperature plasma. In the low-collisionality regime neoclassical losses are not intrinsically ambipolar, leading to the formation of a radial electric field which acts on both neoclassical and turbulent transport. This electric field is measured with a combination of Langmuir and emissive probes. The data are compared with the ambipolar electric field calculated with an analytic model. The experimental fields are positive and larger than the calculated ones. Direct losses of the fast electrons might explain this discrepancy. (orig.)

Advanced fusion concepts: project summaries

International Nuclear Information System (INIS)

1980-12-01

This report contains descriptions of the activities of all the projects supported by the Advanced Fusion Concepts Branch of the Office of Fusion Energy, US Department of Energy. These descriptions are project summaries of each of the individual projects, and contain the following: title, principle investigators, funding levels, purpose, approach, progress, plans, milestones, graduate students, graduates, other professional staff, and recent publications. Information is given for each of the following programs: (1) reverse-field pinch, (2) compact toroid, (3) alternate fuel/multipoles, (4) stellarator/torsatron, (5) linear magnetic fusion, (6) liners, and (7) Tormac

Hygroscopic Swelling Determination of Cellulose Nanocrystal (CNC) Films by Polarized Light Microscopy Digital Image Correlation.

Science.gov (United States)

Shrestha, Shikha; Diaz, Jairo A; Ghanbari, Siavash; Youngblood, Jeffrey P

2017-05-08

The coefficient of hygroscopic swelling (CHS) of self-organized and shear-oriented cellulose nanocrystal (CNC) films was determined by capturing hygroscopic strains produced as result of isothermal water vapor intake in equilibrium. Contrast enhanced microscopy digital image correlation enabled the characterization of dimensional changes induced by the hygroscopic swelling of the films. The distinct microstructure and birefringence of CNC films served in exploring the in-plane hygroscopic swelling at relative humidity values ranging from 0% to 97%. Water vapor intake in CNC films was measured using dynamic vapor sorption (DVS) at constant temperature. The obtained experimental moisture sorption and kinetic profiles were analyzed by fitting with Guggenheim, Anderson, and deBoer (GAB) and Parallel Exponential Kinetics (PEK) models, respectively. Self-organized CNC films showed isotropic swelling, CHS ∼0.040 %strain/%C. By contrast, shear-oriented CNC films exhibited an anisotropic swelling, resulting in CHS ∼0.02 and ∼0.30 %strain/%C, parallel and perpendicular to CNC alignment, respectively. Finite element analysis (FEA) further predicted moisture diffusion as the predominant mechanism for swelling of CNC films.

The effect of coil misalignment on particle transport in quasi-axisymmetric systems

International Nuclear Information System (INIS)

Shimizu, Akihiro; Okamura, Shoichi; Isobe, Mitsutaka; Suzuki, Chihiro; Nishimura, Shin; Akiyama, Tsuyoshi; Matsuoka, Keisuke; Nemov, Victor V.

2004-01-01

The effect of the misalignment of modular coils neoclassical transport in CHS-qa is discussed in this paper. In order to calculate the effective helical ripple that characterizes the neoclassical transport of the stellarator configuration, NEO code is used which gives the effective helical ripple numerically. A displacement is put artificially on the modular coils of the CHS-qa, and the effect of this on the profile of the effective helical ripple is evaluated quantitatively. One objective of this study is to obtain useful information to determine the acceptable error level for the assembly of modular coils from the viewpoint of engineering. The calculation results of the NEO code show that if the level of displacement is smaller than a few centimeters, it has only a very small effect on the neoclassical transport. The a mount of change in the effective helical ripple is small. Therefore the displacement of the modular coils caused by the electromagnetic force at a 1.5 T operation of CHS-qa does not lead to significant problems in terms of neoclassical transport. (author)

Enzymatic Properties and Mutational Studies of Chalcone Synthase from Physcomitrella patens

Directory of Open Access Journals (Sweden)

Mahiran Basri

2012-08-01

Full Text Available PpCHS is a member of the type III polyketide synthase family and catalyses the synthesis of the flavonoid precursor naringenin chalcone from p-coumaroyl-CoA. Recent research reports the production of pyrone derivatives using either hexanoyl-CoA or butyryl-CoA as starter molecule. The Cys-His-Asn catalytic triad found in other plant chalcone synthase predicted polypeptides is conserved in PpCHS. Site directed mutagenesis involving these amino acids residing in the active-site cavity revealed that the cavity volume of the active-site plays a significant role in the selection of starter molecules as well as product formation. Substitutions of Cys 170 with Arg and Ser amino acids decreased the ability of the PpCHS to utilize hexanoyl-CoA as a starter molecule, which directly effected the production of pyrone derivatives (products. These substitutions are believed to have a restricted number of elongations of the growing polypeptide chain due to the smaller cavity volume of the mutant’s active site.

Characterization and isolation of some genes of the shikimate pathway in sensitive and resistant Centaurea jacea plants after ozone exposure

Energy Technology Data Exchange (ETDEWEB)

Francini, A. [Dipartimento di Coltivazione e Difesa delle Specie Legnose ' Giovanni Scaramuzzi' , University of Pisa, Via del Borghetto 80, 56124 Pisa (Italy); Nali, C. [Dipartimento di Coltivazione e Difesa delle Specie Legnose ' Giovanni Scaramuzzi' , University of Pisa, Via del Borghetto 80, 56124 Pisa (Italy)], E-mail: cristina.nali@agr.unipi.it; Pellegrini, E.; Lorenzini, G. [Dipartimento di Coltivazione e Difesa delle Specie Legnose ' Giovanni Scaramuzzi' , University of Pisa, Via del Borghetto 80, 56124 Pisa (Italy)

2008-01-15

Centaurea jacea has been suggested as a potential bioindicator for ozone, but little is known about its intraspecific variation in sensitivity, especially at molecular level. The effects of ozone (200 ppb, 5 h) on sensitive and resistant lines of Centaurea have been investigated at the end of fumigation. Sensitive plants showed characteristic symptoms of injury in the form of diffuse discoloration stipples on leaves. A PCR-based approach was used to identify and isolate a partial-length cDNA coding for PAL and CHS genes. The northern analysis of PAL showed accumulation of transcript in both lines correlated with a typical increase of PAL activity (+41 and +91% in resistant and sensitive material, respectively, compared to controls). On the contrary, the transcripts of CHS, in resistant and sensitive plants, did not change after treatment. Total phenols were not affected by ozone, while anthocyanins were quickly utilised by resistant clone as antioxidant compounds. - Characterization and isolation of PAL and CHS genes in Centaurea jacea exposed to O{sub 3}.

Sediment Microbial Communities Influenced by Cool Hydrothermal Fluid Migration

Directory of Open Access Journals (Sweden)

Laura A. Zinke

2018-06-01

Full Text Available Cool hydrothermal systems (CHSs are prevalent across the seafloor and discharge fluid volumes that rival oceanic input from rivers, yet the microbial ecology of these systems are poorly constrained. The Dorado Outcrop on the ridge flank of the Cocos Plate in the northeastern tropical Pacific Ocean is the first confirmed CHS, discharging minimally altered <15°C fluid from the shallow lithosphere through diffuse venting and seepage. In this paper, we characterize the resident sediment microbial communities influenced by cool hydrothermal advection, which is evident from nitrate and oxygen concentrations. 16S rRNA gene sequencing revealed that Thaumarchaea, Proteobacteria, and Planctomycetes were the most abundant phyla in all sediments across the system regardless of influence from seepage. Members of the Thaumarchaeota (Marine Group I, Alphaproteobacteria (Rhodospirillales, Nitrospirae, Nitrospina, Acidobacteria, and Gemmatimonadetes were enriched in the sediments influenced by CHS advection. Of the various geochemical parameters investigated, nitrate concentrations correlated best with microbial community structure, indicating structuring based on seepage of nitrate-rich fluids. A comparison of microbial communities from hydrothermal sediments, seafloor basalts, and local seawater at Dorado Outcrop showed differences that highlight the distinct niche space in CHS. Sediment microbial communities from Dorado Outcrop differ from those at previously characterized, warmer CHS sediment, but are similar to deep-sea sediment habitats with surficial ferromanganese nodules, such as the Clarion Clipperton Zone. We conclude that cool hydrothermal venting at seafloor outcrops can alter the local sedimentary oxidation–reduction pathways, which in turn influences the microbial communities within the fluid discharge affected sediment.

Theoretical spectroscopic characterization at low temperatures of S-methyl thioformate and O-methyl thioformate

International Nuclear Information System (INIS)

Senent, M. L.; Puzzarini, C.; Hochlaf, M.; Domínguez-Gómez, R.; Carvajal, M.

2014-01-01

Highly correlated ab initio methods are employed to determine spectroscopic properties at low temperatures of two S-analogs of methyl formate: S-methyl thioformate CH 3 -S-CHO (MSCHO) and O-methyl thioformate CH 3 -O-CHS (MOCHS). Both species are detectable and they are expected to play an important role in Astrochemistry. Molecular properties are compared with those of the O-analog, methyl formate. Both isomers present two conformers cis and trans. cis-CH 3 -S-CHO represents the most stable structure lying 4372.2 cm −1 below cis-CH 3 -O-CHS. The energy difference between the cis and trans forms is drastically lower for MSCHO (1134 cm −1 ) than for MOCHS (1963.6 cm −1 ). Harmonic and anharmonic fundamentals and the corresponding intensities, as well as the rotational constants for the ground vibrational and first excited torsional states and the centrifugal distortions constants, are provided. Low torsional energy levels have been obtained by solving variationally a two dimensional Hamiltonian expressed in terms of the two torsional degrees of freedom. The corresponding 2D potential energy surfaces have been computed at the CCSD(T)/aug-cc-pVTZ level of theory. The methyl torsional barriers V 3 (cis) are determined to be 139.7 cm −1 (CH 3 -S-CHO) and 670.4 cm −1 (CH 3 -O-CHS). The A/E splitting of ground torsional state has been estimated to be 0.438 cm −1 for CH 3 -S-CHO and negligible for CH 3 -O-CHS

Transgene-induced gene silencing is not affected by a change in ploidy level.

Directory of Open Access Journals (Sweden)

Daniela Pignatta

Full Text Available BACKGROUND: Whole genome duplication, which results in polyploidy, is a common feature of plant populations and a recurring event in the evolution of flowering plants. Polyploidy can result in changes to gene expression and epigenetic instability. Several epigenetic phenomena, occurring at the transcriptional or post-transcriptional level, have been documented in allopolyploids (polyploids derived from species hybrids of Arabidopsis thaliana, yet findings in autopolyploids (polyploids derived from the duplication of the genome of a single species are limited. Here, we tested the hypothesis that an increase in ploidy enhances transgene-induced post-transcriptional gene silencing using autopolyploids of A. thaliana. METHODOLOGY/PRINCIPAL FINDINGS: Diploid and tetraploid individuals of four independent homozygous transgenic lines of A. thaliana transformed with chalcone synthase (CHS inverted repeat (hairpin constructs were generated. For each line diploids and tetraploids were compared for efficiency in post-transcriptional silencing of the endogenous CHS gene. The four lines differed substantially in their silencing efficiency. Yet, diploid and tetraploid plants derived from these plants and containing therefore identical transgene insertions showed no difference in the efficiency silencing CHS as assayed by visual scoring, anthocyanin assays and quantification of CHS mRNA. CONCLUSIONS/SIGNIFICANCE: Our results in A. thaliana indicated that there is no effect of ploidy level on transgene-induced post-transcriptional gene silencing. Our findings that post-transcriptional mechanisms were equally effective in diploids and tetraploids supports the use of transgene-driven post-transcriptional gene silencing as a useful mechanism to modify gene expression in polyploid species.

CD1d knockout mice exhibit aggravated contact hypersensitivity responses due to reduced interleukin-10 production predominantly by regulatory B cells

DEFF Research Database (Denmark)

Fjelbye, Jonas; Antvorskov, Julie C; Buschard, Karsten

2015-01-01

.05) and peritoneal cavity (80.8% decrease; P challenge, which suggests an important regulatory and protective role of CD1d-dependent NKT cells in CHS in our model, at least in part via regulation of IL-10 producing B(regs) ....... knockout (CD1d KO) and wild-type (Wt) mice after contact allergen exposure. For induction of CHS, C57BL/6 CD1d KO mice (n = 6) and C57BL/6 Wt mice (n = 6) were sensitised with 1% (w/v) dinitrochlorobenzene (DNCB) or vehicle for three consecutive days and subsequently challenged with a single dose of 0...

Depletion of regulatory T cells in a hapten-induced inflammation model results in prolonged and increased inflammation driven by T cells

DEFF Research Database (Denmark)

Christensen, A. D.; Skov, Søren; Kvist, P. H.

2015-01-01

Regulatory T cells (Tregs ) are known to play an immunosuppressive role in the response of contact hypersensitivity (CHS), but neither the dynamics of Tregs during the CHS response nor the exaggerated inflammatory response after depletion of Tregs has been characterized in detail. In this study we...... show that the number of Tregs in the challenged tissue peak at the same time as the ear-swelling reaches its maximum on day 1 after challenge, whereas the number of Tregs in the draining lymph nodes peaks at day 2. As expected, depletion of Tregs by injection of a monoclonal antibody to CD25 prior...

Dicty_cDB: CHS443 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available fqskestin*kyfknafrw*n*ksrllygflgnviftickrislelfi r*f*fhfrefntr*yw*icnlfciingfpskn*sn*tifhrcssnpslfvgkc...iingfpskn*sn*tifhrcssnpslfvgkcyikysiq xng*ktkhxtxif*ix Frame B: *ts*ckiiismf**tiiesqldnldytsk*l*stlkyaslfsgr

Dicty_cDB: CHS280 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available *xxxmvpxmxgpksnxchsypq*xxmiitnvxlmhvpxkvv*lilqsmv mitmpvhlipvhhqlvfptpqltvmivihvp*xhvqiqpvv*tlqsmlmiiihvl*ml...vp nqqvsxipq*m*mittnvqlmhvpkkvv*lilqstlmitmpvqlilvhhqpvfptpqsiv mikrpvqlihvqiqlvv*ilqfpvtiiihvllilamt*lvvail

Dicty_cDB: CHS239 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available neering clone MHPN192d01. 42 9.9 1 AZ781723 |AZ781723.1 2M0021H18F Mouse 10kb plasm...end partial sequence. 42 9.9 1 CR029411 |CR029411.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engi

The use of reproductive healthcare at commune health stations in a changing health system in Vietnam

Science.gov (United States)

2011-01-01

Background With health sector reform in Vietnam moving towards greater pluralism, commune health stations (CHSs) have been subject to growing competition from private health services and increasing numbers of patients bypassing CHSs for higher-level health facilities. This study describes the pattern of reproductive health (RH) and family planning (FP) service utilization among women at CHSs and other health facilities, and explores socio-demographic determinants of RH service utilization at the CHS level. Methods This study was based on a cross-sectional survey conducted in Thua Thien Hue and Vinh Long provinces, using a multi-stage cluster sampling technique. Questionnaire-based interviews with 978 ever-married women at reproductive age provided data on socio-demographic characteristics, current use of FP methods, history of RH service use, and the health facility attended for their most recent services. Multiple logistic regression analyses were used to identify socio-demographic determinants of their use of CHS RH services. Results Eighty nine percent of ever-married women reported current use of birth control with 49% choosing intra-uterine device (IUD). Eighty nine percent of pregnant women attended facility-based antenatal care (ANC) with 62% having at least 3 check-ups during their latest pregnancy. Ninety one percent of mothers had their last delivery in a health facility. Seventy-one percent of respondents used CHS for IUD insertion, 55% for antenatal check-ups, and 77% gynecological examination. District and provincial/central hospitals dominated the provision of delivery service, used by 57% of mothers for their latest delivery. The percentage of women opting for private ANC services was reported at 35%, though the use of private delivery services was low (11%). Women who were farmers, earning a lower income, having more than 2 children, and living in a rural area were more likely than others to use ANC, delivery, and/or gynecological check-up services

The effect of a bidirectional exchange on faculty and institutional development in a global health collaboration.

Directory of Open Access Journals (Sweden)

Benjamin E Bodnar

Full Text Available The MUYU Collaboration is a partnership between Mulago Hospital-Makerere University College of Health Sciences (M-MakCHS, in Kampala, Uganda, and the Yale University School of Medicine. The program allows Ugandan junior faculty to receive up to 1 year of subspecialty training within the Yale hospital system. The authors performed a qualitative study to assess the effects of this program on participants, as well as on M-MakCHS as an institution.Data was collected via semi-structured interviews with exchange participants. Eight participants (67% of those eligible as of 4/2012 completed interviews. Study authors performed data analysis using standard qualitative data analysis techniques.Analysis revealed themes addressing the benefits, difficulties, and opportunities for improvement of the program. Interviewees described the main benefit of the program as its effect on their fund of knowledge. Participants also described positive effects on their clinical practice and on medical education at M-MakCHS. Most respondents cited financial issues as the primary difficulty of participation. Post-participation difficulties included resource limitations and confronting longstanding institutional and cultural habits. Suggestions for programmatic improvement included expansion of the program, ensuring appropriate management of pre-departure expectations, and refinement of program mentoring structures. Participants also voiced interest in expanding post-exchange programming to ensure both the use of and the maintenance of new capacity.The MUYU Collaboration has benefitted both program participants and M-MakCHS, though these benefits remain difficult to quantify. This study supports the assertion that resource-poor to resource-rich exchanges have the potential to provide significant benefits to the resource-poor partner.

Comparison of District-level Smoking Prevalence and Their Income Gaps from Two National Databases: the National Health Screening Database and the Community Health Survey in Korea, 2009-2014.

Science.gov (United States)

Kim, Ikhan; Bahk, Jinwook; Kim, Yeon Yong; Lee, Jeehye; Kang, Hee Yeon; Lee, Juyeon; Yun, Sung Cheol; Park, Jong Heon; Shin, Soon Ae; Khang, Young Ho

2018-02-05

We compared age-standardized prevalence of cigarette smoking and their income gaps at the district-level in Korea using the National Health Screening Database (NHSD) and the Community Health Survey (CHS). Between 2009 and 2014, 39,049,485 subjects participating in the NHSD and 989,292 participants in the CHS were analyzed. The age-standardized prevalence of smoking and their interquintile income differences were calculated for 245 districts of Korea. We examined between-period correlations for the age-standardized smoking prevalence at the district-level and investigated the district-level differences in smoking prevalence and income gaps between the two databases. The between-period correlation coefficients of smoking prevalence for both genders were 0.92-0.97 in NHSD and 0.58-0.69 in CHS, respectively. When using NHSD, we found significant income gaps in all districts for men and 244 districts for women. However, when CHS was analyzed, only 167 and 173 districts for men and women, respectively, showed significant income gaps. While correlation coefficients of district-level smoking prevalence from two databases were 0.87 for men and 0.85 for women, a relatively weak correlation between income gaps from the two databases was found. Based on two databases, income gaps in smoking prevalence were evident for nearly all districts of Korea. Because of the large sample size for each district, NHSD may provide stable district-level smoking prevalence and its income gap and thus should be considered as a valuable data source for monitoring district-level smoking prevalence and its socioeconomic inequality. © 2018 The Korean Academy of Medical Sciences.

Theoretical spectroscopic characterization at low temperatures of S-methyl thioformate and O-methyl thioformate

Energy Technology Data Exchange (ETDEWEB)

Senent, M. L., E-mail: senent@iem.cfmac.csic.es [Departamento de Química y Física Teóricas, Instituto de Estructura de la Materia, IEM-C.S.I.C., Serrano 121, Madrid 28006 (Spain); Puzzarini, C., E-mail: cristina.puzzarini@unibo.it [Dipartimento di Chimica G. Ciamician, Università di Bologna, Via F. Selmi 2, I-40126 Bologna (Italy); Hochlaf, M., E-mail: hochlaf@univ-mlv.fr [Laboratoire de Modélisation et Simulation Multi Echelle, Université Paris-Est, MSME UMR 8208 CNRS, 5 boulevard Descartes, 77454 Marne-la-Vallée (France); Domínguez-Gómez, R., E-mail: rosa.dominguez@upm.es [Departamento de Ingeniería Civil, Cátedra de Química, E.U.I.T. Obras Públicas, Universidad Politécnica de Madrid, Madrid (Spain); Carvajal, M., E-mail: miguel.carvajal@dfa.uhu.es [Departamento de Física Aplicada, Facultad de Ciencias Experimentales, Unidad Asociada IEM-CSIC-U.Huelva, Universidad de Huelva, 21071 Huelva (Spain)

2014-09-14

Highly correlated ab initio methods are employed to determine spectroscopic properties at low temperatures of two S-analogs of methyl formate: S-methyl thioformate CH{sub 3}-S-CHO (MSCHO) and O-methyl thioformate CH{sub 3}-O-CHS (MOCHS). Both species are detectable and they are expected to play an important role in Astrochemistry. Molecular properties are compared with those of the O-analog, methyl formate. Both isomers present two conformers cis and trans. cis-CH{sub 3}-S-CHO represents the most stable structure lying 4372.2 cm{sup −1} below cis-CH{sub 3}-O-CHS. The energy difference between the cis and trans forms is drastically lower for MSCHO (1134 cm{sup −1}) than for MOCHS (1963.6 cm{sup −1}). Harmonic and anharmonic fundamentals and the corresponding intensities, as well as the rotational constants for the ground vibrational and first excited torsional states and the centrifugal distortions constants, are provided. Low torsional energy levels have been obtained by solving variationally a two dimensional Hamiltonian expressed in terms of the two torsional degrees of freedom. The corresponding 2D potential energy surfaces have been computed at the CCSD(T)/aug-cc-pVTZ level of theory. The methyl torsional barriers V{sub 3}(cis) are determined to be 139.7 cm{sup −1} (CH{sub 3}-S-CHO) and 670.4 cm{sup −1} (CH{sub 3}-O-CHS). The A/E splitting of ground torsional state has been estimated to be 0.438 cm{sup −1} for CH{sub 3}-S-CHO and negligible for CH{sub 3}-O-CHS.

Multihopping Multilevel Clustering Heterogeneity-Sensitive Optimized Routing Protocol for Wireless Sensor Networks

Directory of Open Access Journals (Sweden)

Muhammad Aslam

2017-01-01

Full Text Available Effective utilization of energy resources in Wireless Sensor Networks (WSNs has become challenging under uncertain distributed cluster-formation and single-hop intercluster communication capabilities. So, sensor nodes are forced to operate at expensive full rate transmission power level continuously during whole network operation. These challenging network environments experience unwanted phenomena of drastic energy consumption and packet drop. In this paper, we propose an adaptive immune Multihopping Multilevel Clustering (MHMLC protocol that executes a Hybrid Clustering Algorithm (HCA to perform optimal centralized selection of Cluster-Heads (CHs within radius of centrally located Base Station (BS and distributed CHs selection in the rest of network area. HCA of MHMLC also produces optimal intermediate CHs for intercluster multihop communications that develop heterogeneity-aware economical links. This hybrid cluster-formation facilitates the sensors to function at short range transmission power level that enhances link quality and avoids packet drop. The simulation environments produce fair comparison among proposed MHMLC and existing state-of-the-art routing protocols. Experimental results give significant evidence of better performance of the proposed model in terms of network lifetime, stability period, and data delivery ratio.

CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE

Energy Technology Data Exchange (ETDEWEB)

Jang, Minhwan; Choe, G. S. [Department of Astronomy and Space Science, Kyung Hee University, Yongin 17104 (Korea, Republic of); Woods, T. N. [Laboratory for Atmospheric and Space Physics, University of Colorado, Boulder, CO 80303 (United States); Hong, Sunhak, E-mail: gchoe@khu.ac.kr [School of Space Research, Kyung Hee University, Yongin 17104 (Korea, Republic of)

2016-12-10

It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.

Lack of the purinergic receptor P2X7 results in resistance to contact hypersensitivity

Science.gov (United States)

Weber, Felix C.; Esser, Philipp R.; Müller, Tobias; Ganesan, Jayanthi; Pellegatti, Patrizia; Simon, Markus M.; Zeiser, Robert; Idzko, Marco; Jakob, Thilo

2010-01-01

Sensitization to contact allergens requires activation of the innate immune system by endogenous danger signals. However, the mechanisms through which contact allergens activate innate signaling pathways are incompletely understood. In this study, we demonstrate that mice lacking the adenosine triphosphate (ATP) receptor P2X7 are resistant to contact hypersensitivity (CHS). P2X7-deficient dendritic cells fail to induce sensitization to contact allergens and do not release IL-1β in response to lipopolysaccharide (LPS) and ATP. These defects are restored by pretreatment with LPS and alum in an NLRP3- and ASC-dependent manner. Whereas pretreatment of wild-type mice with P2X7 antagonists, the ATP-degrading enzyme apyrase or IL-1 receptor antagonist, prevents CHS, IL-1β injection restores CHS in P2X7-deficient mice. Thus, P2X7 is a crucial receptor for extracellular ATP released in skin in response to contact allergens. The lack of P2X7 triggering prevents IL-1β release, which is an essential step in the sensitization process. Interference with P2X7 signaling may be a promising strategy for the prevention of allergic contact dermatitis. PMID:21059855

CORONAL DYNAMIC ACTIVITIES IN THE DECLINING PHASE OF A SOLAR CYCLE

International Nuclear Information System (INIS)

Jang, Minhwan; Choe, G. S.; Woods, T. N.; Hong, Sunhak

2016-01-01

It has been known that some solar activity indicators show a double-peak feature in their evolution through a solar cycle, which is not conspicuous in sunspot number. In this Letter, we investigate the high solar dynamic activity in the declining phase of the sunspot cycle by examining the evolution of polar and low-latitude coronal hole (CH) areas, splitting and merging events of CHs, and coronal mass ejections (CMEs) detected by SOHO /LASCO C3 in solar cycle 23. Although the total CH area is at its maximum near the sunspot minimum, in which polar CHs prevail, it shows a comparable second maximum in the declining phase of the cycle, in which low-latitude CHs are dominant. The events of CH splitting or merging, which are attributed to surface motions of magnetic fluxes, are also mostly populated in the declining phase of the cycle. The far-reaching C3 CMEs are also overpopulated in the declining phase of the cycle. From these results we suggest that solar dynamic activities due to the horizontal surface motions of magnetic fluxes extend far in the declining phase of the sunspot cycle.

The impact of an integrated hospital-community medical information system on quality and service utilization in hospital departments.

Science.gov (United States)

Nirel, Nurit; Rosen, Bruce; Sharon, Assaf; Blondheim, Orna; Sherf, Michael; Samuel, Hadar; Cohen, Arnon D

2010-09-01

In 2005, an innovative system of hospital-community on-line medical records (OFEK) was implemented at Clalit Health Services (CHS). The goals of the study were to examine the extent of OFEK's use and its impact on quality indicators and medical-service utilization in Internal Medicine and General Surgery wards of CHS hospitals. Examining the frequency of OFEK's use with its own track-log data; comparing, "before" and "after", quality indicators and service utilization data in experimental (CHS patients) versus control groups (other patients). OFEK's use increased by tens of percentages each year, Internal Medicine wards showed a significant decrease in the number of laboratory tests and 3 CT tests performed compared with the control group. Wards using OFEK extensively showed a greater decrease in CT tests, in one imaging test, and in the average number of ambulatory hospitalizations. No similar changes were found in General Surgery wards. The study helps evaluate the extent to which OFEK's targets were achieved and contributes to the development of measures to examine the impact of such systems, which can be used to assess a broad range of Health Information Technology (HIT) systems. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.

Widening and Elaboration of Consecutive Research into Therapeutic Antioxidant Enzyme Derivatives

Directory of Open Access Journals (Sweden)

Alexander V. Maksimenko

2016-01-01

Full Text Available Undiminishing actuality of enzyme modification for therapeutic purposes has been confirmed by application of modified enzymes in clinical practice and numerous research data on them. Intravenous injection of the superoxide dismutase-chondroitin sulfate-catalase (SOD-CHS-CAT conjugate in preventive and medicative regimes in rats with endotoxin shock induced with a lipopolysaccharide bolus has demonstrated that antioxidant agents not only effectively prevent damage caused by oxidative stress (as believed previously but also can be used for antioxidative stress therapy. The results obtained emphasize the importance of investigation into the pathogenesis of vascular damage and the role of oxidative stress in it. The effects of intravenous medicative injection of SOD-CHS-CAT in a rat model of endotoxin shock have demonstrated a variety in the activity of this conjugate in addition to prevention of NO conversion in peroxynitrite upon interaction with O2∙- superoxide radical. Together with the literature data, these findings offer a prospect for the study of NO-independent therapeutic effects of SOD-CHS-CAT, implying the importance of a better insight into the mechanisms of the conjugate activity in modeled cardiovascular damage involving vasoactive agents other than NO.

Modular coils: a promising toroidal-reactor-coil system

International Nuclear Information System (INIS)

Chu, T.K.; Furth, H.P.; Johnson, J.L.; Ludescher, C.; Weimer, K.E.

1981-04-01

The concept of modular coils originated from a need to find reactor-relevant stellarator windings, but its usefulness can be extended to provide an externally applied, additional rotational transform in tokamaks. Considerations of (1) basic principles of modular coils, (2) types of coils, (3) types of configurations (general, helically symmetric, helically asymmetric, with magnetic well, with magnetic hill), (4) types of rotational transform profile, and (5) structure and origin of ripples are given. These results show that modular coils can offer a wide range of vacuum magnetic field configurations, some of which cannot be obtained with the classical stellarator or torsatron coil configuration

Contracting with private providers for primary care services: evidence from urban China.

Science.gov (United States)

Wang, Yan; Eggleston, Karen; Yu, Zhenjie; Zhang, Qiong

2013-01-17

Controversy surrounds the role of the private sector in health service delivery, including primary care and population health services. China's recent health reforms call for non-discrimination against private providers and emphasize strengthening primary care, but formal contracting-out initiatives remain few, and the associated empirical evidence is very limited. This paper presents a case study of contracting with private providers for urban primary and preventive health services in Shandong Province, China. The case study draws on three primary sources of data: administrative records; a household survey of over 1600 community residents in Weifang and City Y; and a provider survey of over 1000 staff at community health stations (CHS) in both Weifang and City Y. We supplement the quantitative data with one-on-one, in-depth interviews with key informants, including local officials in charge of public health and government finance.We find significant differences in patient mix: Residents in the communities served by private community health stations are of lower socioeconomic status (more likely to be uninsured and to report poor health), compared to residents in communities served by a government-owned CHS. Analysis of a household survey of 1013 residents shows that they are more willing to do a routine health exam at their neighborhood CHS if they are of low socioeconomic status (as measured either by education or income). Government and private community health stations in Weifang did not statistically differ in their performance on contracted dimensions, after controlling for size and other CHS characteristics. In contrast, the comparison City Y had lower performance and a large gap between public and private providers. We discuss why these patterns arose and what policymakers and residents considered to be the main issues and concerns regarding primary care services.

Tc1-mediated contact sensitivity reaction, its mechanism and regulation

Directory of Open Access Journals (Sweden)

Magdalena Zemelka-Wiącek

2014-07-01

Full Text Available The contact hypersensitivity reaction (CHS to haptens is a classic example of cell-mediated immune response. In the effector phase, two stages can be distinguished: an early component, that appears only 2 hours after subsequent contact with the hapten, and the late component that develops approximately 24 hours later which is mediated by TCRαβ+ cells. The effector lymphocytes may be CD4+ T helper 1 (Th1 cells or CD8+ T cytotoxic 1 (Tc1 cells, which depends on the employed hapten and/or mice strain. NKT lymphocytes play the crucial role in the CHS initiation, by supporting B1 cells in the antigen-specific IgM antibodies production. The development of an early component is essential for the recruitment of T effector (Teff cells to the side of hapten deposition and for the complete expansion of inflammatory reaction. The CHS reaction is under T regulatory (Treg cells control, both in the induction phase as well as in the effector phase. A new view of a negative regulation of the Tc1 mediated CHS response is based on the suppression induced by epicutaneous (EC application of protein antigen. The DNP-BSA skin application, on a gauze patch, leads to a state of immunosuppression. This maneuver results in rising the population of Treg cells with TCRαβ+CD4+CD25+Foxp3+ phenotype. The mechanism of suppression requires direct contact between Treg cells and Teff cells and the participation of CTLA-4 molecule is also necessary. The described method of evoking immune tolerance via EC immunization may contribute to elaborate a new method of allergic contact dermatitis therapy. This is because of its effectiveness, ease of induction and non-invasive protein antigen application.

Contracting with private providers for primary care services: evidence from urban China

Science.gov (United States)

2013-01-01

Controversy surrounds the role of the private sector in health service delivery, including primary care and population health services. China’s recent health reforms call for non-discrimination against private providers and emphasize strengthening primary care, but formal contracting-out initiatives remain few, and the associated empirical evidence is very limited. This paper presents a case study of contracting with private providers for urban primary and preventive health services in Shandong Province, China. The case study draws on three primary sources of data: administrative records; a household survey of over 1600 community residents in Weifang and City Y; and a provider survey of over 1000 staff at community health stations (CHS) in both Weifang and City Y. We supplement the quantitative data with one-on-one, in-depth interviews with key informants, including local officials in charge of public health and government finance. We find significant differences in patient mix: Residents in the communities served by private community health stations are of lower socioeconomic status (more likely to be uninsured and to report poor health), compared to residents in communities served by a government-owned CHS. Analysis of a household survey of 1013 residents shows that they are more willing to do a routine health exam at their neighborhood CHS if they are of low socioeconomic status (as measured either by education or income). Government and private community health stations in Weifang did not statistically differ in their performance on contracted dimensions, after controlling for size and other CHS characteristics. In contrast, the comparison City Y had lower performance and a large gap between public and private providers. We discuss why these patterns arose and what policymakers and residents considered to be the main issues and concerns regarding primary care services. PMID:23327666

Efficacy of Poly(D,L-Lactic Acid-co-Glycolic acid)-Poly(Ethylene Glycol)-Poly(D,L-Lactic Acid-co-Glycolic Acid) Thermogel As a Barrier to Prevent Spinal Epidural Fibrosis in a Postlaminectomy Rat Model.

Science.gov (United States)

Li, Xiangqian; Chen, Lin; Lin, Hong; Cao, Luping; Cheng, Ji'an; Dong, Jian; Yu, Lin; Ding, Jiandong

2017-04-01

Experimental animal study. The authors conducted a study to determine the efficacy and safety of the poly(D,L-lactic acid-co-glycolic acid)-poly(ethylene glycol)-poly(D,L-lactic acid-co-glycolic acid) (PLGA-PEG-PLGA) thermogel to prevent peridural fibrosis in an adult rat laminectomy model. Peridural fibrosis often occurs after spinal laminectomy. It might cause persistent back and/or leg pain postoperatively and make a reoperation more difficult and dangerous. Various materials have been used to prevent epidural fibrosis, but only limited success has been achieved. The PLGA-PEG-PLGA thermogel was synthesized by us. Total L3 laminectomies were performed on 24 rats. The PLGA-PEG-PLGA thermogel or chitosan (CHS) gel (a positive control group) was applied to the operative sites in a blinded manner. In the control group, the L3 laminectomy was performed and the defect was irrigated with the NS solution 3 times. All the rats were killed 4 weeks after the surgery. The cytotoxicity of this thermogel was evaluated in vitro and the result demonstrated that no evidence of cytotoxicity was observed. The extent of epidural fibrosis, the area of epidural fibrosis, and the density of the fibroblasts and blood vessel were evaluated histologically. There were statistical differences among the PLGA-PEG-PLGA thermogel or CHS gel group compared with the control group. Although there was no difference between the PLGA-PEG-PLGA thermogel and CHS gel, the efficiency of the PLGA-PEG-PLGA thermogel was shown to be slightly improved compared with the CHS gel. The biocompatibility of the PLGA-PEG-PLGA thermogel was proven well. The application of this thermogel effectively reduced epidural scarring and prevented the subsequent adhesion to the dura mater. No side effects were noted in the rats.

Is Patient Support Program Participation Associated with Longer Persistence and Improved Adherence Among New Users of Adalimumab? A Retrospective Cohort Study.

Science.gov (United States)

Srulovici, Einav; Garg, Vishvas; Ghilai, Adi; Feldman, Becca; Hoshen, Moshe; Balicer, Ran D; Skup, Martha; Leventer-Roberts, Maya

2018-05-10

Adalimumab (ADA) is a medication used in the treatment of several autoimmune diseases. Despite the beneficial effects of ADA, its adherence and persistence rates are low. Patients treated with ADA from Clalit Health Services (CHS) can enroll in AbbVie's patient support program (PSP), which aims to improve ADA adherence and persistence. Therefore, we examine whether PSP participation is associated with a longer persistence and/or an improved adherence to ADA. A real-world retrospective cohort study of all new ADA users from CHS, comparing those enrolled in the offered PSP to those not enrolled. The data regarding PSP users can be tracked using CHS's data warehouse. The index date was defined as the date of the patients' first purchase of ADA occurring between August 1, 2012 and December 31, 2014. The follow-up data were collected at 12, 24, and 36 months. Persistence was assessed using survival analyses of time until discontinuation, and adherence was assessed using medication possession ratio (MPR). There were 1520 patients in the study, 755 (49.7%) of whom were PSP users. PSP users were 54.3% female vs. 51.9% among non-PSP users (p = 0.355) and they were significantly younger than non-PSP users (mean age 42.3 vs. 45.0 years, p = 0.002) The PSP and non-PSP users' persistence was 673 and 574 days, respectively (p users were more likely than the non-PSP users to be persistently taking medication at the 12-month follow-up (57.5% vs. 45.6%, p users compared to the non-PSP users (94.1% vs. 92.9%, p = 0.026). The AbbVie PSP provided to CHS patients was associated with a longer persistence among new users of ADA. It was also associated with significantly higher adherence rate within the first 12 months. AbbVie Inc.

Dynamic analysis of compact helical system power supply and designs of its upgrade

International Nuclear Information System (INIS)

Tanahashi, S.; Yamada, S.

1991-09-01

Computed dynamic waveforms are compared with measured ones for the power supply of the Compact Helical System (CHS) during 1.5T operation and found to be in good agreement. On the basis of these results, designs for the upgraded power supply for 2T operation are discussed in the two cases, with and without power consumption for additional heating. In the former case, the additional heating power is supplied from the ac generator that powers the CHS coils. Electric voltages and currents in the electric circuit are shown for both cases. These designs show the possibility for 2T operation by addition of some components without changing the ratings of existing components. (author)

Genome-wide identification of lncRNAs associated with chlorantraniliprole resistance in diamondback moth Plutella xylostella (L.).

Science.gov (United States)

Zhu, Bin; Xu, Manyu; Shi, Haiyan; Gao, Xiwu; Liang, Pei

2017-05-15

Long noncoding RNAs (lncRNAs) are now considered important regulatory factors, with a variety of biological functions in many species including insects. Some lncRNAs have the ability to show rapid responses to diverse stimuli or stress factors and are involved in responses to insecticide. However, there are no reports to date on the characterization of lncRNAs associated with chlorantraniliprole resistance in Plutella xylostella. Nine RNA libraries constructed from one susceptible (CHS) and two chlorantraniliprole-resistant P. xylostella strains (CHR, ZZ) were sequenced, and 1309 lncRNAs were identified, including 877 intergenic lncRNAs, 190 intronic lncRNAs, 76 anti-sense lncRNAs and 166 sense-overlapping lncRNAs. Of the identified lncRNAs, 1059 were novel. Furthermore, we found that 64 lncRNAs were differentially expressed between CHR and CHS and 83 were differentially expressed between ZZ and CHS, of which 22 were differentially expressed in both CHR and ZZ. Most of the differentially expressed lncRNAs were hypothesized to be associated with chlorantraniliprole resistance in P. xylostella. The targets of lncRNAs via cis- ( 0.9 or xylostella. These results will facilitate future studies of the regulatory mechanisms of lncRNAs in chlorantraniliprole and other insecticide resistance and in other biological processes in P. xylostella.

Global identification of microRNAs associated with chlorantraniliprole resistance in diamondback moth Plutella xylostella (L.)

Science.gov (United States)

Zhu, Bin; Li, Xiuxia; Liu, Ying; Gao, Xiwu; Liang, Pei

2017-01-01

The diamondback moth (DBM), Plutella xylostella (L.), is one of the most serious cruciferous pests and has developed high resistance to most insecticides, including chlorantraniliprole. Previous studies have reported several protein-coding genes that involved in chlorantraniliprole resistance, but research on resistance mechanisms at the post-transcription level is still limited. In this study, a global screen of microRNAs (miRNAs) associated with chlorantraniliprole resistance in P. xylostella was performed. The small RNA libraries for a susceptible (CHS) and two chlorantraniliprole resistant strains (CHR, ZZ) were constructed and sequenced, and a total of 199 known and 30 novel miRNAs were identified. Among them, 23 miRNAs were differentially expressed between CHR and CHS, and 90 miRNAs were differentially expressed between ZZ and CHS, of which 11 differentially expressed miRNAs were identified in both CHR and ZZ. Using miRanda and RNAhybrid, a total of 1,411 target mRNAs from 102 differentially expressed miRNAs were predicted, including mRNAs in several groups of detoxification enzymes. The expression of several differentially expressed miRNAs and their potential targets was validated by qRT-PCR. The results may provide important clues for further study of the mechanisms of miRNA-mediated chlorantraniliprole resistance in DBM and other target insects. PMID:28098189

Levels of potential bioactive compounds including carotenoids, vitamin C and phenolic compounds, and expression of their cognate biosynthetic genes vary significantly in different varieties of potato (Solanum tuberosum L.) grown under uniform cultural conditions.

Science.gov (United States)

Valcarcel, Jesus; Reilly, Kim; Gaffney, Michael; O'Brien, Nora M

2016-02-01

In addition to their high carbohydrate content, potatoes are also an important dietary source of vitamin C and bioactive secondary metabolites, including phenolic compounds and carotenoids, which have been suggested to play a role in human health. The expression of genes encoding key enzymes involved in the synthesis of these compounds was assessed by reverse transcription-quantitative polymerase chain reaction and compared to the accumulation of the corresponding product in seven potato varieties showing contrasting levels of metabolite accumulation. Strong positive correlations were found between phenolic content in the flesh of tubers and transcript levels of phenylalanine ammonia lyase (PAL) and chalcone synthase (CHS) genes. The expression of PAL and CHS was also related to that of AN1, a transcription factor involved in the synthesis of anthocyanins, suggesting that these genes are regulated in a coordinated manner. No clear relationship was found between transcript levels of phytoene synthase (PSY) or L-galactono-1,4-lactone dehydrogenase (GLDH) genes and total carotenoid or vitamin C accumulation, respectively. Data indicate that levels of total phenolic and flavonoid compounds in potato are controlled primarily by PAL and CHS gene expression. Transcript levels of PSY and GLDH did not control accumulation of carotenoids or vitamin C. © 2015 Society of Chemical Industry.

Primary Spinal Chondrosarcoma: Radiologic Findings with Pathologic Correlation

International Nuclear Information System (INIS)

Lloret, I.; Server, A.; Bjerkehagen, B.

2006-01-01

Purpose: To describe the radiologic appearance of the four types of primary spinal chondrosarcoma (CHS) (conventional intramedullary, juxtacortical, clear cell, and mesenchymal) and to correlate with histopathologic findings. Material and Methods: A retrospective review was carried out of 5 patients with histopathologically confirmed primary spinal CHS; 3 F and 2 M ranging in age between 27 and 66 years (mean 40.2; median 39). Charts, conventional radiographs, computed tomography scans, and magnetic resonance images were reviewed. All the patients underwent surgical excision, followed by postoperative chemotherapy (1 patient) and radiotherapy (3 patients). Follow-up was available for all patients but one. The mean follow-up was 42 months (14-120 months). Histopathological specimens for all patients were available for review. Results: Vertebral column distribution was 3 thoracic (60%), 1 cervical (20%), and 1 lumbar (20%). Neurological deficits were present in 3 (60%) cases. The radiological appearance of the four types of primary spinal CHS varies with specific lesion type. Imaging findings suggest diagnosis of the conventional intramedullary and juxtacortical types. While the clear cell and mesenchymal types show some distinctive features, these do not allow confident radiologic diagnosis. Conclusion: The radiologist must be aware of imaging features of these tumors in order to improve diagnostic accuracy, treatment planning, and prognosis

A Second Glass Transition in Pressure Collapsed Type II Clathrate Hydrates.

Science.gov (United States)

Andersson, Ove; Häussermann, Ulrich

2018-04-19

Type II clathrate hydrates (CHs) M·17 H 2 O, with M = tetrahydrofuran (THF) or 1,3-dioxolane, are known to collapse, or amorphize, on pressurization to ∼1.3 GPa in the temperature range 77-140 K. On heating at 1 GPa, these pressure-amorphized CH states show a weak, stretched sigmoid-shaped, heat-capacity increase because of a glass transition. Here we use thermal conductivity and heat capacity measurements to show that also type II CH with M = cyclobutanone (CB) collapses on isothermal pressurization and undergoes a similar, weak, glass transition upon heating at 1 GPa. Furthermore, we reveal for both THF CH and CB CH a second, much more pronounced, glass transition at temperatures above the thermally weak glass transition on heating in the 0.2-0.7 GPa range. This result suggests the general occurrence of two glass transitions in water-rich (94 mol %) pressure-collapsed CHs. Because of a large increase in dielectric permittivity concurrently as the weak heat capacity increase, the first glass transition must be due to kinetic unfreezing of water molecules. The thermal features of the second glass transition, measured on isobaric temperature cycling, are typical of a glass-liquid-glass transition, which suggests that pressure-amorphized CHs transform reversibly to liquids.

Preparation and optimization of self-assembled chondroitin sulfate-nisin nanogel based on quality by design concept.

Science.gov (United States)

Mohtashamian, Shahab; Boddohi, Soheil; Hosseinkhani, Saman

2018-02-01

Self-assembled nanogel was prepared by electrostatic complexation of two oppositely charged biological macromolecules, which were cationic nisin and anionic chondroitin sulfate (ChS). The critical factors affected the physical properties of ChS-nisin nanogel was screened and optimized by Plackett-Burman design (PB) and central composite design (CCD). The independent factors selected were: concentration ratio of nisin to ChS, injection rate of nisin solution, buffer solvent type, magnetic stirring rate, pH of initial buffer solution, centrifuge-cooling temperature, and centrifuge rotation speed. Among these factors, concentration ratio changed the entrapment efficiency and loading capacity significantly. In addition, the hydrodynamic diameter and loading capacity were significantly influenced by injection rate and pH of initial buffer solution. The optimized nanogel structure was obtained by concentration ratio of 6.4mg/mL nisin to 1mg/mL ChS, pH of buffer solution at 4.6, and nisin solution injection rate of 0.2mL/min. The observed values of dependent responses were close to predicted values confirmed by model from response surface methodology. The results obviously showed that quality by design concept (QbD) could be effectively applied to optimize the developed ChS-nisin nanogel. Copyright © 2017 Elsevier B.V. All rights reserved.

Primary Spinal Chondrosarcoma: Radiologic Findings with Pathologic Correlation

Energy Technology Data Exchange (ETDEWEB)

Lloret, I.; Server, A. [The Norwegian Radium Hospital, Oslo (Norway). Depts. of Radiology and Pathology; Bjerkehagen, B. [Ullevaal Univ. Hospital, Oslo (Norway). Dept. of Neuroradiology

2006-02-15

Purpose: To describe the radiologic appearance of the four types of primary spinal chondrosarcoma (CHS) (conventional intramedullary, juxtacortical, clear cell, and mesenchymal) and to correlate with histopathologic findings. Material and Methods: A retrospective review was carried out of 5 patients with histopathologically confirmed primary spinal CHS; 3 F and 2 M ranging in age between 27 and 66 years (mean 40.2; median 39). Charts, conventional radiographs, computed tomography scans, and magnetic resonance images were reviewed. All the patients underwent surgical excision, followed by postoperative chemotherapy (1 patient) and radiotherapy (3 patients). Follow-up was available for all patients but one. The mean follow-up was 42 months (14-120 months). Histopathological specimens for all patients were available for review. Results: Vertebral column distribution was 3 thoracic (60%), 1 cervical (20%), and 1 lumbar (20%). Neurological deficits were present in 3 (60%) cases. The radiological appearance of the four types of primary spinal CHS varies with specific lesion type. Imaging findings suggest diagnosis of the conventional intramedullary and juxtacortical types. While the clear cell and mesenchymal types show some distinctive features, these do not allow confident radiologic diagnosis. Conclusion: The radiologist must be aware of imaging features of these tumors in order to improve diagnostic accuracy, treatment planning, and prognosis.

Using Smart Pumps to Understand and Evaluate Clinician Practice Patterns to Ensure Patient Safety

Science.gov (United States)

Mansfield, Jennifer; Jarrett, Steven

2013-01-01

Background: Safety software installed on intravenous (IV) infusion pumps has been shown to positively impact the quality of patient care through avoidance of medication errors. The data derived from the use of smart pumps are often overlooked, although these data provide helpful insight into the delivery of quality patient care. Objective: The objectives of this report are to describe the value of implementing IV infusion safety software and analyzing the data and reports generated by this system. Case study: Based on experience at the Carolinas HealthCare System (CHS), executive score cards provide an aggregate view of compliance rate, number of alerts, overrides, and edits. The report of serious errors averted (ie, critical catches) supplies the location, date, and time of the critical catch, thereby enabling management to pinpoint the end-user for educational purposes. By examining the number of critical catches, a return on investment may be calculated. Assuming 3,328 of these events each year, an estimated cost avoidance would be $29,120,000 per year for CHS. Other reports allow benchmarking between institutions. Conclusion: A review of the data about medication safety across CHS has helped garner support for a medication safety officer position with the goal of ultimately creating a safer environment for the patient. PMID:24474836

Immunotoxicity of epicutaneously applied anticoagulant rodenticide warfarin: evaluation by contact hypersensitivity to DNCB in rats

International Nuclear Information System (INIS)

Kataranovski, Milena; Vlaski, Marija; Kataranovski, Dragan; Tosic, Natasa; Mandic-Radic, Slavka; Todorovic, Vera

2003-01-01

The immunotoxicity of epicutaneously administered anticoagulant rodenticide warfarin (WF) was examined in this work by using experimental contact hypersensitivity (CHS) reaction to hapten dinitrochlorobenzene (DNCB). WF (0.05 and 0.5 mg/kg) administration 24 h before the induction of CHS does not change expression of CHS evaluated by ear swelling assay. Regional draining lymph node response during sensitization phase was characterized by decreased cellularity but increased spontaneous and IL-2 stimulated proliferation of draining lymph node cells (DLC). No changes in IL-2 production and in numbers of CD25 + cells were noted and even decreased proliferative index (ratio of IL-2 stimulated to unstimulated DLC proliferation) was detected. Increase in granulocyte activity (MTT reduction and adhesion to plastic) was noted following application of WF solely with further increase following subsequent application of DNCB, when granulocyte activation (NBT reduction) was noted also. Access of WF into general circulation might be responsible for observed changes, what was supported by ex vivo changes in DLC and granulocyte functions assessed before initiation of sensitization and by in vitro effect of exogenous WF as well. Differential effects of WF on lymphocytes and granulocytes noted in this study highlight the need for simultaneous testing of both cell type activity what might constitute a more integrated approach in immunotoxicity studies

Rod internal pressure quantification and distribution analysis using Frapcon

Energy Technology Data Exchange (ETDEWEB)

Jessee, Matthew Anderson [ORNL; Wieselquist, William A [ORNL; Ivanov, Kostadin [Pennsylvania State University, University Park

2015-09-01

This report documents work performed supporting the Department of Energy (DOE) Office of Nuclear Energy (NE) Fuel Cycle Technologies Used Fuel Disposition Campaign (UFDC) under work breakdown structure element 1.02.08.10, ST Analysis. In particular, this report fulfills the M4 milestone M4FT- 15OR0810036, Quantify effects of power uncertainty on fuel assembly characteristics, within work package FT-15OR081003 ST Analysis-ORNL. This research was also supported by the Consortium for Advanced Simulation of Light Water Reactors (http://www.casl.gov), an Energy Innovation Hub (http://www.energy.gov/hubs) for Modeling and Simulation of Nuclear Reactors under U.S. Department of Energy Contract No. DE-AC05-00OR22725. The discharge rod internal pressure (RIP) and cladding hoop stress (CHS) distributions are quantified for Watts Bar Nuclear Unit 1 (WBN1) fuel rods by modeling core cycle design data, operation data (including modeling significant trips and downpowers), and as-built fuel enrichments and densities of each fuel rod in FRAPCON-3.5. A methodology is developed which tracks inter-cycle assembly movements and assembly batch fabrication information to build individual FRAPCON inputs for each evaluated WBN1 fuel rod. An alternate model for the amount of helium released from the zirconium diboride (ZrB2) integral fuel burnable absorber (IFBA) layer is derived and applied to FRAPCON output data to quantify the RIP and CHS for these types of fuel rods. SCALE/Polaris is used to quantify fuel rodspecific spectral quantities and the amount of gaseous fission products produced in the fuel for use in FRAPCON inputs. Fuel rods with ZrB2 IFBA layers (i.e., IFBA rods) are determined to have RIP predictions that are elevated when compared to fuel rod without IFBA layers (i.e., standard rods) despite the fact that IFBA rods often have reduced fill pressures and annular fuel pellets. The primary contributor to elevated RIP predictions at burnups less than and greater than 30 GWd

A DISTRIBUTED ENERGY EFFICIENT CLUSTERING ALGORITHM FOR DATA AGGREGATION IN WIRELESS SENSOR NETWORKS

Directory of Open Access Journals (Sweden)

Seyed Mohammad Bagher Musavi Shirazi

2018-06-01

Full Text Available Wireless sensor networks (WSNs are a new generation of networks typically consisting of a large number of inexpensive nodes with wireless communications. The main purpose of these networks is to collect information from the environment for further processing. Nodes in the network have been equipped with limited battery lifetime, so energy saving is one of the major issues in WSNs. If we balance the load among cluster heads and prevent having an extra load on just a few nodes in the network, we can reach longer network lifetime. One solution to control energy consumption and balance the load among nodes is to use clustering techniques. In this paper, we propose a new distributed energy-efficient clustering algorithm for data aggregation in wireless sensor networks, called Distributed Clustering for Data Aggregation (DCDA. In our new approach, an optimal transmission tree is constructed among sensor nodes with a new greedy method. Base station (BS is the root, cluster heads (CHs and relay nodes are intermediate nodes, and other nodes (cluster member nodes are the leaves of this transmission tree. DCDA balances load among CHs in intra-cluster and inter-cluster data communications using different cluster sizes. For efficient inter-cluster communications, some relay nodes will transfer data between CHs. Energy consumption, distance to the base station, and cluster heads’ centric metric are three main adjustment parameters for the cluster heads election. Simulation results show that the proposed protocol leads to the reduction of individual sensor nodes’ energy consumption and prolongs network lifetime, in comparison with other known methods. ABSTRAK: Rangkaian sensor wayarles (WSN adalah rangkaian generasi baru yang terdiri daripada nod-nod murah komunikasi wayarles. Tujuan rangkaian-rangkaian ini adalah bagi mengumpul maklumat sekeliling untuk proses seterusnya. Nod dalam rangkaian ini dilengkapi bateri kurang jangka hayat, jadi simpanan tenaga

Increased understanding of neoclassical internal transport barrier on CHS

International Nuclear Information System (INIS)

Minami, T.; Fujisawa, A.; Iguchi, H.

2002-10-01

We report the recent progress of the study on neoclassical internal transport barrier (N-ITB) on Compact Helical System experiment. N-ITB has been observed for EC heated NBI plasma. The improved confinement region for electrons is expanded compared to that of the previous N-ITB plasma heated by only ECH. Moreover, the ion temperature is found to be increased simultaneously by about two to three times (T i (0) ∼ 400-500 eV) with steep gradient region at ρ - 0.6. From the measurement of the averaged peak energy intensity using the soft X-ray CCD camera it is confirmed that the impurity confinement is also improved with N-ITB. The radial electric field is observed to bifurcate into electron root (E r - 15 kV/m) and rather large electric field shear (dE r /dr - 300 kV/m 2 ) is produced in the layer between ion and electron root. (author)

Increased understanding of neoclassical internal transport barrier on CHS

International Nuclear Information System (INIS)

Minami, T.; Fujisawa, A.; Iguchi, H.

2003-01-01

We report the recent progress of the study on neoclassical internal transport barrier (N-ITB) on Compact Helical System experiment. N-ITB has been observed for EC heated NBI plasma. The improved confinement region for electrons is expanded compared to that of the previous N-ITB plasma heated by only ECH. Moreover, the ion temperature is found to be increased simultaneously by about two to three times (T i (0)∼400-500eV) with steep gradient region at ρ∼0.6. From the measurement of the averaged peak energy intensity using the soft X-ray CCD camera it is confirmed that the impurity confinement is also improved with N-ITB. The radial electric field is observed to bifurcate into electron root (E r ∼15kV/m) and rather large electric field shear (dE r /dr∼300kV/m 2 ) is produced in the layer between ion and electron root. (author)

Increased understanding of neoclassical internal transport barrier on CHS

International Nuclear Information System (INIS)

Minami, T.; Fujisawa, A.; Iguchi, H.

2002-01-01

We report the recent progress of the study on neoclassical internal transport barrier (N-ITB) on Compact Helical System experiment. N-ITB has been observed for EC heated NBI plasma. The improved confinement region for electrons is expanded compared to that of the previous N-ITB plasma heated by only ECH. Moreover, the ion temperature is found to be increased simultaneously by about two to three times (T i (0)∼400-500eV) with steep gradient region at ρ∼0.6. From the measurement of the averaged peak energy intensity using the soft X-ray CCD camera it is confirmed that the impurity confinement is also improved with N-ITB. The radial electric field is observed to bifurcate into electron root (E r ∼15kV/m) and rather large electric field shear (dE r /dr∼-300kV/m 2 ) is produced in the layer between ion and electron root. (author)

Factors Affecting Patient Satisfaction with Community Health Service under the Gatekeeper System: A Cross-sectional Study in Nanjing, China.

Science.gov (United States)

Li, Wen Zhen; Gan, Yong; Zhou, Yan Feng; Chen, Ya Wen; Li, Jing; Kkandawire, Naomiem; Hu, Sai; Qiao, Yan; Lu, Zu Xun

2017-09-01

The gatekeeper policy has been implemented for approximately ten years on a pilot population in China. It is necessary to assess the satisfaction of patients utilizing community health service (CHS) under the gatekeeper system. Our study showed that the cognition of gatekeeper policy was associated with four dimensions including doctor-patient relationships, information and support, organization of care, and accessibility (P health scores also affected their satisfaction. General practitioners must be prepared to focus on these aspects of information and support, organization of care, and accessibility as indicators of potential opportunities for improvement. Additionally, policymakers can improve patients' satisfaction with CHS by strengthening their awareness of the gatekeeper policy. Copyright © 2017 The Editorial Board of Biomedical and Environmental Sciences. Published by China CDC. All rights reserved.

Pathways for retaining human capital in academic departments of a South African university

Directory of Open Access Journals (Sweden)

Luyanda Dube

2013-07-01

Objective: The study intends to profile knowledge assets in CHS, determine retention strategies and offer suggestions about regenerating knowledge retention initiatives. Research methodology: A quantitative approach, more specifically the informetrics technique of data mining, was adopted to profile academics in CHS at UNISA. Results: The results confirm the assertion that there is a discrepancy between senior academics who are probably due to leave the university in the next few years, and entrants who will replace them. The issue is worsened by the lack of an institutional framework to guide, standardise, strengthen or prioritise the process of knowledge retention. Conclusion: The study recommends the prioritisation, formalisation and institutionalisation of knowledge retention through the implementation of a broad range of knowledge retention strategies.

Deep sequencing of the Camellia chekiangoleosa transcriptome revealed candidate genes for anthocyanin biosynthesis.

Science.gov (United States)

Wang, Zhong-Wei; Jiang, Cong; Wen, Qiang; Wang, Na; Tao, Yuan-Yuan; Xu, Li-An

2014-03-15

Camellia chekiangoleosa is an important species of genus Camellia. It provides high-quality edible oil and has great ornamental value. The flowers are big and red which bloom between February and March. Flower pigmentation is closely related to the accumulation of anthocyanin. Although anthocyanin biosynthesis has been studied extensively in herbaceous plants, little molecular information on the anthocyanin biosynthesis pathway of C. chekiangoleosa is yet known. In the present study, a cDNA library was constructed to obtain detailed and general data from the flowers of C. chekiangoleosa. To explore the transcriptome of C. chekiangoleosa and investigate genes involved in anthocyanin biosynthesis, a 454 GS FLX Titanium platform was used to generate an EST dataset. About 46,279 sequences were obtained, and 24,593 (53.1%) were annotated. Using Blast search against the AGRIS, 1740 unigenes were found homologous to 599 Arabidopsis transcription factor genes. Based on the transcriptome dataset, nine anthocyanin biosynthesis pathway genes (PAL, CHS1, CHS2, CHS3, CHI, F3H, DFR, ANS, and UFGT) were identified and cloned. The spatio-temporal expression patterns of these genes were also analyzed using quantitative real-time polymerase chain reaction. The study results not only enrich the gene resource but also provide valuable information for further studies concerning anthocyanin biosynthesis. Copyright © 2014 Elsevier B.V. All rights reserved.

Accuracy of the all patient refined diagnosis related groups classification system in congenital heart surgery.

Science.gov (United States)

Parnell, Aimee S; Shults, Justine; Gaynor, J William; Leonard, Mary B; Dai, Dingwei; Feudtner, Chris

2014-02-01

Administrative data are increasingly used to evaluate clinical outcomes and quality of care in pediatric congenital heart surgery (CHS) programs. Several published analyses of large pediatric administrative data sets have relied on the All Patient Refined Diagnosis Related Groups (APR-DRG, version 24) diagnostic classification system. The accuracy of this classification system for patients undergoing CHS is unclear. We performed a retrospective cohort study of all 14,098 patients 0 to 5 years of age undergoing any of six selected congenital heart operations, ranging in complexity from isolated closure of a ventricular septal defect to single-ventricle palliation, at 40 tertiary-care pediatric centers in the Pediatric Health Information Systems database between 2007 and 2010. Assigned APR-DRGs (cardiac versus noncardiac) were compared using χ2 or Fisher's exact tests between those patients admitted during the first day of life versus later and between those receiving extracorporeal membrane oxygenation support versus those not. Recursive partitioning was used to assess the greatest determinants of APR-DRG type in the model. Every patient admitted on day 1 of life was assigned to a noncardiac APR-DRG (pDRG (pDRG experienced a significantly increased mortality (pDRG coding has systematic misclassifications, which may result in inaccurate reporting of CHS case volumes and mortality. Copyright © 2014 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

The Effect of the Transition to Home Monitoring for the Diagnosis of OSAS on Test Availability, Waiting Time, Patients’ Satisfaction, and Outcome in a Large Health Provider System

Directory of Open Access Journals (Sweden)

Ahmad Safadi

2014-01-01

Full Text Available During 2009, the Haifa district of Clalit Health Services (CHS has switched from in-lab polysomnography (PSG to home studies for the diagnosis of obstructive sleep apnea (OSA. We assessed the effects of this change on accessibility, waiting time, satisfaction, costs, and CPAP purchase by the patients. Data regarding sleep studies, CPAP purchase, and waiting times were collected retrospectively from the computerized database of CHS. Patients’ satisfaction was assessed utilizing a telephone questionnaire introduced to a randomized small sample of 70 patients. Comparisons were made between 2007 and 2008 (in-lab PSGs and 2010 and 2011 (when most studies were ambulatory. Of about 650000 insured individuals in the Haifa district of CHS, 1471 sleep studies were performed during 2007-2008 compared to 2794 tests during 2010-2011. The average waiting time was 9.9 weeks in 2007-2008 compared to 1.1 weeks in 2010-2011 (P<0.05. 597 CPAPs were purchased in 2007-2008 compared to 831 in 2010-2011. The overall patients’ satisfaction was similar, but discomfort tended to be higher in the in-laboratory group (4.1 vs 2.7 in a scale of 0–10; P=0.11. Switching to ambulatory diagnosis improved the test accessibility and reduced the waiting times. Patients’ satisfaction remained similarly high. The total direct cost of OSA management was reduced.

Mechanism of immune suppression by ultraviolet irradiation in vivo. I. Evidence for the existence of a unique photoreceptor in skin and its role in photoimmunology

International Nuclear Information System (INIS)

De Fabo, E.C.; Noonan, F.P.

1983-01-01

UV irradiation of mice causes a systemic immune alteration that can be detected either by suppression of the immunologic rejection of UV-induced tumors, or by suppression of contact hypersensitivity (CHS). Suppression of these two immunologic responses has similar photobiologic characteristics and in both cases is associated with the generation of antigen-specific suppressor T cells. To identify whether a specific photoreceptor for this effect exists, the relative wavelength effectiveness (action spectrum) was determined for the UV-induced suppression of CHS. Narrow bands of UV (half bandwidth 3 nm) were used at 10 wavelengths from 250 to 320 nm to obtain dose-response curves. The action spectrum derived from the dose-response curves has a maximum between 260 and 270 nm, a shoulder at 280-290 nm, and declines steadily to approximately 3% of maximum at 320 nm. The finding of such a clearly defined wavelength dependence implies the presence of a specific photoreceptor for this effect. Removing the stratum corneum by tape stripping before UV irradiation prevented the suppression of CHS using 254-nm radiation, suggesting the photoreceptor is superficially located in the skin. The hypothesis is advanced that the photoreceptor for systemic UV-induced immunosuppression of contact hypersensitivity may be urocanic acid. As such, it may also play a role in UV-induced carcinogenesis via the production of tumor-specific suppressor cells

Undesired small RNAs originate from an artificial microRNA precursor in transgenic petunia (Petunia hybrida.

Directory of Open Access Journals (Sweden)

Yulong Guo

Full Text Available Although artificial microRNA (amiRNA technology has been used frequently in gene silencing in plants, little research has been devoted to investigating the accuracy of amiRNA precursor processing. In this work, amiRNAchs1 (amiRchs1, based on the Arabidopsis miR319a precursor, was expressed in order to suppress the expression of CHS genes in petunia. The transgenic plants showed the CHS gene-silencing phenotype. A modified 5' RACE technique was used to map small-RNA-directed cleavage sites and to detect processing intermediates of the amiRchs1 precursor. The results showed that the target CHS mRNAs were cut at the expected sites and that the amiRchs1 precursor was processed from loop to base. The accumulation of small RNAs in amiRchs1 transgenic petunia petals was analyzed using the deep-sequencing technique. The results showed that, alongside the accumulation of the desired artificial microRNAs, additional small RNAs that originated from other regions of the amiRNA precursor were also accumulated at high frequency. Some of these had previously been found to be accumulated at low frequency in the products of ath-miR319a precursor processing and some of them were accompanied by 3'-tailing variant. Potential targets of the undesired small RNAs were discovered in petunia and other Solanaceae plants. The findings draw attention to the potential occurrence of undesired target silencing induced by such additional small RNAs when amiRNA technology is used. No appreciable production of secondary small RNAs occurred, despite the fact that amiRchs1 was designed to have perfect complementarity to its CHS-J target. This confirmed that perfect pairing between an amiRNA and its targets is not the trigger for secondary small RNA production. In conjunction with the observation that amiRNAs with perfect complementarity to their target genes show high efficiency and specificity in gene silencing, this finding has an important bearing on future applications of ami

Chitin synthases from Saprolegnia are involved in tip growth and represent a potential target for anti-oomycete drugs.

Directory of Open Access Journals (Sweden)

Gea Guerriero

Full Text Available Oomycetes represent some of the most devastating plant and animal pathogens. Typical examples are Phytophthora infestans, which causes potato and tomato late blight, and Saprolegnia parasitica, responsible for fish diseases. Despite the economical and environmental importance of oomycete diseases, their control is difficult, particularly in the aquaculture industry. Carbohydrate synthases are vital for hyphal growth and represent interesting targets for tackling the pathogens. The existence of 2 different chitin synthase genes (SmChs1 and SmChs2 in Saprolegnia monoica was demonstrated using bioinformatics and molecular biology approaches. The function of SmCHS2 was unequivocally demonstrated by showing its catalytic activity in vitro after expression in Pichia pastoris. The recombinant SmCHS1 protein did not exhibit any activity in vitro, suggesting that it requires other partners or effectors to be active, or that it is involved in a different process than chitin biosynthesis. Both proteins contained N-terminal Microtubule Interacting and Trafficking domains, which have never been reported in any other known carbohydrate synthases. These domains are involved in protein recycling by endocytosis. Enzyme kinetics revealed that Saprolegnia chitin synthases are competitively inhibited by nikkomycin Z and quantitative PCR showed that their expression is higher in presence of the inhibitor. The use of nikkomycin Z combined with microscopy showed that chitin synthases are active essentially at the hyphal tips, which burst in the presence of the inhibitor, leading to cell death. S. parasitica was more sensitive to nikkomycin Z than S. monoica. In conclusion, chitin synthases with species-specific characteristics are involved in tip growth in Saprolegnia species and chitin is vital for the micro-organisms despite its very low abundance in the cell walls. Chitin is most likely synthesized transiently at the apex of the cells before cellulose, the major

Undesired small RNAs originate from an artificial microRNA precursor in transgenic petunia (Petunia hybrida).

Science.gov (United States)

Guo, Yulong; Han, Yao; Ma, Jing; Wang, Huiping; Sang, Xianchun; Li, Mingyang

2014-01-01

Although artificial microRNA (amiRNA) technology has been used frequently in gene silencing in plants, little research has been devoted to investigating the accuracy of amiRNA precursor processing. In this work, amiRNAchs1 (amiRchs1), based on the Arabidopsis miR319a precursor, was expressed in order to suppress the expression of CHS genes in petunia. The transgenic plants showed the CHS gene-silencing phenotype. A modified 5' RACE technique was used to map small-RNA-directed cleavage sites and to detect processing intermediates of the amiRchs1 precursor. The results showed that the target CHS mRNAs were cut at the expected sites and that the amiRchs1 precursor was processed from loop to base. The accumulation of small RNAs in amiRchs1 transgenic petunia petals was analyzed using the deep-sequencing technique. The results showed that, alongside the accumulation of the desired artificial microRNAs, additional small RNAs that originated from other regions of the amiRNA precursor were also accumulated at high frequency. Some of these had previously been found to be accumulated at low frequency in the products of ath-miR319a precursor processing and some of them were accompanied by 3'-tailing variant. Potential targets of the undesired small RNAs were discovered in petunia and other Solanaceae plants. The findings draw attention to the potential occurrence of undesired target silencing induced by such additional small RNAs when amiRNA technology is used. No appreciable production of secondary small RNAs occurred, despite the fact that amiRchs1 was designed to have perfect complementarity to its CHS-J target. This confirmed that perfect pairing between an amiRNA and its targets is not the trigger for secondary small RNA production. In conjunction with the observation that amiRNAs with perfect complementarity to their target genes show high efficiency and specificity in gene silencing, this finding has an important bearing on future applications of amiRNAs in gene

Research

African Journals Online (AJOL)

ebutamanya

2015-01-30

Jan 30, 2015 ... initiatives driving Kenya into realizing Millennium Development Goals. (MDGs) number 4 .... The CHWs have done a recommendable job in the ... slowed their productivity hence impeding efficiency of the CHS in providing ...

Strains for the production of flavonoids from glucose

Energy Technology Data Exchange (ETDEWEB)

Stephanopoulos, Gregory; Santos, Christine; Koffas, Mattheos

2015-11-13

The invention relates to the production of flavonoids and flavonoid precursors in cells through recombinant expression of tyrosine ammonia lyase (TAL), 4-coumarate:CoA ligase (4CL), chalcone synthase (CHS), and chalcone isomerase (CHI).

Papers presented at the Fourteenth International conference on Plasma Physics and Controlled Nuclear Fusion Research. Organization International de la Energia Atomica Wuerzberg, Alemania 30 September - 7 October 1992

International Nuclear Information System (INIS)

1994-01-01

This report contains the contributions of the CIEMAT's Fusion Unit to the 14th International Conference on Plasma Physics and Controlled Nuclear Fusion Research that was held by the International Atomic Energy Agency in Wuerzberg, Germany from 30 September to 7 October 1992. Three papers were presented that summarized the, main lines of work done in the Unit during the previous two years: The first one on the theoretical advances in the understanding of the Fexible Heliac TJ-II under construction, the second on the confinement studies performed in the operating TJ-I Tokamak and the third one on the description of the physical properties of the soon to be started TJ-IU Torsatron. (Author) 25 refs

Papers presented at the fourteenth international conference on plasma physics and controlled nuclear fusion research

International Nuclear Information System (INIS)

1994-01-01

This report contains the contributions of the CIEMAT's Fusion Unit to the 14th International Conference on Plasma Physics and Controlled Nuclear Fusion Research that was held by the International Atomic Energy Agency in Wurzburg, Germany from 30 September to 7 October 1992. Three papers were presented that summarized the main lines of work done in the Unit during the previous two years: The first one on the theoretical advances in the understanding of the Flexible Heliac TJ-II under construction, the second on the confinement studies performed in the operating TJ-I Tokamak and the third one on the description of the physical properties of the soon to be started TJ-IU Torsatron. (Author) 25 refs

Recent progress in stellarator reactor conceptual design

International Nuclear Information System (INIS)

Miller, R.L.

1985-01-01

The Stellarator/Torsatron/Heliotron (S/T/H) class of toroidal magnetic fusion reactor designs continues to offer a distinct and in several ways superior approach to eventual commercial competitiveness. Although no major, integrated conceptual reactor design activity is presently underway, a number of international research efforts suggest avenues for the substantial improvement of the S/T/H reactor embodiment, which derive from recent experimental and theoretical progress and are responsive to current trends in fusion-reactor projection to set the stage for a third generation of designs. Recent S/T/H reactor design activity is reviewed and the impact of the changing technical and programmatic context on the direction of future S/T/H reactor design studies is outlined

Magnetohydrodynamic theory of plasma equilibrium and stability in stellarators: Survey of results

International Nuclear Information System (INIS)

Shafranov, V.D.

1983-01-01

The main advantage of a stellarator is its capability of steady-state operation. It can be exploited as a reactor if stable plasma confinement can be achieved with #betta#approx.10%. Therefore, this limiting pressure value is a key factor in stellarator development. This paper contains a survey of current ideas on the magnetohydrodynamic equilibrium and stability properties of stellarators with sufficiently high pressure. Here, any system of nested toroidal magnetic surfaces generated by external currents is considered a stellarator. Systems produced by helical or equivalent windings, including torsatrons and heliotrons, will be called ordinary stellarators, in contrast to those with spatial axes. It is shown that adequate confinement can be achieved

Investigation of three-dimensional turbulent structures in the torsatron TJ-K

International Nuclear Information System (INIS)

Mahdizadeh, N.

2007-01-01

In this work, for the first time, the three-dimensional nature of drift waves has been verified experimentally inside the confinement region of the toroidal plasma in TJ-K. The perpendicular dynamics of turbulence has been studied with the focus on the poloidal wavenumber spectra and the scaling of the turbulent structure with the drift scale. To this end, a 64 tip Langmuir probe array has been used, which is poloidally positioned on a flux surface. For the first time, the parallel dynamics of turbulence has been investigated in the core of a toroidally confined plasma. In contrast to previous experiments, multi-probe measurements were carried out to get simultaneous information on the shape and the propagation direction of the turbulent structures. The results for the parallel wave number and the parallel propagation velocity have been compared with results from the simulation code GEM3. It is demonstrated that the propagation in the direction parallel to the magnetic field is affected by Alfven dynamics. Together, these results strongly confirm previous investigations, which have demonstrated the importance of drift-wave turbulence in TJ-K and therefore also in fusion edge plasma. (orig.)

Investigation of three-dimensional turbulent structures in the torsatron TJ-K

Energy Technology Data Exchange (ETDEWEB)

Mahdizadeh, N.

2007-02-14

In this work, for the first time, the three-dimensional nature of drift waves has been verified experimentally inside the confinement region of the toroidal plasma in TJ-K. The perpendicular dynamics of turbulence has been studied with the focus on the poloidal wavenumber spectra and the scaling of the turbulent structure with the drift scale. To this end, a 64 tip Langmuir probe array has been used, which is poloidally positioned on a flux surface. For the first time, the parallel dynamics of turbulence has been investigated in the core of a toroidally confined plasma. In contrast to previous experiments, multi-probe measurements were carried out to get simultaneous information on the shape and the propagation direction of the turbulent structures. The results for the parallel wave number and the parallel propagation velocity have been compared with results from the simulation code GEM3. It is demonstrated that the propagation in the direction parallel to the magnetic field is affected by Alfven dynamics. Together, these results strongly confirm previous investigations, which have demonstrated the importance of drift-wave turbulence in TJ-K and therefore also in fusion edge plasma. (orig.)

Immunosuppressive Effect of Litsea cubeba L. Essential Oil on Dendritic Cell and Contact Hypersensitivity Responses

Directory of Open Access Journals (Sweden)

Hsin-Chun Chen

2016-08-01

Full Text Available Litsea cubeba L., also named as Makauy, is a traditional herb and has been used as cooking condiment or tea brewing to treat diseases for aborigines. The present study was undertaken to explore the chemical compositions of the fruit essential oil of L. cubeba (LCEO and the immunomodulatory effect of LCEO on dendritic cells and mice. The LCEO was analyzed using gas chromatography (GC and gas chromatography/mass spectrometry (GC/MS with direct injection (DI/GC or headspace-solid phase microextraction (HS-SPME/GC. In total, 56 components were identified, of which 48 were detected by DI/GC and 49 were detected by HS-SPME/GC. The principal compounds were citral (neral and geranial. An immunosuppressive activity of LCEO was investigated with bone marrow-derived dendritic cells (DCs which have a critical role to trigger the adaptive immunity. Additionally, the inhibitory effect of LCEO on immune response was elucidated by performing the contact hypersensitivity (CHS responses in mice. Our results clearly showed that LCEO decreases the production of TNF-α and cytokine IL-12 in a dose-dependent manner in lipopolysaccharide (LPS-stimulated DCs. CHS response and the infiltrative T cells were inhibited in the tested ears of the mice co-treated with LCEO. We demonstrate, for the first time, that the LCEO mainly containing citral exhibits an immunosuppressive effect on DCs and mice, indicating that LCEO can potentially be applied in the treatment of CHS, inflammatory diseases, and autoimmune diseases.

DEFLECTIONS OF FAST CORONAL MASS EJECTIONS AND THE PROPERTIES OF ASSOCIATED SOLAR ENERGETIC PARTICLE EVENTS

International Nuclear Information System (INIS)

Kahler, S. W.; Akiyama, S.; Gopalswamy, N.

2012-01-01

The onset times and peak intensities of solar energetic particle (SEP) events at Earth have long been thought to be influenced by the open magnetic fields of coronal holes (CHs). The original idea was that a CH lying between the solar SEP source region and the magnetic footpoint of the 1 AU observer would result in a delay in onset and/or a decrease in the peak intensity of that SEP event. Recently, Gopalswamy et al. showed that CHs near coronal mass ejection (CME) source regions can deflect fast CMEs from their expected trajectories in space, explaining the appearance of driverless shocks at 1 AU from CMEs ejected near solar central meridian (CM). This suggests that SEP events originating in CME-driven shocks may show variations attributable to CH deflections of the CME trajectories. Here, we use a CH magnetic force parameter to examine possible effects of CHs on the timing and intensities of 41 observed gradual E ∼ 20 MeV SEP events with CME source regions within 20° of CM. We find no systematic CH effects on SEP event intensity profiles. Furthermore, we find no correlation between the CME leading-edge measured position angles and SEP event properties, suggesting that the widths of CME-driven shock sources of the SEPs are much larger than the CMEs. Independently of the SEP event properties, we do find evidence for significant CME deflections by CH fields in these events.

DEFLECTIONS OF FAST CORONAL MASS EJECTIONS AND THE PROPERTIES OF ASSOCIATED SOLAR ENERGETIC PARTICLE EVENTS

Energy Technology Data Exchange (ETDEWEB)

Kahler, S. W. [Air Force Research Laboratory, Space Vehicles Directorate, 3550 Aberdeen Avenue, Kirtland AFB, NM 87117 (United States); Akiyama, S. [Institute for Astrophyics and Computational Sciences, Catholic University of America, Washington, DC 20064 (United States); Gopalswamy, N., E-mail: AFRL.RVB.PA@kirtland.af.mil [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

2012-08-01

The onset times and peak intensities of solar energetic particle (SEP) events at Earth have long been thought to be influenced by the open magnetic fields of coronal holes (CHs). The original idea was that a CH lying between the solar SEP source region and the magnetic footpoint of the 1 AU observer would result in a delay in onset and/or a decrease in the peak intensity of that SEP event. Recently, Gopalswamy et al. showed that CHs near coronal mass ejection (CME) source regions can deflect fast CMEs from their expected trajectories in space, explaining the appearance of driverless shocks at 1 AU from CMEs ejected near solar central meridian (CM). This suggests that SEP events originating in CME-driven shocks may show variations attributable to CH deflections of the CME trajectories. Here, we use a CH magnetic force parameter to examine possible effects of CHs on the timing and intensities of 41 observed gradual E {approx} 20 MeV SEP events with CME source regions within 20 Degree-Sign of CM. We find no systematic CH effects on SEP event intensity profiles. Furthermore, we find no correlation between the CME leading-edge measured position angles and SEP event properties, suggesting that the widths of CME-driven shock sources of the SEPs are much larger than the CMEs. Independently of the SEP event properties, we do find evidence for significant CME deflections by CH fields in these events.

Deflections of Fast Coronal Mass Ejections and the Properties of Associated Solar Energetic Particle Events

Science.gov (United States)

Kahler, S. W.; Akiyama, S.; Gopalswamy, N.

2012-01-01

The onset times and peak intensities of solar energetic particle (SEP) events at Earth have long been thought to be influenced by the open magnetic fields of coronal holes (CHs). The original idea was that a CH lying between the solar SEP source region and the magnetic footpoint of the 1 AU observer would result in a delay in onset and/or a decrease in the peak intensity of that SEP event. Recently, Gopalswamy et al. showed that CHs near coronal mass ejection (CME) source regions can deflect fast CMEs from their expected trajectories in space, explaining the appearance of driverless shocks at 1 AU from CMEs ejected near solar central meridian (CM). This suggests that SEP events originating in CME-driven shocks may show variations attributable to CH deflections of the CME trajectories. Here, we use a CH magnetic force parameter to examine possible effects of CHs on the timing and intensities of 41 observed gradual E approx 20 MeV SEP events with CME source regions within 20 deg. of CM. We find no systematic CH effects on SEP event intensity profiles. Furthermore, we find no correlation between the CME leading-edge measured position angles and SEP event properties, suggesting that the widths of CME-driven shock sources of the SEPs are much larger than the CMEs. Independently of the SEP event properties, we do find evidence for significant CME deflections by CH fields in these events

Automated Identification of Coronal Holes from Synoptic EUV Maps

Science.gov (United States)

Hamada, Amr; Asikainen, Timo; Virtanen, Ilpo; Mursula, Kalevi

2018-04-01

Coronal holes (CHs) are regions of open magnetic field lines in the solar corona and the source of the fast solar wind. Understanding the evolution of coronal holes is critical for solar magnetism as well as for accurate space weather forecasts. We study the extreme ultraviolet (EUV) synoptic maps at three wavelengths (195 Å/193 Å, 171 Å and 304 Å) measured by the Solar and Heliospheric Observatory/Extreme Ultraviolet Imaging Telescope (SOHO/EIT) and the Solar Dynamics Observatory/Atmospheric Imaging Assembly (SDO/AIA) instruments. The two datasets are first homogenized by scaling the SDO/AIA data to the SOHO/EIT level by means of histogram equalization. We then develop a novel automated method to identify CHs from these homogenized maps by determining the intensity threshold of CH regions separately for each synoptic map. This is done by identifying the best location and size of an image segment, which optimally contains portions of coronal holes and the surrounding quiet Sun allowing us to detect the momentary intensity threshold. Our method is thus able to adjust itself to the changing scale size of coronal holes and to temporally varying intensities. To make full use of the information in the three wavelengths we construct a composite CH distribution, which is more robust than distributions based on one wavelength. Using the composite CH dataset we discuss the temporal evolution of CHs during the Solar Cycles 23 and 24.

Bibliometric analysis about the scientific production on the Social Skills Field

Directory of Open Access Journals (Sweden)

Eliane Colepicolo

2015-05-01

Full Text Available Objective. This research consisted to contribute to the systematization of the theoretical and practical field of Social Skills, here called Social Skills Field (SSF. Method. A survey of a representative sample of CHS publications metadata extracted from the 15 scientific and technical literature databases in Psychology available in the CAPES Journals Portal was conducted. After treatment and refinement, this sample resulted in a corpus of metadata 25,409 scientific articles, which is a set of metadata publications, from fields such as author, title, subject, abstract, among others. The corpus of metadata stored in a database allowed the creation of a series of data crossing, resulting in bibliometric indicators. Results. As a result, we have: the SS Corpus, published on the Internet, which enables the inclusion of new metadata and the recovery of almost all scientific articles of the field; 2 bibliometric indicators in CHS, which may offer subsidies for the development and expansion of the field. Conclusions. Bibliometric indicators of the CHS show a representative production growth of social skills in the 1970s. Research on SS is mainly conducted by researchers from the United States, Brazil, United Kingdon and Denmark. The main subject studied are "social skills", "interpersonal relations", "social competence", "empathy", "assertividade", "assertiveness", "children", "adult", "college students"; and the major journals are: Journal of Personality and Social Psychology; Psychological Reports; Journal of Autism and Developmental Disorders and Child Development.

Expression of CD73 slows down migration of skin dendritic cells, affecting the sensitization phase of contact hypersensitivity reactions in mice.

Science.gov (United States)

Neuberger, A; Ring, S; Silva-Vilches, C; Schrader, J; Enk, A; Mahnke, K

2017-09-01

Application of haptens to the skin induces release of immune stimulatory ATP into the extracellular space. This "danger" signal can be converted to immunosuppressive adenosine (ADO) by the action of the ectonucleotidases CD39 and CD73, expressed by skin and immune cells. Thus, the expression and regulation of CD73 by skin derived cells may have crucial influence on the outcome of contact hypersensitivity (CHS) reactions. To investigate the role of CD73 expression during 2,4,6-trinitrochlorobenzene (TNCB) induced CHS reactions. Wild type (wt) and CD73 deficient mice were subjected to TNCB induced CHS. In the different mouse strains the resulting ear swelling reaction was recorded along with a detailed phenotypic analysis of the skin migrating subsets of dendritic cells (DC). In CD73 deficient animals the motility of DC was higher as compared to wt animals and in particular after sensitization we found increased migration of Langerin + DC from skin to draining lymph nodes (LN). In the TNCB model this led to a stronger sensitization as indicated by increased frequency of interferon-γ producing T cells in the LN and an increased ear thickness after challenge. CD73 derived ADO production slows down migration of Langerin + DC from skin to LN. This may be a crucial mechanism to avoid over boarding immune reactions against haptens. Copyright © 2017 Japanese Society for Investigative Dermatology. Published by Elsevier B.V. All rights reserved.

Impacts of a farmers' market incentive programme on fruit and vegetable access, purchase and consumption.

Science.gov (United States)

Olsho, Lauren Ew; Payne, Gayle Holmes; Walker, Deborah Klein; Baronberg, Sabrina; Jernigan, Jan; Abrami, Alyson

2015-10-01

The present study examines the impact of Health Bucks, a farmers' market incentive programme, on awareness of and access to farmers' markets, and fruit and vegetable purchase and consumption in low-income New York City neighbourhoods. The evaluation used two primary data collection methods: (i) an on-site point-of-purchase survey of farmers' market shoppers; and (ii) a random-digit-dial telephone survey of residents in neighbourhoods where the programme operates. Additionally, we conducted a quasi-experimental analysis examining differential time trends in consumption before and after programme introduction using secondary Community Health Survey (CHS) data. New York City farmers' markets and communities. Farmers' market shoppers (n 2287) completing point-of-purchase surveys in a representative sample of New York City farmers' markets in 2010; residents (n 1025) completing random-digit-dial telephone survey interviews in 2010; and respondents (n 35 606) completing CHS interviews in 2002, 2004, 2008 and 2009. Greater Health Bucks exposure was associated with: (i) greater awareness of farmers' markets; (ii) increased frequency and amount of farmers' market purchases; and (iii) greater likelihood of a self-reported year-over-year increase in fruit and vegetable consumption. However, our CHS analysis did not detect impacts on consumption. While our study provides promising evidence that use of farmers' market incentives is associated with increased awareness and use of farmers' markets, additional research is needed to better understand impacts on fruit and vegetable consumption.

Yeast casein kinase 2 governs morphology, biofilm formation, cell wall integrity, and host cell damage of Candida albicans.

Science.gov (United States)

Jung, Sook-In; Rodriguez, Natalie; Irrizary, Jihyun; Liboro, Karl; Bogarin, Thania; Macias, Marlene; Eivers, Edward; Porter, Edith; Filler, Scott G; Park, Hyunsook

2017-01-01

The regulatory networks governing morphogenesis of a pleomorphic fungus, Candida albicans are extremely complex and remain to be completely elucidated. This study investigated the function of C. albicans yeast casein kinase 2 (CaYck2p). The yck2Δ/yck2Δ strain displayed constitutive pseudohyphae in both yeast and hyphal growth conditions, and formed enhanced biofilm under non-biofilm inducing condition. This finding was further supported by gene expression analysis of the yck2Δ/yck2Δ strain which showed significant upregulation of UME6, a key transcriptional regulator of hyphal transition and biofilm formation, and cell wall protein genes ALS3, HWP1, and SUN41, all of which are associated with morphogenesis and biofilm architecture. The yck2Δ/yck2Δ strain was hypersensitive to cell wall damaging agents and had increased compensatory chitin deposition in the cell wall accompanied by an upregulation of the expression of the chitin synthase genes, CHS2, CHS3, and CHS8. Absence of CaYck2p also affected fungal-host interaction; the yck2Δ/yck2Δ strain had significantly reduced ability to damage host cells. However, the yck2Δ/yck2Δ strain had wild-type susceptibility to cyclosporine and FK506, suggesting that CaYck2p functions independently from the Ca+/calcineurin pathway. Thus, in C. albicans, Yck2p is a multifunctional kinase that governs morphogenesis, biofilm formation, cell wall integrity, and host cell interactions.

Surrogate screening models for the low physical activity criterion of frailty.

Science.gov (United States)

Eckel, Sandrah P; Bandeen-Roche, Karen; Chaves, Paulo H M; Fried, Linda P; Louis, Thomas A

2011-06-01

Low physical activity, one of five criteria in a validated clinical phenotype of frailty, is assessed by a standardized, semiquantitative questionnaire on up to 20 leisure time activities. Because of the time demanded to collect the interview data, it has been challenging to translate to studies other than the Cardiovascular Health Study (CHS), for which it was developed. Considering subsets of activities, we identified and evaluated streamlined surrogate assessment methods and compared them to one implemented in the Women's Health and Aging Study (WHAS). Using data on men and women ages 65 and older from the CHS, we applied logistic regression models to rank activities by "relative influence" in predicting low physical activity.We considered subsets of the most influential activities as inputs to potential surrogate models (logistic regressions). We evaluated predictive accuracy and predictive validity using the area under receiver operating characteristic curves and assessed criterion validity using proportional hazards models relating frailty status (defined using the surrogate) to mortality. Walking for exercise and moderately strenuous household chores were highly influential for both genders. Women required fewer activities than men for accurate classification. The WHAS model (8 CHS activities) was an effective surrogate, but a surrogate using 6 activities (walking, chores, gardening, general exercise, mowing and golfing) was also highly predictive. We recommend a 6 activity questionnaire to assess physical activity for men and women. If efficiency is essential and the study involves only women, fewer activities can be included.

Review Article: Mapping of children's health and development data on population level using the classification system ICF-CY.

Science.gov (United States)

Ståhl, Ylva; Granlund, Mats; Gäre-Andersson, Boel; Enskär, Karin

2011-02-01

The aim of this study was to investigate if essential health and development data of all children in Sweden in the Child Health Service (CHS) and School Health Service (SHS) can be linked to the classification system International Classification of Functioning, Disability and Health--Children and Youth (ICF-CY). Lists of essential health terms, compiled by professionals from CHS and SHS, expected to be used in the national standardised records form the basis for the analysis in this study. The essential health terms have been linked to the codes of ICF-CY by using linking rules and a verification procedure. After exclusion of terms not directly describing children's health, a majority of the health terms could be linked into the ICF-CY with a high proportion of terms in body functions and a lower proportion in activity/participation and environment respectively. Some health terms had broad description and were linked to several ICF-CY codes. The precision of the health terms was at a medium level of detail. ICF-CY can be useful as a tool for documenting child health. It provides not only a code useful for statistical purposes but also a language useful for the CHS and SHS in their work on individual as well as population levels. It was noted that the health terms used by services mainly focused on health related to body function. This indicates that more focus is needed on health data related to child's functioning in everyday life situations.

Transgenerational transmission of trauma in families of Holocaust survivors: the consequences of extreme family functioning on resilience, sense of coherence, anxiety and depression.

Science.gov (United States)

Fossion, Pierre; Leys, Christophe; Vandeleur, Caroline; Kempenaers, Chantal; Braun, Stéphanie; Verbanck, Paul; Linkowski, Paul

2015-01-15

The psychological transmission of the noxious effects of a major trauma from one generation to the next remains unclear. The present study aims to identify possible mechanisms explaining this transmission among families of Holocaust Survivors (HS). We hypothesized that the high level of depressive and anxiety disorders (DAD) among HS impairs family systems, which results in damaging coping strategies of their children (CHS) yielding a higher level of DAD. 49 CHS completed the Resilience Scale for Adults, the Hopkins Symptom Check List-25, the 13-Item Sense of Coherence (SOC) scale, and the Family Adaptability and Cohesion Scale. We test a mediation model with Family types as the predictor; coping strategies (i.e. Resilience or SOC) as the mediator; and DAD as the outcome variable. Results confirm that the CHS׳ family types are more often damaged than in general population. Moreover, growing in a damaged family seems to impede development of coping strategies and, therefore, enhances the occurrence of DAD. The present investigation is correlational and should be confirmed by other prospective investigations. At a theoretical level we propose a mechanism of transmission of the noxious effects of a major trauma from one generation to the next through family structure and coping strategies. At a clinical level, our results suggest to investigate the occurrence of trauma among parents of patients consulting for DAD and to reinforce their coping strategies. Copyright © 2014 Elsevier B.V. All rights reserved.

Automatic Identification of the Repolarization Endpoint by Computing the Dominant T-wave on a Reduced Number of Leads.

Science.gov (United States)

Giuliani, C; Agostinelli, A; Di Nardo, F; Fioretti, S; Burattini, L

2016-01-01

Electrocardiographic (ECG) T-wave endpoint (Tend) identification suffers lack of reliability due to the presence of noise and variability among leads. Tend identification can be improved by using global repolarization waveforms obtained by combining several leads. The dominant T-wave (DTW) is a global repolarization waveform that proved to improve Tend identification when computed using the 15 (I to III, aVr, aVl, aVf, V1 to V6, X, Y, Z) leads usually available in clinics, of which only 8 (I, II, V1 to V6) are independent. The aim of the present study was to evaluate if the 8 independent leads are sufficient to obtain a DTW which allows a reliable Tend identification. To this aim Tend measures automatically identified from 15-dependent-lead DTWs of 46 control healthy subjects (CHS) and 103 acute myocardial infarction patients (AMIP) were compared with those obtained from 8-independent-lead DTWs. Results indicate that Tend distributions have not statistically different median values (CHS: 340 ms vs. 340 ms, respectively; AMIP: 325 ms vs. 320 ms, respectively), besides being strongly correlated (CHS: ρ=0.97, AMIP: 0.88; Pautomatic Tend identification from DTW, the 8 independent leads can be used without a statistically significant loss of accuracy but with a significant decrement of computational effort. The lead dependence of 7 out of 15 leads does not introduce a significant bias in the Tend determination from 15 dependent lead DTWs.

Arterial hypertension pregnancy induced at the Conjunto Hospitalar de Sorocaba. Maternal and perinatal aspects

Directory of Open Access Journals (Sweden)

Joe Luiz Vieira Garcia Novo

2010-10-01

Full Text Available ABSTRACT Objectives: to contribute with the description and analysis of the risk factors associated with preeclampsia in the CHS. Methods: retrospective observational study of medical handbooks on the deliveries of pregnant women hospitalized in the CHS from January - February 2007 to August 2008. The variables being studied were: social demographic mother-to-be behavioral characteristics; family history, personal gestational obstetrics overview; deliveries, puerperal data; patient assistance conductibility, clinical development and mother/baby hospital discharge. The statistical analysis which made use of Statistical Package for Social Sciences came to these results: out of the 2122 performed deliveries, 246 patients presented preeclampsia. Hospital admittance being due to: hypertension crisis (31.30%, abdominal pain (26.02% and eclampsia (2.04%. Hydralazine (15.85% and magnesium sulfate (14.23% were used to control hypertensive and convulsion crisis. Furthermore, gestational age (p = 0.037 and fifth minute Apgar index of newborns (p = 0.020 came out significantly higher in patients with no family history of hypertension. In the chi-square test (PAD >110 mmHg, there was significant difference in severe preeclampsia and eclampsia patients (p < 0.001, late maternal complications (p = 0.009 and newborn Apgar index in the first (p < 0.001 and fifth minutes (p < 0.007. Conclusion: in spite of the severe preeclampsia conditions some admitted patients presented, the CHS dealt with a small percentage of complications and mortality rate due to the use of magnesium sulfate and the successful handling of deliveries.

Spontaneous mutation rate in Chinese hamster cell clones differing in UV-sensitivity

International Nuclear Information System (INIS)

Manuilova, E.S.; Bagrova, A.M.; Moskovskij Gosudarstvennyj Univ.

1983-01-01

The spontaneous rate of appearance of mutations to 6-mercaptopurine (6 MP) resistence in the cells of CHR2 and CHs2 clones dofferent in sensitivity to lethal and matagenous effect of UV-rays, is investigated. Increased UV-sensitivity of CHs2 clone is caused by the violation of postreplicative DNA reparation. It is established that the purity of spontaneously occuring mutations in both clones turns out to be similar, i.e. (1.5-1.8)x10 -5 for the cell pergeneration. It is shown that the effect of postreplicative DNA reparation in the cells of chinese hamster is not connected with the increase of spontaneous mutation ability. The problem on the possible role of reparation in the mechanism of appearance of spontaneous and induced mutations in the cells of Chinese hamster with increased UV-sensitivity is discussed

Overexpression of maize anthocyanin regulatory gene Lc affects rice fertility.

Science.gov (United States)

Li, Yuan; Zhang, Tao; Shen, Zhong-Wei; Xu, Yu; Li, Jian-Yue

2013-01-01

Seventeen independent transgenic rice plants with the maize anthocyanin regulatory gene Lc under control of the CaMV 35S promoter were obtained and verified by molecular identification. Ten plants showed red spikelets during early development of florets, and the degenerate florets were still red after heading. Additionally, these plants exhibited intense pigmentation on the surface of the anther and the bottom of the ovary. They were unable to properly bloom and were completely sterile. Following pollination with normal pollen, these plants yielded red caryopses but did not mature normally. QRT-PCR analysis indicated that mRNA accumulation of the CHS-like gene encoding a chalcone synthase-related protein was increased significantly in the sterile plant. This is the first report to suggest that upregulation of the CHS gene expression may result in rice sterility and affect the normal development of rice seeds.

Systematic immunosuppression induced by photodynamic therapy (PDT) is adoptively transferred by macrophages

International Nuclear Information System (INIS)

Lynch, D.H.; Haddad, S; King, V.J.; Ott, M.J.; Jolles, C.J.; Straight, R. C.

1989-01-01

The purpose of this study was to determine whether photodynamic therapy induced suppression of contact hypersensitivity (CHS) responses was an active phenomenon that could be adoptively transferred by viable splenocytes from PDT-treated mice. Although induction of adoptively transferable suppressor cells in PDT-treated mice required exposure to antigen, the suppressor cells were found to be antigen nonspecific in their function. Furthermore, splenocytes from PDT-treated mice were capable of generating levels of allospecific cytotoxic T lymphocyte (CTL) activity which were comparable to those generated by normal control mice, but the ability of irradiated spleen cells from PDT-treated mice to stimulate a mixed lymphocyte response (MLR) was dramatically impaired. Finally, chromatographic separation of T cells, B cells and macrophages showed that the cell type which mediates adoptively transferable suppression of CHS responsiveness is in the macrophage lineage. (author)

Antioxidant enzymes as potential targets in cardioprotection and treatment of cardiovascular diseases. Enzyme antioxidants: the next stage of pharmacological counterwork to the oxidative stress

Directory of Open Access Journals (Sweden)

Alexander V. Vavaev

2012-02-01

Full Text Available The focus in antioxidant research is on enzyme derivative investigations. Extracellular superoxide dismutase (EC-SOD is of particular interest, as it demonstrates in vivo the protective action against development of atherosclerosis, hypertension, heart failure, diabetes mellitus. The reliable association of coronary artery disease with decreased level of heparin-released EC-SOD was established in clinical research. To create a base for and to develop antioxidant therapy, various SOD isozymes, catalase (CAT, methods of gene therapy, and combined applications of enzymes are used. Covalent bienzyme SOD-CHS-CAT conjugate (CHS, chondroitin sulphate showed high efficacy and safety as the drug candidate. There is an evident trend to use the components of glycocalyx and extracellular matrix for target delivery of medical substances. Development of new enzyme antioxidants for therapeutic application is closely connected with progress in medical biotechnology, pharmaceutical industry, and bioeconomy.

ICR studies of some anionic gas phase reactions and FTICR software design

International Nuclear Information System (INIS)

Noest, A.J.

1983-01-01

This thesis consists of two parts. Part one (Chs. 1-5) reports experimental results from mostly drift-cell ICR studies of negative ion-molecule reactions; part two (Chs. 6-11) concerns the design of software for an FTICR instrument. The author discusses successively: 1. ion cyclotron resonance spectrometry; 2. the gas phase allyl anion; 3. the (M-H) and (M-H2) anions from acetone; 4. negative ion-molecule reactions of aliphatic nitrites studied by cyclotron resonance; 5. homoconjugation versus charge-dipole interaction effects in the stabilization of carbanions in the gas phase; 6. the Fourier Transform ICR method; 7. the FTICR-software; 8. an efficient adaptive matcher filter for fast transient signals; 9. reduction of spectral peak height errors by time-domain weighing; 10. Chirp excitation; 11. Compact data storage. The book concludes with a Dutch and English summary (G.J.P.)

In silicio expression analysis of PKS genes isolated from Cannabis sativa L.

Directory of Open Access Journals (Sweden)

Isvett J. Flores-Sanchez

2010-01-01

Full Text Available Cannabinoids, flavonoids, and stilbenoids have been identified in the annual dioecious plant Cannabis sativa L. Of these, the cannabinoids are the best known group of this plant's natural products. Polyketide synthases (PKSs are responsible for the biosynthesis of diverse secondary metabolites, including flavonoids and stilbenoids. Biosynthetically, the cannabinoids are polyketide substituted with terpenoid moiety. Using an RT-PCR homology search, PKS cDNAs were isolated from cannabis plants. The deduced amino acid sequences showed 51%-73% identity to other CHS/STS type sequences of the PKS family. Further, phylogenetic analysis revealed that these PKS cDNAs grouped with other non-chalcone-producing PKSs. Homology modeling analysis of these cannabis PKSs predicts a 3D overall fold, similar to alfalfa CHS2, with small steric differences on the residues that shape the active site of the cannabis PKSs.

RESEARCH ARTICLE Cloning and expression analysis of chalcone ...

Indian Academy of Sciences (India)

Praveen Awasthi

the CLC genomic workbench (CLC bio, a Qiagen company, Netherland). ..... regulate CfCHS RNA levels through cleavage, while miR477 may act by translational ..... Received 27 August 2015, in final revised form 4 January 2016; accepted 8 ...

綜合高中分流政策對學生學習成就的影響：以TEPS 資料分析為例 Effects of Comprehensive High School Policy on Students’ Achievement: Evidence from Taiwan Education Panel Survey

Directory of Open Access Journals (Sweden)

李敦義 Duen-Yi Lee

2011-06-01

Full Text Available 我國自1996 年開始試辦綜合高中，該政策的目的在於促使我國後期中等教育能在高中、高職之外，提供另一條不同的選擇進路，俾使學生得以適性發展，學得多方面知識，達到適性教育的目標。綜合高中分流政策立意甚佳，然而就歷年來綜合高中學生數變化來看，顯然綜合高中在我國後期中等教育仍不是主流，何以綜合高中沒有成為我國後期中等教育的主流？是否與國內相關研究發現綜合高中分流政策在執行上遭遇瓶頸有關，且進一步影響到國中畢業生在選擇就讀綜合高中的考量？此外，過去國內關於綜合高中分流政策的研究，大都集中在探討綜合高中的辦學績效和實施困難，而非該政策對學生學習成就的影響之探討。有鑑於此，本研究進一步探討綜合高中分流政策對綜合高中學生學習成就的影響？原始資料取自臺灣教育長期追蹤資料庫（Taiwan Education Panel Survey）公共使用版中的第一波到第四波國中追蹤樣本資料，並使用傾向分數配對法（propensity score matching）進行資料分析。研究結果發現：在學生學習成就表現上，就整體平均效果來看，就讀綜合高中的學生並不比就讀普通高中或高職的學生來得好。最後，說明本研究結果對綜合高中分流政策的意涵，及提出研究建議供相關人員與後續研究之用。 Since 1996, the Taiwanese government has launched the policy of comprehensive high school (CHS to relax the traditional system of curriculum tracking at the level of senior secondary education. The aim of CHS is to offer junior high graduates delaying their choice between senior high and vocational curricula, an opportunity to increase their common knowledge and achieve a goal of personally tailored development. However, in contrast with students in both senior high and vocational schools, the percentage

Neighborhood disadvantage and ischemic stroke: the Cardiovascular Health Study (CHS).

Science.gov (United States)

Brown, Arleen F; Liang, Li-Jung; Vassar, Stefanie D; Stein-Merkin, Sharon; Longstreth, W T; Ovbiagele, Bruce; Yan, Tingjian; Escarce, José J

2011-12-01

Neighborhood characteristics may influence the risk of stroke and contribute to socioeconomic disparities in stroke incidence. The objectives of this study were to examine the relationship between neighborhood socioeconomic status and incident ischemic stroke and examine potential mediators of these associations. We analyzed data from 3834 whites and 785 blacks enrolled in the Cardiovascular Health Study, a multicenter, population-based, longitudinal study of adults ages≥65 years from 4 US counties. The primary outcome was adjudicated incident ischemic stroke. Neighborhood socioeconomic status was measured using a composite of 6 census tract variables. Race-stratified multilevel Cox proportional hazard models were constructed adjusted for sociodemographic, behavioral, and biological risk factors. Among whites, in models adjusted for sociodemographic characteristics, stroke hazard was significantly higher among residents of neighborhoods in the lowest compared with the highest neighborhood socioeconomic status quartile (hazard ratio, 1.32; 95% CI, 1.01-1.72) with greater attenuation of the hazard ratio after adjustment for biological risk factors (hazard ratio, 1.16; 0.88-1.52) than for behavioral risk factors (hazard ratio, 1.30; 0.99-1.70). Among blacks, we found no significant associations between neighborhood socioeconomic status and ischemic stroke. Higher risk of incident ischemic stroke was observed in the most disadvantaged neighborhoods among whites, but not among blacks. The relationship between neighborhood socioeconomic status and stroke among whites appears to be mediated more strongly by biological than behavioral risk factors.

The effect of ultraviolet-B radiation on gene expression and pigment composition in etiolated and green pea leaf tissue: UV-B-induced changes are gene-specific and dependent upon the developmental stage

International Nuclear Information System (INIS)

Jordan, B.R.; James, P.E.; Strid, A.; Anthony, R.G.

1994-01-01

The effect of ultraviolet-B radiation (UV-B: 280–320nm) on gene expression and pigment composition has been investigated in pea tissue at different stages of development. Pea (Pisum sativum L., cv. Feltham First) seedlings were grown for 17d and then exposed to supplementary UV-B radiation. Chlorophyll a per unit fresh weight decreased by more than 20% compared with control levels after exposure to UV-B radiation for 7d. In contrast, chlorophyll b content remained the same or increased slightly. Leaf protein biosynthesis, as determined by 35 S-methionine incorporation, was rapidly inhibited by UV-B radiation, although the steady-state levels of proteins were either unchanged or only slightly altered. RNA transcripts for the chlorophyll a/b binding protein (cab) were also rapidly reduced to low or even undetectable levels in the expanded third leaf or younger leaf bud tissue after exposure to UV-B radiation. In contrast, cab RNA transcripts were either low or undetectable in etiolated pea tissue, but increased substantially in light and during exposure to UV-B radiation. The cab RNA transcripts were still present at control levels in pea plants after 7d of greening under supplementary UV-B radiation or UV-B alone. The protein composition changed significantly over the 7d of greening, but no differences could be detected between the light treatments. The increase in chlorophyll content was slightly greater during de-etiolation under supplementary UV-B radiation than under control irradiance. Under UV-B radiation alone, chlorophyll was synthesized at a greatly reduced rate. Changes in protective pigments were also determined. Anthocyanins did not change in either etiolated or green tissue exposed to UV-B radiation. However, other flavonoids increased substantially in either tissue during exposure to light and UV-B radiation. The RNA levels for chalcone synthase were measured in green and etiolated tissue exposed to UV-B radiation. The chs RNA transcripts were

The impact of social franchising on the use of reproductive health and family planning services at public commune health stations in Vietnam.

Science.gov (United States)

Ngo, Anh D; Alden, Dana L; Pham, Van; Phan, Ha

2010-02-28

Service franchising is a business model that involves building a network of outlets (franchisees) that are locally owned, but act in coordinated manner with the guidance of a central headquarters (franchisor). The franchisor maintains quality standards, provides managerial training, conducts centralized purchasing and promotes a common brand. Research indicates that franchising private reproductive health and family planning (RHFP) services in developing countries improves quality and utilization. However, there is very little evidence that franchising improves RHFP services delivered through community-based public health clinics. This study evaluates behavioral outcomes associated with a new approach - the Government Social Franchise (GSF) model - developed to improve RHFP service quality and capacity in Vietnam's commune health stations (CHSs). The project involved networking and branding 36 commune health station (CHS) clinics in two central provinces of Da Nang and Khanh Hoa, Vietnam. A quasi-experimental design with 36 control CHSs assessed GSF model effects on client use as measured by: 1) clinic-reported client volume; 2) the proportion of self-reported RHFP service users at participating CHS clinics over the total sample of respondents; and 3) self-reported RHFP service use frequency. Monthly clinic records were analyzed. In addition, household surveys of 1,181 CHS users and potential users were conducted prior to launch and then 6 and 12 months after implementing the GSF network. Regression analyses controlled for baseline differences between intervention and control groups. CHS franchise membership was significantly associated with a 40% plus increase in clinic-reported client volumes for both reproductive and general health services. A 45% increase in clinic-reported family planning service clients related to GSF membership was marginally significant (p = 0.05). Self-reported frequency of RHFP service use increased by 20% from the baseline survey to the

Establishment of a Site-Specific Tropospheric Model Based on Ground Meteorological Parameters over the China Region.

Science.gov (United States)

Zhou, Chongchong; Peng, Bibo; Li, Wei; Zhong, Shiming; Ou, Jikun; Chen, Runjing; Zhao, Xinglong

2017-07-27

China is a country of vast territory with complicated geographical environment and climate conditions. With the rapid progress of the Chinese BeiDou satellite navigation system (BDS); more accurate tropospheric models must be applied to improve the accuracy of navigation and positioning. Based on the formula of the Saastamoinen and Callahan models; this study develops two single-site tropospheric models (named SAAS_S and CH_S models) for the Chinese region using radiosonde data from 2005 to 2012. We assess the two single-site tropospheric models with radiosonde data for 2013 and zenith tropospheric delay (ZTD) data from four International GNSS Service (IGS) stations and compare them to the results of the Saastamoinen and Callahan models. The experimental results show that: the mean accuracy of the SAAS_S model (bias: 0.19 cm; RMS: 3.19 cm) at all radiosonde stations is superior to those of the Saastamoinen (bias: 0.62 cm; RMS: 3.62 cm) and CH_S (bias: -0.05 cm; RMS: 3.38 cm) models. In most Chinese regions; the RMS values of the SAAS_S and CH_S models are about 0.51~2.12 cm smaller than those of their corresponding source models. The SAAS_S model exhibits a clear improvement in the accuracy over the Saastamoinen model in low latitude regions. When the SAAS_S model is replaced by the SAAS model in the positioning of GNSS; the mean accuracy of vertical direction in the China region can be improved by 1.12~1.55 cm and the accuracy of vertical direction in low latitude areas can be improved by 1.33~7.63 cm. The residuals of the SAAS_S model are closer to a normal distribution compared to those of the Saastamoinen model. Single-site tropospheric models based on the short period of the most recent data (for example 2 years) can also achieve a satisfactory accuracy. The average performance of the SAAS_S model (bias: 0.83 cm; RMS: 3.24 cm) at four IGS stations is superior to that of the Saastamoinen (bias: -0.86 cm; RMS: 3.59 cm) and CH_S (bias: 0.45 cm; RMS: 3.38 cm

Phylogeny and expression analyses reveal important roles for plant PKS III family during the conquest of land by plants and angiosperm diversification

Directory of Open Access Journals (Sweden)

Lulu Xie

2016-08-01

Full Text Available AbstractPolyketide synthases (PKSs utilize the products of primary metabolism to synthesize a wide array of secondary metabolites in both prokaryotic and eukaryotic organisms. PKSs can be grouped into three distinct classes, type I, II, and III, based on enzyme structure, substrate specificity, and catalytic mechanisms. The type III PKS enzymes function as homodimers, and are the only class of PKS that do not require acyl carrier protein. Plant type III PKS enzymes, also known as chalcone synthase (CHS-like enzymes, are of particular interest due to their functional diversity. In this study, we mined type III PKS gene sequences from the genomes of six aquatic algae and twenty-five land plants (one bryophyte, one lycophyte, two basal angiosperms, sixteen core eudicots, and five monocots. PKS III sequences were found relatively conserved in all embryophytes, but not exist in algae. We also examined gene expression patterns by analyzing available transcriptome data, and identified potential cis regulatory elements in upstream sequences. Phylogenetic trees of dicots angiosperms showed that plant type III PKS proteins fall into three clades. Clade A contains CHS/STS-type enzymes coding genes with diverse transcriptional expression patterns and enzymatic functions, while clade B is further divided into subclades b1 and b2, which consist of anther-specific CHS-like enzymes. Differentiation regions, such as amino acids 196-207 between clades A and B, and predicted positive selected sites within α-helixes in late appeared branches of clade A, account for the major diversification in substrate choice and catalytic reaction. The integrity and location of conserved cis-elements containing MYB and bHLH binding sites can affect transcription levels. Potential binding sites for transcription factors such as WRKY, SPL or AP2/EREBP may contribute to tissue- or taxon-specific differences in gene expression. Our data shows that gene duplications and functional

Genomics reveals traces of fungal phenylpropanoid-flavonoid metabolic pathway in the f ilamentous fungus Aspergillus oryzae.

Science.gov (United States)

Juvvadi, Praveen Rao; Seshime, Yasuyo; Kitamoto, Katsuhiko

2005-12-01

Fungal secondary metabolites constitute a wide variety of compounds which either play a vital role in agricultural, pharmaceutical and industrial contexts, or have devastating effects on agriculture, animal and human affairs by virtue of their toxigenicity. Owing to their beneficial and deleterious characteristics, these complex compounds and the genes responsible for their synthesis have been the subjects of extensive investigation by microbiologists and pharmacologists. A majority of the fungal secondary metabolic genes are classified as type I polyketide synthases (PKS) which are often clustered with other secondary metabolism related genes. In this review we discuss on the significance of our recent discovery of chalcone synthase (CHS) genes belonging to the type III PKS superfamily in an industrially important fungus, Aspergillus oryzae. CHS genes are known to play a vital role in the biosynthesis of flavonoids in plants. A comparative genome analyses revealed the unique character of A. oryzae with four CHS-like genes (csyA, csyB, csyC and csyD) amongst other Aspergilli (Aspergillus nidulans and Aspergillus fumigatus) which contained none of the CHS-like genes. Some other fungi such as Neurospora crassa, Fusarium graminearum, Magnaporthe grisea, Podospora anserina and Phanerochaete chrysosporium also contained putative type III PKSs, with a phylogenic distinction from bacteria and plants. The enzymatically active nature of these newly discovered homologues is expected owing to the conservation in the catalytic residues across the different species of plants and fungi, and also by the fact that a majority of these genes (csyA, csyB and csyD) were expressed in A. oryzae. While this finding brings filamentous fungi closer to plants and bacteria which until recently were the only ones considered to possess the type III PKSs, the presence of putative genes encoding other principal enzymes involved in the phenylpropanoid and flavonoid biosynthesis (viz

LHD helical divertor

International Nuclear Information System (INIS)

Ohyabu, N.; Watanabe, T.; Ji Hantao

1993-07-01

The Large Helical Device (LHD) now under construction is a heliotron/torsatron device with a closed divertor system. The edge LHD magnetic structure has been studied in detail. A peculiar feature of the configuration is existence of edge surface layers, a complicated three dimensional magnetic structure which does not, however, seem to hamper the expected divertor functions. Two divertor operational modes are being considered for the LHD experiment, high density, cold radiative divertor operation as a safe heat removal scheme and high temperature divertor plasma operation. In the latter operation, a divertor plasma with temperature of a few kev, generated by efficient pumping, expects to lead to significant improvement in core plasma confinement. Conceptual designs of the LHD divertor components are under way. (author)

Chediak-Higashi syndrome presenting in the accelerated phase

African Journals Online (AJOL)

Chediak-Higashi syndrome (CHS) is an extremely rare autosomal recessive disorder characterised by recurrent pyogenic ... Genetic studies suggest a mutation in the lysosomal trafficking ... neuropathy and seizures in adolescence and early adulthood. ... of ataxia, tremors, muscle weakness, sensory loss, cranial nerve. Fig.

Competency based ophthalmology training curriculum for ...

African Journals Online (AJOL)

Background: The establishment of a credible, defensible and acceptable “formal competency based ophthalmology training curriculum for undergraduate medical and dental students” is fundamental to program recognition, monitoring and evaluation. The University of Zimbabwe College of Health Sciences (UZ-CHS) has ...

Remarks on application of VMEC and PROCTR to the Wendelstein 7-AS experiment

International Nuclear Information System (INIS)

Yamada, H.; Geiger, J.; Stroth, U.; Weller, A.; Howe, H.C.

1994-02-01

This report describes the application of the VMEC (Variational Moments Equilibrium Code) and PROCTR (PRedictOr Corrector TRansport code) numerical codes to the W7-AS experiment. The different versions of VMEC, each of which has been used for W7-AS and CHS (National Institute for Fusion Science, Nagoya, Japan), were compared to confirm their reliability and performance, and successfully benchmarked. The PROCTR code set was installed in the Wendelstein-VAX cluster. Its potential in experimental interpretation and theoretical analysis was demonstrated for coordinate inversion based on full 3-D geometry, power balance analysis and time-dependent transport simulation. The benchmark tests of tools for finite-β equilibrium and power balance analysis are a prerequisite for the joint profile and configuration database for stellarators which has just been started. We successfully recognized the compatibility of the schemes used on W7-AS and CHS. (orig.)

Severe dermatophytosis due to Trichophyton mentagrophytes var. interdigitale in flocks of green iguanas (Iguana iguana).

Science.gov (United States)

Khosravi, A R; Shokri, H; Rostami, A; Tamai, I A; Erfanmanesh, A; Memarian, I

2012-05-01

To describe the clinical, mycological, histopathological and molecular findings in green iguanas (Iguana iguana) affected with severe dermatophytosis in selected flocks near Tehran, Iran. Samples were collected from the scales of skin lesions and tested with standard mycological methods and dermatophyte-specific PCR amplification analysis using the primer pair for the chitin synthase 1(CHS1) gene. All iguanas were definitively diagnosed with dermatophytosis using both traditional and molecular diagnostic methods. PCR fingerprinting profiles using simple repetitive (GACA)4 primers showed that all diagnosed iguanas had the same pattern profile. Intraspecific variability was not observed for these isolates. Oligonucleotide sequencing of CHS1 gene PCR products confirmed Trichophyton mentagrophytes var. interdigitale as the infectious agent. These results suggest that (GACA)4-based PCR has utility both as a simple and rapid method for identification of dermatophyte species and for differentiation of T. mentagrophytes variants. © 2012 British Small Animal Veterinary Association.

Review paper on research ethics in Ethiopia: experiences and lessons learnt from Addis Ababa University College of Health Sciences 2007-2012.

Science.gov (United States)

Feleke, Yeweyenhareg; Addissie, Adamu; Wamisho, Biruk L; Davey, Gail

2015-01-01

Health research in Ethiopia is increasing both in volume and type, accompanied with expansion of higher education and research since the past few years. This calls for a proportional competence in the governance of medical research ethics in Ethiopia in the respective research and higher learning institutes. The paper highlights the evolution and progress ofthe ethics review at Addis Ababa University - College of Health Sciences (AAU-CHS) in the given context of health research review system in Ethiopia. Reflections are made on the key lessons to be drawnfrom the formative experiences of the Institutional Review Board (IRB) and their implications to the Ethiopian health research review system. This article is a review paper based on review of published and un published documents on research ethics in Ethiopia and the AAU-CHS (2007-2012). Thematic summaries of review findings are presented in thematic areas - formation of ethics review and key factors in the evolution of ethics review and implications. The IRB at AAU-CHS has been pivotal in providing review and follow-up for important clinical studies in Ethiopia. It has been one of the first IRBs to get WHO/SIDCER recognition from Africa and Ethiopia. Important factors in the successes of the IRB among others included leadership commitment, its placement in institutional structure, and continued capacity building. Financial challenges and sustainability issues need to be addressed for the sustained gains registered so far. Similar factors are considered important for the new and younger IRBs within the emergent Universities and research centers in the country.

Insight into the adsorption profiles of the Saprolegnia monoica chitin synthase MIT domain on POPA and POPC membranes by molecular dynamics simulation studies.

Science.gov (United States)

Kuang, Guanglin; Liang, Lijun; Brown, Christian; Wang, Qi; Bulone, Vincent; Tu, Yaoquan

2016-02-21

The critical role of chitin synthases in oomycete hyphal tip growth has been established. A microtubule interacting and trafficking (MIT) domain was discovered in the chitin synthases of the oomycete model organism, Saprolegnia monoica. MIT domains have been identified in diverse proteins and may play a role in intracellular trafficking. The structure of the Saprolegnia monoica chitin synthase 1 (SmChs1) MIT domain has been recently determined by our group. However, although our in vitro assay identified increased strength in interactions between the MIT domain and phosphatidic acid (PA) relative to other phospholipids including phosphatidylcholine (PC), the mechanism used by the MIT domain remains unknown. In this work, the adsorption behavior of the SmChs1 MIT domain on POPA and POPC membranes was systematically investigated by molecular dynamics simulations. Our results indicate that the MIT domain can adsorb onto the tested membranes in varying orientations. Interestingly, due to the specific interactions between MIT residues and lipid molecules, the binding affinity to the POPA membrane is much higher than that to the POPC membrane. A binding hotspot, which is critical for the adsorption of the MIT domain onto the POPA membrane, was also identified. The lower binding affinity to the POPC membrane can be attributed to the self-saturated membrane surface, which is unfavorable for hydrogen-bond and electrostatic interactions. The present study provides insight into the adsorption profile of SmChs1 and additionally has the potential to improve our understanding of other proteins containing MIT domains.

Desiccation resistance: effect of cuticular hydrocarbons and water content in Drosophila melanogaster adults

Directory of Open Access Journals (Sweden)

Jean-Francois Ferveur

2018-02-01

Full Text Available Background The insect cuticle covers the whole body and all appendages and has bi-directionnal selective permeability: it protects against environmental stress and pathogen infection and also helps to reduce water loss. The adult cuticle is often associated with a superficial layer of fatty acid-derived molecules such as waxes and long chain hydrocarbons that prevent rapid dehydration. The waterproofing properties of cuticular hydrocarbons (CHs depend on their chain length and desaturation number. Drosophila CH biosynthesis involves an enzymatic pathway including several elongase and desaturase enzymes. Methods The link between desiccation resistance and CH profile remains unclear, so we tested (1 experimentally selected desiccation-resistant lines, (2 transgenic flies with altered desaturase expression and (3 natural and laboratory-induced CH variants. We also explored the possible relationship between desiccation resistance, relative water content and fecundity in females. Results We found that increased desiccation resistance is linked with the increased proportion of desaturated CHs, but not with their total amount. Experimentally-induced desiccation resistance and CH variation both remained stable after many generations without selection. Conversely, flies with a higher water content and a lower proportion of desaturated CHs showed reduced desiccation resistance. This was also the case in flies with defective desaturase expression in the fat body. Discussion We conclude that rapidly acquired desiccation resistance, depending on both CH profile and water content, can remain stable without selection in a humid environment. These three phenotypes, which might be expected to show a simple relationship, turn out to have complex physiological and genetic links.

Analysis of the structural and functional roles of coupling helices in the ATP-binding cassette transporter MsbA through enzyme assays and molecular dynamics simulations.

Science.gov (United States)

Furuta, Tadaomi; Yamaguchi, Tomohiro; Kato, Hiroaki; Sakurai, Minoru

2014-07-08

ATP-binding cassette (ABC) transporters are constructed from some common structural units: the highly conserved nucleotide-binding domains (NBDs), which work as a nucleotide-dependent engine for driving substrate transport, the diverse transmembrane domains (TMDs), which create the translocation pathway, and the coupling helices (CHs), which are located at the NBD-TMD interface. Although the CHs are believed to be essential for NBD-TMD communication, their roles remain unclear. In this study, we performed enzyme assays and molecular dynamics (MD) simulations of the ABC transporter MsbA and two MsbA mutants in which the amino acid residues of one of the CHs were mutated to alanines: (i) wild type (Wt), (ii) CH1 mutant (Mt1), and (iii) CH2 mutant (Mt2). The experiments show that the CH2 mutation decreases the ATPase activity (kcat) compared with that of the Wt (a decrease of 32%), and a nearly equal degree of decrease in the ATP binding affinity (Km) was observed for both Mt1 and Mt2. The MD simulations successfully accounted for several structural and dynamical origins for these experimental observations. In addition, on the basis of collective motion and morphing analyses, we propose that the reverse-rotational motions and noddinglike motions between the NBDs and TMDs are indispensable for the conformational transition between the inward- and outward-facing conformations. In particular, CH2 is significantly important for the occurrence of the noddinglike motion. These findings provide important insights into the structure-function relationship of ABC transporters.

FTUC: A Flooding Tree Uneven Clustering Protocol for a Wireless Sensor Network.

Science.gov (United States)

He, Wei; Pillement, Sebastien; Xu, Du

2017-11-23

Clustering is an efficient approach in a wireless sensor network (WSN) to reduce the energy consumption of nodes and to extend the lifetime of the network. Unfortunately, this approach requires that all cluster heads (CHs) transmit their data to the base station (BS), which gives rise to the long distance communications problem, and in multi-hop routing, the CHs near the BS have to forward data from other nodes that lead those CHs to die prematurely, creating the hot zones problem. Unequal clustering has been proposed to solve these problems. Most of the current algorithms elect CH only by considering their competition radius, leading to unevenly distributed cluster heads. Furthermore, global distances values are needed when calculating the competition radius, which is a tedious task in large networks. To face these problems, we propose a flooding tree uneven clustering protocol (FTUC) suited for large networks. Based on the construction of a tree type sub-network to calculate the minimum and maximum distances values of the network, we then apply the unequal cluster theory. We also introduce referenced position circles to evenly elect cluster heads. Therefore, cluster heads are elected depending on the node's residual energy and their distance to a referenced circle. FTUC builds the best inter-cluster communications route by evaluating a cluster head cost function to find the best next hop to the BS. The simulation results show that the FTUC algorithm decreases the energy consumption of the nodes and balances the global energy consumption effectively, thus extending the lifetime of the network.

Effects of Childhood Asthma on the Development of Obesity among School-aged Children.

Science.gov (United States)

Chen, Zhanghua; Salam, Muhammad T; Alderete, Tanya L; Habre, Rima; Bastain, Theresa M; Berhane, Kiros; Gilliland, Frank D

2017-05-01

Asthma and obesity often occur together in children. It is unknown whether asthma contributes to the childhood obesity epidemic. We aimed to investigate the effects of asthma and asthma medication use on the development of childhood obesity. The primary analysis was conducted among 2,171 nonobese children who were 5-8 years of age at study enrollment in the Southern California Children's Health Study (CHS) and were followed for up to 10 years. A replication analysis was performed in an independent sample of 2,684 CHS children followed from a mean age of 9.7 to 17.8 years. Height and weight were measured annually to classify children into normal, overweight, and obese categories. Asthma status was ascertained by parent- or self-reported physician-diagnosed asthma. Cox proportional hazards models were fitted to assess associations of asthma history with obesity incidence during follow-up. We found that children with a diagnosis of asthma at cohort entry were at 51% increased risk of developing obesity during childhood and adolescence compared with children without asthma at baseline (hazard ratio, 1.51; 95% confidence interval, 1.08-2.10) after adjusting for confounders. Use of asthma rescue medications at cohort entry reduced the risk of developing obesity (hazard ratio, 0.57; 95% confidence interval, 0.33-0.96). In addition, the significant association between a history of asthma and an increased risk of developing obesity was replicated in an independent CHS sample. Children with asthma may be at higher risk of obesity. Asthma rescue medication use appeared to reduce obesity risk independent of physical activity.

Resistance mutation conserved between insects and mites unravels the benzoylurea insecticide mode of action on chitin biosynthesis.

Science.gov (United States)

Douris, Vassilis; Steinbach, Denise; Panteleri, Rafaela; Livadaras, Ioannis; Pickett, John Anthony; Van Leeuwen, Thomas; Nauen, Ralf; Vontas, John

2016-12-20

Despite the major role of chitin biosynthesis inhibitors such as benzoylureas (BPUs) in the control of pests in agricultural and public health for almost four decades, their molecular mode of action (MoA) has in most cases remained elusive. BPUs interfere with chitin biosynthesis and were thought to interact with sulfonylurea receptors that mediate chitin vesicle transport. Here, we uncover a mutation (I1042M) in the chitin synthase 1 (CHS1) gene of BPU-resistant Plutella xylostella at the same position as the I1017F mutation reported in spider mites that confers etoxazole resistance. Using a genome-editing CRISPR/Cas9 approach coupled with homology-directed repair (HDR) in Drosophila melanogaster, we introduced both substitutions (I1056M/F) in the corresponding fly CHS1 gene (kkv). Homozygous lines bearing either of these mutations were highly resistant to etoxazole and all tested BPUs, as well as buprofezin-an important hemipteran chitin biosynthesis inhibitor. This provides compelling evidence that BPUs, etoxazole, and buprofezin share in fact the same molecular MoA and directly interact with CHS. This finding has immediate effects on resistance management strategies of major agricultural pests but also on mosquito vectors of serious human diseases such as Dengue and Zika, as diflubenzuron, the standard BPU, is one of the few effective larvicides in use. The study elaborates on how genome editing can directly, rapidly, and convincingly elucidate the MoA of bioactive molecules, especially when target sites are complex and hard to reconstitute in vitro.

An investigation of the techno-economic impact of internal combustion engine based cogeneration systems on the energy requirements and greenhouse gas emissions of the Canadian housing stock

International Nuclear Information System (INIS)

Asaee, S. Rasoul; Ugursal, V. Ismet; Beausoleil-Morrison, Ian

2015-01-01

This study provides a techno-economic evaluation of retrofitting internal combustion engine (ICE) based cogeneration systems in the Canadian housing stock (CHS). The study was conducted using the Canadian Hybrid Residential End-Use Energy and GHG Emissions Model (CHREM). CHREM includes close to 17,000 unique house files that are statistically representative of the Canadian housing stock. The cogeneration system performance was evaluated using a high resolution integrated building performance simulation software. It is assumed that the ICE cogeneration system is retrofitted into all houses that currently use a central space heating system and have a suitable basement or crawl space. The GHG emission intensity factor associated with marginal electricity generation in each province is used to estimate the annual GHG emissions reduction due to the cogeneration system retrofit. The results show that cogeneration retrofit yields 13% energy savings in the CHS. While the annual GHG emissions would increase in some provinces due to cogeneration retrofits, the total GHG emissions of the CHS would be reduced by 35%. The economic analysis indicates that ICE cogeneration system retrofits may provide an economically feasible opportunity to approach net/nearly zero energy status for existing Canadian houses. - Highlights: • Techno-economic evaluation ICE cogeneration systems for Canadian housing is reported. • ICE cogeneration retrofit could yield 13% annual energy savings in Canadian housing. • Annual GHG emissions of Canadian housing could decrease by 35% with ICE cogeneration. • But, in some provinces, GHG emissions would increase as a result of ICE cogeneration

The Open Flux Problem

Science.gov (United States)

Linker, J. A.; Caplan, R. M.; Downs, C.; Riley, P.; Mikic, Z.; Lionello, R.; Henney, C. J.; Arge, C. N.; Liu, Y.; Derosa, M. L.; Yeates, A.; Owens, M. J.

2017-10-01

The heliospheric magnetic field is of pivotal importance in solar and space physics. The field is rooted in the Sun’s photosphere, where it has been observed for many years. Global maps of the solar magnetic field based on full-disk magnetograms are commonly used as boundary conditions for coronal and solar wind models. Two primary observational constraints on the models are (1) the open field regions in the model should approximately correspond to coronal holes (CHs) observed in emission and (2) the magnitude of the open magnetic flux in the model should match that inferred from in situ spacecraft measurements. In this study, we calculate both magnetohydrodynamic and potential field source surface solutions using 14 different magnetic maps produced from five different types of observatory magnetograms, for the time period surrounding 2010 July. We have found that for all of the model/map combinations, models that have CH areas close to observations underestimate the interplanetary magnetic flux, or, conversely, for models to match the interplanetary flux, the modeled open field regions are larger than CHs observed in EUV emission. In an alternative approach, we estimate the open magnetic flux entirely from solar observations by combining automatically detected CHs for Carrington rotation 2098 with observatory synoptic magnetic maps. This approach also underestimates the interplanetary magnetic flux. Our results imply that either typical observatory maps underestimate the Sun’s magnetic flux, or a significant portion of the open magnetic flux is not rooted in regions that are obviously dark in EUV and X-ray emission.

The Open Flux Problem

Energy Technology Data Exchange (ETDEWEB)

Linker, J. A.; Caplan, R. M.; Downs, C.; Riley, P.; Mikic, Z.; Lionello, R. [Predictive Science Inc., 9990 Mesa Rim Road, Suite 170, San Diego, CA 92121 (United States); Henney, C. J. [Air Force Research Lab/Space Vehicles Directorate, 3550 Aberdeen Avenue SE, Kirtland AFB, NM (United States); Arge, C. N. [Science and Exploration Directorate, NASA/GSFC, Greenbelt, MD 20771 (United States); Liu, Y. [W. W. Hansen Experimental Physics Laboratory, Stanford University, Stanford, CA 94305 (United States); Derosa, M. L. [Lockheed Martin Solar and Astrophysics Laboratory, 3251 Hanover Street B/252, Palo Alto, CA 94304 (United States); Yeates, A. [Department of Mathematical Sciences, Durham University, Durham, DH1 3LE (United Kingdom); Owens, M. J., E-mail: linkerj@predsci.com [Space and Atmospheric Electricity Group, Department of Meteorology, University of Reading, Earley Gate, P.O. Box 243, Reading RG6 6BB (United Kingdom)

2017-10-10

The heliospheric magnetic field is of pivotal importance in solar and space physics. The field is rooted in the Sun’s photosphere, where it has been observed for many years. Global maps of the solar magnetic field based on full-disk magnetograms are commonly used as boundary conditions for coronal and solar wind models. Two primary observational constraints on the models are (1) the open field regions in the model should approximately correspond to coronal holes (CHs) observed in emission and (2) the magnitude of the open magnetic flux in the model should match that inferred from in situ spacecraft measurements. In this study, we calculate both magnetohydrodynamic and potential field source surface solutions using 14 different magnetic maps produced from five different types of observatory magnetograms, for the time period surrounding 2010 July. We have found that for all of the model/map combinations, models that have CH areas close to observations underestimate the interplanetary magnetic flux, or, conversely, for models to match the interplanetary flux, the modeled open field regions are larger than CHs observed in EUV emission. In an alternative approach, we estimate the open magnetic flux entirely from solar observations by combining automatically detected CHs for Carrington rotation 2098 with observatory synoptic magnetic maps. This approach also underestimates the interplanetary magnetic flux. Our results imply that either typical observatory maps underestimate the Sun’s magnetic flux, or a significant portion of the open magnetic flux is not rooted in regions that are obviously dark in EUV and X-ray emission.

Sequence Classification: 892983 [

Lifescience Database Archive (English)

Full Text Available r protein of unknown function; deletion results in sensitivity to anticancer drugs oxaliplatin and cisplatin..., but not mitomycin C; deletion is synthetically lethal with a chitin synthase (CHS1) null mutant; Psy2p || http://www.ncbi.nlm.nih.gov/protein/6324128 ...

The Colletotrichum acutatum complex

NARCIS (Netherlands)

Damm, U.; Cannon, P.F.; Woudenberg, J.H.C.; Crous, P.W.

2012-01-01

Colletotrichum acutatum is known as an important anthracnose pathogen of a wide range of host plants worldwide. Numerous studies have reported subgroups within the C. acutatum species complex. Multilocus molecular phylogenetic analysis (ITS, ACT, TUB2, CHS-1, GAPDH, HIS3) of 331 strains previously

Chalcone synthase genes from milk thistle (Silybum marianum ...

Indian Academy of Sciences (India)

In the current research, fragments of CHS genes were amplified ... transcript level in petals in the early flowering stage and in the stem of five upper leaves, followed by five upper leaves in the ..... First strand cDNA was amplified by 1 μg of.

Metabolite profiling of Arabidopsis thaliana (L.) plants transformed with an antisense chalcone synthase gene

DEFF Research Database (Denmark)

Le Gall, G.; Metzdorff, Stine Broeng; Pedersen, Jan W.

2005-01-01

A metabolite profiling study has been carried out on Arabidopsis thaliana (L.) Heynh. ecotype Wassilewskija and a series of transgenic lines of the ecotype transformed with a CHS (chalcone synthase) antisense construct. Compound identifications by LC/MS and H-1 NMR are discussed. The glucosinolate...

Transactivation of Ds by Ac-transposase gene fusions in tobacco

NARCIS (Netherlands)

Rommens, Caius M.T.; Haaren, Mark J.J. van; Buchel, Annemarie S.; Mol, Joseph N.M.; Tunen, Arjen J. van; Nijkamp, H. John J.; Hille, Jacques

1992-01-01

To study regulation of the (Ds) transposition process in heterologous plant species, the transposase gene of Ac was fused to several promoters that are active late during plant development. These promoters are the flower-specific chalcone synthase A promoter (CHS A), the anther-specific chalcone

GPCR Interaction: 158 [GRIPDB[Archive

Lifescience Database Archive (English)

Full Text Available f CCR1 A Chemokine CCR1 CCR1 A Chemokine CCR1 CCR1 Experiment The different oligomeric states are indicated by affinity chromatograph..., dimers and higher order oligomers of CCR1 solubilized in DDM/CHS. 19275940 Affinity chromatography NP_001286.1 ...

Species of the Colletotrichum gloeosporioides complex associated with anthracnose diseases of Proteaceae

NARCIS (Netherlands)

Liu, F.; Damm, U.; Cai, L.; Crous, P.W.

2013-01-01

Anthracnose disease of Proteaceae has in the past chiefly been attributed to infections by C. acutatum, C. boninense and C. gloeosporioides. In the present study, a multi-locus phylogenetic analysis (ACT, CAL, CHS-1, GAPDH, GS, ITS, TUB2) revealed that strains of the C. gloeosporioides complex

Radiographic evaluation of destructive periodontal disease in blue mink in relation to age and blood morphology

DEFF Research Database (Denmark)

Hammer, Anne Sofie; Andersen, Thomas Holmen; Eriksen, Thomas

2005-01-01

In this study, blood samples and jaws were collected from 2 genotypes of blue mink (n = 289) in order to examine phenotypic expression of specific characteristics of Chediak-Higashi Syndrome (C-HS). Blood samples were subjected to differential counts to assess the proportion of abnormal polymorph...

Distance learning approach to train health sciences students at the ...

African Journals Online (AJOL)

Background: The University of Nairobi (UoN) College of Health Sciences (CHS) established Partnership for Innovative Medical Education in Kenya (PRIME-K) programmeme to enhance health outcomes in Kenya through extending the reach of medical training outside Nairobi to help health sciences students enhance their ...

Numerical/experimental research on welded joints in aluminium truss girders

NARCIS (Netherlands)

van Hove, B.W.E.M.; Soetens, F.; Mazzolani, F.M.; Bellucci, F.; Faggiano, B.; Squillace, A.

2016-01-01

Welded joints in a 30 meter span aluminium truss girder were investigated numerically and experimentally. Since aluminium design rules for welded K-and N-joints in CHS truss girders were lacking the joints were checked using steel design rules. Calculations showed that the N-joints were governing

Combined gelatin-chondroitin sulfate hydrogels for controlled release of cationic antibacterial proteins

NARCIS (Netherlands)

Kuijpers, A. J.; Engbers, G. H. M.; Meyvis, T. K. L.; de Smedt, S. S. C.; Demeester, J.; Krijgsveld, J.; Zaat, S. A. J.; Dankert, J.; Feijen, J.

2000-01-01

Chemically cross-linked gelatin-chondroitin sulfate (ChS) hydrogels were prepared for the controlled release of small cationic proteins. The amount of chondroitin sulfate in the gelatin gels varied between 0 and 20 wt %. The chemical cross-link density, the degree of swelling, and the rheological

HS5 of the human β-globin Locus Control Region: a developmental stage-specific border in erythroid cells.

NARCIS (Netherlands)

A. Wai (Albert); N. Gillemans (Nynke); S. Raguz-Bolognesi (Selina); S. Pruzina (Sara); G. Zafarana (Gaetano); D.N. Meijer (Dies); F.G. Grosveld (Frank); J.N.J. Philipsen (Sjaak)

2003-01-01

textabstractElements with insulator/border activity have been characterized most extensively in Drosophila melanogaster. In vertebrates, the first example of such an element was provided by a hypersensitive site of the chicken beta-globin locus, cHS4. It has been proposed that the homologous site in

Development of novel microsatellite markers for Holothurian scabra (Holothuriidae), Apostichopus japonicas (Stichopodidae) and cross-species testing in other sea cucumbers

Science.gov (United States)

Shangguan, Jingbo; Li, Zhongbao

2018-03-01

Thirty-five new microsatellite loci from the sea cucumbers Holothurian scabra (Jaeger, 1833) and Apostichopus japonicas (Selenka, 1867) were screened and characterized using the method of magnetic bead enrichment. Of the twenty-four polymorphic loci tested, eighteen were consistent with Hardy-Weinberg equilibrium after a modified false discovery rate (B-Y FDR) correction, whereas six showed statistically significant deviations (CHS2 and CHS11: Psea cucumbers ( Holothurian scabra, Holothuria leucospilota, Stichopus horrens and Apostichopus japonicas) were tested for mutual cross-amplification using a total of ninety microsatellite loci. Although transferability and universality of all loci were generally low, the results of the cross-species study showed that the markers can be applied to identify individuals to species according to the presence or absence of specific microsatellite alleles. The microsatellite markers reported here will contribute to the study of genetic diversity, assisted breeding, and population conservation in sea cucumbers, as well as allow for the identification of individuals to closely related species.

The bZip transscription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.

Science.gov (United States)

Liu, Chao-Chao; Chi, Cheng; Jin, Li-Juan; Zhu, Jianhua; Yu, Jing-Quan; Zhou, Yan-Hong

2018-03-22

The production of anthocyanin is regulated by light and corresponding photoreceptors. In this study, we found that exposure to blue light and overexpression of CRY1a are associated with increased accumulation of anthocyanin in tomato (Solanum lycopersicum L.). These responses are the result of changes in mRNA and the protein levels of SlHY5, a transcription factor. In vitro and in vivo experiments using EMSA and ChIP-qPCR assays revealed that SlHY5 could directly recognize and bind to the G-box and ACE motifs in the promoters of anthocyanin biosynthesis genes, such as CHS1, CHS2 and DFR. Silencing of SlHY5 in OE-CRY1a lines decreased the accumulation of anthocyanin. The findings presented here not only deepened our understanding of how light controls anthocyanin biosynthesis and associated photoprotection in tomato leaves, but also allowed us to explore potential targets for improving pigment production. This article is protected by copyright. All rights reserved.

HIGH: A Hexagon-based Intelligent Grouping Approach in Wireless Sensor Networks

Directory of Open Access Journals (Sweden)

FAN, C.-S.

2016-02-01

Full Text Available In a random deployment or uniform deployment strategy, sensor nodes are scattered randomly or uniformly in the sensing field, respectively. Hence, the coverage ratio cannot be guaranteed. The coverage ratio of uniform deployment, in general, is larger than that of the random deployment strategy. However, a random deployment or uniform deployment strategy may cause unbalanced traffic pattern in wireless sensor networks (WSNs. Therefore, cluster heads (CHs around the sink have larger loads than those farther away from the sink. That is, CHs close to the sink exhaust their energy earlier. In order to overcome the above problem, we propose a Hexagon-based Intelligent Grouping approacH in WSNs (called HIGH. The coverage, energy consumption and data routing issues are well investigated and taken into consideration in the proposed HIGH scheme. The simulation results validate our theoretical analysis and show that the proposed HIGH scheme achieves a satisfactory coverage ratio, balances the energy consumption among sensor nodes, and extends network lifetime significantly.

Preventive Migraine Treatment

Science.gov (United States)

Silberstein, Stephen D.

2015-01-01

Purpose of Review: This article reviews the evidence base for the preventive treatment of migraine. Recent Findings: Evidence-based guidelines for the preventive treatment of migraine have recently been published by the American Academy of Neurology (AAN) and the Canadian Headache Society (CHS), providing valuable guidance for clinicians. Strong evidence exists to support the use of metoprolol, timolol, propranolol, divalproex sodium, sodium valproate, and topiramate for migraine prevention, according to the AAN. Based on best available evidence, adverse event profile, and expert consensus, topiramate, propranolol, nadolol, metoprolol, amitriptyline, gabapentin, candesartan, Petasites (butterbur), riboflavin, coenzyme Q10, and magnesium citrate received a strong recommendation for use from the CHS. Summary: Migraine preventive drug treatments are underutilized in clinical practice. Principles of preventive treatment are important to improve compliance, minimize side effects, and improve patient outcomes. Choice of preventive treatment of migraine should be based on the presence of comorbid and coexistent illness, patient preference, reproductive potential and planning, and best available evidence. PMID:26252585

Rich: Region-based Intelligent Cluster-Head Selection and Node Deployment Strategy in Concentric-based WSNs

Directory of Open Access Journals (Sweden)

FAN, C.-S.

2013-11-01

Full Text Available In a random deployment, sensor nodes are scattered randomly in the sensing field. Hence, the coverage can not be guaranteed. In contrast, the coverage of uniformly deployment is in general larger than the random deployment. However, uniformly deployment strategy may cause unbalanced traffic pattern in wireless sensor networks (WSNs. In this situation, larger load may be imposed to CHs (cluster heads around the sink. Therefore, CHs close to the sink use up their energy earlier than those farther away from the sink. To overcome this problem, we propose a novel node deployment strategy in the concentric model, namely, Region-based Intelligent Cluster-Head selection and node deployment strategy (called Rich. The coverage, energy consumption and data routing issues are well investigated and taken into consideration in the proposed Rich scheme. The simulation results show that the proposed Rich alleviates the unbalanced traffic pattern significantly, prolongs network lifetime and achieves satisfactory coverage ratio.

Chronic low-dose UVA irradiation induces local suppression of contact hypersensitivity, Langerhans cell depletion and suppressor cell activation in C3H/HeJ mice

International Nuclear Information System (INIS)

Bestak, Rosa; Halliday, G.M.

1996-01-01

It has previously been demonstrated that chronic low-dose solar-simulated UV radiation could induce both local and systemic immunosuppression as well as tolerance to a topically applied hapten. In this study, we have used a chronic low-dose UV-irradiation protocol to investigate the effects of UVA on the skin immune system of C3H/HeJ mice. Irradiation with UVA+B significantly suppressed the local and systemic primary contact hypersensitivity (CHS) response to the hapten 2,4,6-trinitrochlorobenzene. Furthermore, UVA+B reduced Langerhans cell (LC) and dendritic epidermal T cell (DETC) densities in chronically UV-irradiated mice. Ultraviolet A irradiation induced local, but not systemic, immunosuppression and reduced LC (32%) but not DETC from the epidermis compared to the shaved control animals. Treatment of mice with both UVA+B and UVA radiation also induced an impaired secondary CHS response, and this tolerance was transferable with spleen cells. (Author)

Morphological changes of the filamentous fungus Mucor mucedo and inhibition of chitin synthase activity induced by anethole.

Science.gov (United States)

Yutani, Masahiro; Hashimoto, Yukie; Ogita, Akira; Kubo, Isao; Tanaka, Toshio; Fujita, Ken-ichi

2011-11-01

trans-Anethole (anethole), a major component of anise oil, has a broad antimicrobial spectrum with antimicrobial activity relatively weaker than those of well-known antibiotics, and significantly enhances the antifungal activity of polygodial and dodecanol against the baker's yeast Saccharomyces cerevisiae and human pathogenic yeast Candida albicans. However, the antifungal mechanism of anethole is unresolved. Anethole demonstrated antifungal activity against the filamentous fungus, Mucor mucedo IFO 7684, accompanied by hyphal morphological changes such as swollen hyphae at the tips. Its minimum growth inhibitory concentration was 0.625 mM. A hyperosmotic condition (1.2 M sorbitol) restricted the induction of morphological changes, while hypoosmotic treatment (distilled water) induced bursting of hyphal tips and leakage of cytoplasmic constituents. Furthermore, anethole dose-dependently inhibited chitin synthase (CHS) activity in permeabilized hyphae in an uncompetitive manner. These results suggest that the morphological changes of M. mucedo could be explained by the fragility of cell walls caused by CHS inhibition. Copyright © 2011 John Wiley & Sons, Ltd.

Browse Title Index

African Journals Online (AJOL)

Items 9701 - 9750 of 11090 ... MO Oke, SO Awonorin, OJ Oyelade, JO Olajide, GO Olaniyan, PO Sobukola. Vol 10, No 3 (2011), Sonicated date syrup media preparation for microbial culture, Abstract PDF. SH Nazari. Vol 10, No 56 (2011), Sonication assisted Agrobacterium-mediated transformation of chalcone synthase (CHS) ...

Beam-driven currents in the 1/ν regime in a helical system

International Nuclear Information System (INIS)

Nakajima, Noriyoshi; Okamoto, Masao.

1990-04-01

Beam currents driven by a neutral particle injection in a helical system (stellarator, heliotron/torsatron) are studied in the 1/ν collisionality regime. The general expression for the beam-driven current is obtained for arbitrary magnetic field configurations by solving the drift kinetic equation for electrons. It is found that F = J(net)/J(b) (J(net) is the net current and J(b) is the fast ion beam current) increases as f(t) and Zeff where f(t) is the fraction of trapped electrons and Zeff is the effective ionic charge number. Especially, for Zeff ≅ 1 the effect of trapped electrons is large and F is roughly proportional to f(t). On the other hand, if Zeff > or approx 3 the effect of trapped electrons becomes small. (author)

A randomized controlled trial comparing customized versus standard headrests for head and neck radiotherapy immobilization in terms of set-up errors, patient comfort and staff satisfaction (ICORG 08-09)

International Nuclear Information System (INIS)

Howlin, C.; O'Shea, E.; Dunne, M.; Mullaney, L.; McGarry, M.; Clayton-Lea, A.; Finn, M.; Carter, P.; Garret, B.; Thirion, P.

2015-01-01

Purpose: To recommend a specific headrest, customized or standard, for head and neck radiotherapy patients in our institution based primarily on an evaluation of set-up accuracy, taking into account a comparison of patient comfort, staff and patient satisfaction, and resource implications. Methods and materials: Between 2008 and 2009, 40 head and neck patients were randomized to either a standard (Arm A, n = 21) or customized (Arm B, n = 19) headrest, and immobilized with a customized thermoplastic mask. Set-up accuracy was assessed using electronic portal images (EPI). Random and systematic set-up errors for each arm were determined from 668 EPIs, which were analyzed by one Radiation Therapist. Patient comfort was assessed using a visual analogue scale (VAS) and staff satisfaction was measured using an in-house questionnaire. Resource implications were also evaluated. Results: The difference in set-up errors between arms was not significant in any direction. However, in this study the standard headrest (SH) arm performed well, with set-up errors comparative to customized headrests (CHs) in previous studies. CHs require regular monitoring and 47% were re-vacuumed making them more resource intensive. Patient comfort and staff satisfaction were comparable in both arms. Conclusion: The SH provided similar treatment accuracy and patient comfort compared with the CH. The large number of CHs that needed to be re-vacuumed undermines their reliability for radiotherapy schedules that extend beyond 34 days from the initial CT scan. Accordingly the CH was more resource intensive without improving the accuracy of positioning, thus the standard headrest is recommended for continued use at our institution

Continuous Blood Glucose Monitoring May Detect Carotid Occlusion Intolerance during Carotid Artery Stenting.

Science.gov (United States)

Hiramatsu, Ryo; Furuse, Motomasa; Yagi, Ryokichi; Ohmura, Tomohisa; Ohnishi, Hiroyuki; Ikeda, Naokado; Nonoguchi, Naosuke; Kawabata, Shinji; Miyachi, Shigeru; Kuroiwa, Toshihiko

2018-02-05

The frequency of the occurrence of adverse events associated with carotid artery stenting (CAS) is usually low, but serious adverse events such as cerebral hyperperfusion syndrome (CHS) may occur. Real-time monitoring is ideal for the early detection of adverse events during the surgical procedure. This study aimed to evaluate continuous blood glucose (BG) monitoring for the detection of adverse events during CAS. Forty patients undergoing scheduled CAS were prospectively enrolled. An artificial pancreas was used for continuous BG monitoring (once per minute), using venous blood extracted at a rate of 2 mL/hr during CAS. The primary endpoint was a correlation between BG change and adverse events. CAS was discontinued in 1 patient, and BG was not measured in 5 patients (12.5%) because of the inability to extract blood. Among 34 evaluable patients, no patient developed CHS, but 3 patients (9%) experienced carotid occlusion intolerance. During CAS, BG was significantly higher in patients with carotid occlusion intolerance (median: 5 mg/dL) than in patients without carotid occlusion intolerance (median: 0 mg/dL) (P = 0.0221). A cutoff BG value ≥4 mg/dL during CAS showed 50% sensitivity and 100% specificity for the detection of carotid occlusion intolerance. There was no significant correlation between BG change and other adverse events. BG elevation may help detect carotid occlusion intolerance although it is still unknown whether BG monitoring can detect CHS. Further studies should validate that a cutoff BG elevation value of ≥4 mg/dL during CAS indicates carotid occlusion intolerance. Copyright © 2018 Elsevier Inc. All rights reserved.

WAFs lead molting retardation of naupliar stages with down-regulated expression profiles of chitin metabolic pathway and related genes in the copepod Tigriopus japonicus.

Science.gov (United States)

Hwang, Dae-Sik; Lee, Min-Chul; Kyung, Do-Hyun; Kim, Hui-Su; Han, Jeonghoon; Kim, Il-Chan; Puthumana, Jayesh; Lee, Jae-Seong

2017-03-01

Oil pollution is considered being disastrous to marine organisms and ecosystems. As molting is critical in the developmental process of arthropods in general and copepods, in particular, the impact will be adverse if the target of spilled oil is on molting. Thus, we investigated the harmful effects of water accommodated fractions (WAFs) of crude oil with an emphasis on inhibition of chitin metabolic pathways related genes and developmental retardation in the copepod Tigriopus japonicus. Also, we analysed the ontology and domain of chitin metabolic pathway genes and mRNA expression patterns of developmental stage-specific genes. Further, the developmental retardation followed by transcriptional modulations in nuclear receptor genes (NR) and chitin metabolic pathway-related genes were observed in the WAFs-exposed T. japonicus. As a result, the developmental time was found significantly (P<0.05) delayed in response to 40% WAFs in comparison with that of control. Moreover, the NR gene, HR3 and chitinases (CHT9 and CHT10) were up-regulated in N4-5 stages, while chitin synthase genes (CHS-1, CHS-2-1, and CHS-2-2) down-regulated in response to WAFs. In brief, a high concentration of WAFs repressed nuclear receptor genes but elicited activation of some of the transcription factors at low concentration of WAFs, resulting in suppression of chitin synthesis. Thus, we suggest that WAF can lead molting retardation of naupliar stages in T. japonicus through down-regulations of chitin metabolism. These findings will provide a better understanding of the mode of action of chitin biosynthesis associated with molting mechanism in WAF-exposed T. japonicus. Copyright © 2016 Elsevier Inc. All rights reserved.

A wild 'albino' bilberry (Vaccinium myrtillus L. from Slovenia shows three bottlenecks in the anthocyanin pathway and significant differences in the expression of several regulatory genes compared to the common blue berry type.

Directory of Open Access Journals (Sweden)

Zala Zorenc

Full Text Available Relative expressions of structural genes and a number of transcription factors of the anthocyanin pathway relevant in Vaccinium species, and related key enzyme activities were compared with the composition and content of metabolites in skins of ripe fruits of wild albino and blue bilberry (Vaccinium myrtillus found in Slovenia. Compared to the common blue type, the albino variant had a 151-fold lower total anthocyanin and a 7-fold lower total phenolic content in their berry skin, which correlated with lower gene expression of flavonoid 3-O-glycosyltransferase (FGT; 33-fold, flavanone 3-hydroxylase (FHT; 18-fold, anthocyanidin synthase (ANS; 11-fold, chalcone synthase (CHS, 7.6-fold and MYBPA1 transcription factor (22-fold. The expression of chalcone isomerase (CHI, dihydroflavonol 4-reductase (DFR, leucoanthocyanidin reductase (LAR, anthocyanidin reductase (ANR and MYBC2 transcription factor was reduced only by a factor of 1.5-2 in the albino berry skins, while MYBR3 and flavonoid 3',5'-hydroxylase (F3'5'H were increased to a similar extent. Expression of the SQUAMOSA class transcription factor TDR4, in contrast, was independent of the color type and does therefore not seem to be correlated with anthocyanin formation in this variant. At the level of enzymes, significantly lower FHT and DFR activities, but not of phenylalanine ammonia-lyase (PAL and CHS/CHI, were observed in the fruit skins of albino bilberries. A strong increase in relative hydroxycinnamic acid derivative concentrations indicates the presence of an additional bottleneck in the general phenylpropanoid pathway at a so far unknown step between PAL and CHS.

Arctic mustard flower color polymorphism controlled by petal-specific downregulation at the threshold of the anthocyanin biosynthetic pathway.

Directory of Open Access Journals (Sweden)

Cynthia A Dick

2011-04-01

Full Text Available Intra- and interspecific variation in flower color is a hallmark of angiosperm diversity. The evolutionary forces underlying the variety of flower colors can be nearly as diverse as the colors themselves. In addition to pollinator preferences, non-pollinator agents of selection can have a major influence on the evolution of flower color polymorphisms, especially when the pigments in question are also expressed in vegetative tissues. In such cases, identifying the target(s of selection starts with determining the biochemical and molecular basis for the flower color variation and examining any pleiotropic effects manifested in vegetative tissues. Herein, we describe a widespread purple-white flower color polymorphism in the mustard Parrya nudicaulis spanning Alaska. The frequency of white-flowered individuals increases with increasing growing-season temperature, consistent with the role of anthocyanin pigments in stress tolerance. White petals fail to produce the stress responsive flavonoid intermediates in the anthocyanin biosynthetic pathway (ABP, suggesting an early pathway blockage. Petal cDNA sequences did not reveal blockages in any of the eight enzyme-coding genes in white-flowered individuals, nor any color differentiating SNPs. A qRT-PCR analysis of white petals identified a 24-fold reduction in chalcone synthase (CHS at the threshold of the ABP, but no change in CHS expression in leaves and sepals. This arctic species has avoided the deleterious effects associated with the loss of flavonoid intermediates in vegetative tissues by decoupling CHS expression in petals and leaves, yet the correlation of flower color and climate suggests that the loss of flavonoids in the petals alone may affect the tolerance of white-flowered individuals to colder environments.

Antipsychotic Use and Hospitalization Among Older Assisted Living Residents: Does Risk Vary by Frailty Status?

Science.gov (United States)

Stock, Kathryn J; Hogan, David B; Lapane, Kate; Amuah, Joseph E; Tyas, Suzanne L; Bronskill, Susan E; Morris, Andrew M; Bell, Chaim M; Jeffs, Lianne; Maxwell, Colleen J

2017-07-01

To examine associations between baseline frailty measures, antipsychotic use, and hospitalization over 1 year and whether hospitalization risk associated with antipsychotic use varies by frailty level. In this prospective cohort study of 1,066 residents (mean age: 85 years; 77% women) from the Alberta Continuing Care Epidemiological Studies, trained research nurses conducted comprehensive resident assessments at baseline (2006-2007) for sociodemographic characteristics, health conditions, frailty status, behavioral problems, and all medications consumed during the past 3 days. Two separate measures of frailty were assessed, the Cardiovascular Health Study (CHS) phenotype and an 86-item Frailty Index (FI). Time to first hospitalization during follow-up was determined via linkage with the Alberta Inpatient Discharge Abstract Database. Baseline frailty status (both measures), but not antipsychotic use, was significantly associated with hospitalization over 1 year. When stratified by frailty, FI-defined frail residents using antipsychotics showed a significantly increased risk for hospitalization (adjusted HR: 1.54; 95% CI: 1.01-2.36) compared with frail nonusers. CHS-defined frail antipsychotic users versus frail nonusers also showed an elevated risk (adjusted HR: 1.67; 95% CI: 0.96-2.88). Nonfrail residents using antipsychotics were significantly less likely to be hospitalized compared with nonfrail nonusers whether defined by the FI (adjusted HR: 0.62; 95% CI: 0.39-0.99) or CHS criteria (adjusted HR: 0.62; 95% CI: 0.40-0.96). Frailty measures may be helpful in identifying those who are particularly vulnerable to adverse effects and those who may experience benefit with treatment. Copyright © 2017 American Association for Geriatric Psychiatry. Published by Elsevier Inc. All rights reserved.

A Study of the Interplanetary Signatures of Earth-Arriving CMEs

Science.gov (United States)

Akiyama, S.; Yashiro, S.; Gopalswamy, N.; Xie, H.; Makela, P. A.; Kay, C.

2017-12-01

We studied interplanetary (IP) signatures associated with coronal mass ejections (CMEs) that are likely to reach Earth. In order to find Earth- arriving CMEs, we started with disk-center CMEs originating within 30 degrees from the central meridian and the equator. Using the side-view images from the STEREO mission, we excluded CMEs that faded out before reaching the Earth orbit, or were captured by other CMEs, or erupted away from the ecliptic plane. We found 61 Earth- arriving CMEs during 2009/10/01 - 2012/07/31 (inclusive). Though all events were observed to reach Earth in the STEREO/HI2 field of view, only 34 out of 61 events (56%) were associated with magnetic cloud (MC) or ejecta (EJ) observed by ACE or Wind. We compared the CME characteristics associated with 9 MCs, 25 EJs, and 27 no- clear- signature (NCS) events to find out what might cause the difference in the IP signatures. To avoid projection effects, we used coronagraph images obtained by the STEREO mission. The average speed (width) of CMEs associated with MCs, EJs, and NCSs are 484 km/s (104°), 663 km/s (135°), and 595 km/s (144°), respectively. CMEs associated with MCs tend to be less energetic than other types in our dataset. We also checked the coronal holes (CHs) near the CME source to examine the effect of the CME deflection. In the case of MCs and EJs, only 22% (2/9) and 28% (7/25) events have CHs near the source, while 48% (13/27) NCS events have nearby CHs. We discuss what factors near the Sun cause the observed differences at Earth.

Fracture Strength of Three-Unit Implant Supported Fixed Partial Dentures with Excessive Crown Height Fabricated from Different Materials

Directory of Open Access Journals (Sweden)

Vahideh Nazari

2017-01-01

Full Text Available Objectives: Fracture strength is an important factor influencing the clinical long-term success of implant-supported prostheses especially in high stress situations like excessive crown height space (CHS. The purpose of this study was to compare the fracture strength of implant-supported fixed partial dentures (FPDs with excessive crown height, fabricated from three different materials.Materials and Methods: Two implants with corresponding abutments were mounted in a metal model that simulated mandibular second premolar and second molar. Thirty 3-unit frameworks with supportive anatomical design were fabricated using zirconia, nickel-chromium alloy (Ni-Cr, and polyetheretherketone (PEEK (n=10. After veneering, the CHS was equal to 15mm. Then; samples were axially loaded on the center of pontics until fracture in a universal testing machine at a crosshead speed of 0.5 mm/minute. The failure load data were analyzed by one-way ANOVA and Games-Howell tests at significance level of 0.05.Results: The mean failure loads for zirconia, Ni-Cr and PEEK restorations were 2086±362N, 5591±1200N and 1430±262N, respectively. There were significant differences in the mean failure loads of the three groups (P<0.001. The fracture modes in zirconia, metal ceramic and PEEK restorations were cohesive, mixed and adhesive type, respectively.Conclusions: According to the findings of this study, all implant supported three-unit FPDs fabricated of zirconia, metal ceramic and PEEK materials are capable to withstand bite force (even para-functions in the molar region with excessive CHS.Keywords: Dental Implants; Polyetheretherketone; Zirconium oxide; Dental Restoration Failure; Dental Porcelain

Recent Results of Helical Nonneutral Plasmas on Compact Helical System (CHS)

International Nuclear Information System (INIS)

Himura, H.; Yamamoto, Y.; Sanpei, A.; Masamune, S.; Wakabayashi, H.; Isobe, M.

2006-01-01

First of all, non-constant space potential φs and electron density ne on magnetic surfaces of helical nonneutral plasmas are verified experimentally. The difference in φs enlarges significantly at the outer region inside the closed magnetic surfaces, and the corresponding equipotential surfaces are inferred to shift upward vertically with respect to magnetic surfaces. Meanwhile, larger value of ne is clearly observed in the downward region (z < 0) of magnetic surfaces, which seems to be consistent with the φs measurement. These results are the first evidence which strongly suggests the equilibrium proposed for nonneutral plasmas confined in closed magnetic surfaces. Secondly, in order to investigate the mechanism of the multiple disruption of helical nonneutral plasmas observed in experiments, space and time evolutions of electron flux are measured carefully inside the magnetic surfaces, when the plasma disruption occurs. Surprisingly, a set of data show that the observed disruption is at first happened at ρ ∼ 0.8, where ρ is the normalized minor radius, and then, it seems to propagate inside magnetic surfaces

The impact of social franchising on the use of reproductive health and family planning services at public commune health stations in Vietnam

Science.gov (United States)

2010-01-01

Background Service franchising is a business model that involves building a network of outlets (franchisees) that are locally owned, but act in coordinated manner with the guidance of a central headquarters (franchisor). The franchisor maintains quality standards, provides managerial training, conducts centralized purchasing and promotes a common brand. Research indicates that franchising private reproductive health and family planning (RHFP) services in developing countries improves quality and utilization. However, there is very little evidence that franchising improves RHFP services delivered through community-based public health clinics. This study evaluates behavioral outcomes associated with a new approach - the Government Social Franchise (GSF) model - developed to improve RHFP service quality and capacity in Vietnam's commune health stations (CHSs). Methods The project involved networking and branding 36 commune health station (CHS) clinics in two central provinces of Da Nang and Khanh Hoa, Vietnam. A quasi-experimental design with 36 control CHSs assessed GSF model effects on client use as measured by: 1) clinic-reported client volume; 2) the proportion of self-reported RHFP service users at participating CHS clinics over the total sample of respondents; and 3) self-reported RHFP service use frequency. Monthly clinic records were analyzed. In addition, household surveys of 1,181 CHS users and potential users were conducted prior to launch and then 6 and 12 months after implementing the GSF network. Regression analyses controlled for baseline differences between intervention and control groups. Results CHS franchise membership was significantly associated with a 40% plus increase in clinic-reported client volumes for both reproductive and general health services. A 45% increase in clinic-reported family planning service clients related to GSF membership was marginally significant (p = 0.05). Self-reported frequency of RHFP service use increased by 20% from

Combined effect of CO2 enrichment and foliar application of salicylic acid on the production and antioxidant activities of anthocyanin, flavonoids and isoflavonoids from ginger

Science.gov (United States)

2012-01-01

Background The increase in atmospheric CO2 concentration caused by climate change and agricultural practices is likely to affect biota by producing changes in plant growth, allocation and chemical composition. This study was conducted to evaluate the combined effect of the application of salicylic acid (SA, at two levels: 0 and 10-3 M) and CO2 enrichment (at two levels: 400 and 800 μmol·mol−1) on the production and antioxidant activities of anthocyanin, flavonoids and isoflavonoids from two Malaysian ginger varieties, namely Halia Bentong and Halia Bara. Methods High-performance liquid chromatography (HPLC) with photodiode array detection and mass spectrometry was employed to identify and quantify the flavonoids and anthocyanins in the ginger extracts. The antioxidant activity of the leaf extracts was determined by the 1,1-diphenyl-2-picrylhydrazyl (DPPH) and thiobarbituric acid (TBA) assays. The substrate specificity of chalcone synthase, the key enzyme for flavonoid biosynthesis, was investigated using the chalcone synthase (CHS) assay. Results CO2 levels of 800 μmol·mol−1 significantly increased anthocyanin, rutin, naringenin, myricetin, apigenin, fisetin and morin contents in ginger leaves. Meanwhile, the combined effect of SA and CO2 enrichment enhanced anthocyanin and flavonoid production compared with single treatment effects. High anthocyanin content was observed in H Bara leaves treated with elevated CO2 and SA. The highest chalcone synthase (CHS) activity was observed in plants treated with SA and CO2 enrichment. Plants not treated with SA and kept under ambient CO2 conditions showed the lowest CHS activity. The highest free radical scavenging activity corresponded to H Bara treated with SA under high CO2 conditions, while the lowest activity corresponded to H Bentong without SA treatment and under atmospheric CO2 levels. As the level of CO2 increased, the DPPH activity increased. Higher TBA activity was also recorded in the extracts of H Bara

Combined effect of CO2 enrichment and foliar application of salicylic acid on the production and antioxidant activities of anthocyanin, flavonoids and isoflavonoids from ginger

Directory of Open Access Journals (Sweden)

Ghasemzadeh Ali

2012-11-01

Full Text Available Abstract Background The increase in atmospheric CO2 concentration caused by climate change and agricultural practices is likely to affect biota by producing changes in plant growth, allocation and chemical composition. This study was conducted to evaluate the combined effect of the application of salicylic acid (SA, at two levels: 0 and 10-3 M and CO2 enrichment (at two levels: 400 and 800 μmol·mol−1 on the production and antioxidant activities of anthocyanin, flavonoids and isoflavonoids from two Malaysian ginger varieties, namely Halia Bentong and Halia Bara. Methods High-performance liquid chromatography (HPLC with photodiode array detection and mass spectrometry was employed to identify and quantify the flavonoids and anthocyanins in the ginger extracts. The antioxidant activity of the leaf extracts was determined by the 1,1-diphenyl-2-picrylhydrazyl (DPPH and thiobarbituric acid (TBA assays. The substrate specificity of chalcone synthase, the key enzyme for flavonoid biosynthesis, was investigated using the chalcone synthase (CHS assay. Results CO2 levels of 800 μmol·mol−1 significantly increased anthocyanin, rutin, naringenin, myricetin, apigenin, fisetin and morin contents in ginger leaves. Meanwhile, the combined effect of SA and CO2 enrichment enhanced anthocyanin and flavonoid production compared with single treatment effects. High anthocyanin content was observed in H Bara leaves treated with elevated CO2 and SA. The highest chalcone synthase (CHS activity was observed in plants treated with SA and CO2 enrichment. Plants not treated with SA and kept under ambient CO2 conditions showed the lowest CHS activity. The highest free radical scavenging activity corresponded to H Bara treated with SA under high CO2 conditions, while the lowest activity corresponded to H Bentong without SA treatment and under atmospheric CO2 levels. As the level of CO2 increased, the DPPH activity increased. Higher TBA activity was also recorded in the

Changes in Phytochemical Synthesis, Chalcone Synthase Activity and Pharmaceutical Qualities of Sabah Snake Grass (Clinacanthus nutans L. in Relation to Plant Age

Directory of Open Access Journals (Sweden)

Ali Ghasemzadeh

2014-10-01

Full Text Available In the current study, changes in secondary metabolite synthesis and the pharmaceutical quality of sabah snake grass leaves and buds were considered in relation to plant age (1 month, 6 months, and 1 year old. The activity of the enzyme chalcone synthase (CHS, EC 2.3.1.74 was measured, as it is a key enzyme for flavonoid production. Significant differences in total flavonoid (TF production were observed between the three plant growth periods and the different plant parts. The highest contents of TF (6.32 mg/g dry weight [DW] and total phenolic (TP (18.21 mg/g DW were recorded in 6-month-old buds. Among the flavonoids isolated in this study the most important ones based on concentration were from high to low as follows: catechin > quercetin > kaempferol > luteolin. Production of phenolic acids increased from 1 to 6 months, but after 6 months up to 1 year of age, they decreased significantly. The highest contents of caffeic acid (0.307 mg/g DW and gallic acid (5.96 mg/g DW were recorded in 1-year and 6-month-old buds, respectively. The lowest and highest activity of CHS was recorded in 1-month and 6-month-old buds with values of 3.6 and 9.5 nkat/mg protein, respectively. These results indicate that the increment in flavonoids and phenolic acids in 6-month-old buds can be attributed to an increase in CHS activity. The highest 1,1-diphenyl-2-picrylhydrazyl (DPPH activity was observed in the extract of 1-year-old buds followed by 6-month-old buds, with 50% of free radical scavenging (IC50 values of 64.6 and 73.5 µg/mL, respectively. Interestingly, a ferric reducing antioxidant power (FRAP assay showed a higher activity in 6-month-old buds (488 μM of Fe(II/g than in 1-year-old buds (453 μM of Fe(II/g, in contrast to the DPPH result. Significant correlations (p < 0.05 were observed between CHS enzyme activity and FRAP activity, TF, catechin, and kaempferol content. Extracts of 6-month-old bud exhibited a significant in vitro anticancer activity

The impact of social franchising on the use of reproductive health and family planning services at public commune health stations in Vietnam

Directory of Open Access Journals (Sweden)

Pham Van

2010-02-01

Full Text Available Abstract Background Service franchising is a business model that involves building a network of outlets (franchisees that are locally owned, but act in coordinated manner with the guidance of a central headquarters (franchisor. The franchisor maintains quality standards, provides managerial training, conducts centralized purchasing and promotes a common brand. Research indicates that franchising private reproductive health and family planning (RHFP services in developing countries improves quality and utilization. However, there is very little evidence that franchising improves RHFP services delivered through community-based public health clinics. This study evaluates behavioral outcomes associated with a new approach - the Government Social Franchise (GSF model - developed to improve RHFP service quality and capacity in Vietnam's commune health stations (CHSs. Methods The project involved networking and branding 36 commune health station (CHS clinics in two central provinces of Da Nang and Khanh Hoa, Vietnam. A quasi-experimental design with 36 control CHSs assessed GSF model effects on client use as measured by: 1 clinic-reported client volume; 2 the proportion of self-reported RHFP service users at participating CHS clinics over the total sample of respondents; and 3 self-reported RHFP service use frequency. Monthly clinic records were analyzed. In addition, household surveys of 1,181 CHS users and potential users were conducted prior to launch and then 6 and 12 months after implementing the GSF network. Regression analyses controlled for baseline differences between intervention and control groups. Results CHS franchise membership was significantly associated with a 40% plus increase in clinic-reported client volumes for both reproductive and general health services. A 45% increase in clinic-reported family planning service clients related to GSF membership was marginally significant (p = 0.05. Self-reported frequency of RHFP service use

Validation of a Portuguese Version of the Children's Hope Scale

Science.gov (United States)

Marques, Susana C.; Pais-Ribeiro, J. L.; Lopez, Shane J.

2009-01-01

The article describes the development of the Portuguese version of the Children's Hope Scale and the examination of its psychometric properties. A sample of 367 Portuguese students completed the Portuguese-language versions of the Children's Hope Scale (CHS; Snyder et al., 1997), Students' Life Satisfaction Scale (SLSS; Huebner, 1991), Global…

78 FR 25345 - Petition for Waiver of Compliance

Science.gov (United States)

2013-04-30

... 223.11 and 223.15 for one locomotive, two cars, and one equipment/generator car. Specifically, CHS..., and equipment/generator car, is in good condition and has no history of glazing-related accidents or... Docket Operations Facility, 1200 New Jersey Avenue SE., W12-140, Washington, DC 20590. The Docket...

Efecto de la Adición de Minerales en el Agua o Alimento sobre la Frecuencia Cardiaca, en Pollos de Engorde Sometidos a Estrés Calórico Crónico y Agudo

DEFF Research Database (Denmark)

Rojas, Jesus; Steffensen, Simon Gabriel Comerma; Chacon, Tony

2008-01-01

The effects of mineral addition in feed or water on performance parameters and heart rate (HR) were evaluated in broilers at 28-35 d and 36 d under both chronic heat stress (CHS) and acute heat stress (AHS) in laboratory conditions. Onehundred ninety two broilers were used, distributed in 6 cages...

Users' Satisfaction with Library Information Resources and Services: A Case Study College of Health Sciences Library Niger Delta University, Amassoma, Nigeria

Science.gov (United States)

Tiemo, Pereware Aghwotu; Ateboh, Benedict Alaowei

2016-01-01

This study investigated users' satisfaction with library information resources and services at the College of Health Sciences (CHS) library Niger Delta University, Nigeria. The objective was to determine the level of users satisfaction with library information resources and services. 2 (two) research questions were formulated to guide the study.…

Diversidad de arañas (Araneae, Araneomorphae en la selva de montaña: un caso de estudio en las Yungas Argentinas

Directory of Open Access Journals (Sweden)

Rubio, Gonzalo D.

2015-12-01

Full Text Available The spider diversity from yungas vegetation in northwestern Argentina is studied, integrating two levels: local (α diversity, community structures and a projection at regional level of diversity (β diversity. Twenty six sites in Salta Province were sampled, representing different ambient/altitudinal strata of yungas sensu stricto (SP= pedemontane rainforest, SM= montane rainforest and BM= montane forest, yungas sensu lato (Cc-s= yungas central and southern sectors connectivity areas, YT= transitional yungas, and Chaco Serrano sites (ChS as contrast. The sampling was carried out seasonally for one year taking 10 samples of vegetation with G-Vac method. A total of 6412 spiders, 188 species and 34 families were obtained (only yungas. Theridiidae, Anyphaenidae and Linyphiidae were dominant. The highest richness was observed in Araneidae, Salticidae and Theridiidae. >em>Chibchea salta (Pholcidae, Dubiaranea msp111 (Linyphiidae and Mysmena msp110 (Mysmenidae were dominant species. Relevant differences in species composition and abundance highlighted two groups of environment (Cc-s+SP+YT+ChS vs. (SM+BM. Dictynidae, Oxyopidae and Philodromidae are associated with lower altitudinal floors (Cc-s, YT, ChS. The greatest species richness and diversity were recorded in SP and YT. The highest similarity was recorded in SM and BM; the major differences were observed in Cc-s and ChS compared with the other ambient, except with SP. Complementarity and similarity indices and coefficients revealed high β diversity in the region. Thus, it is suggested that besides reinforcing protection in transitional levels Yungas (the most disturbed and diverse habitats for spiders, conservation management in the area should be directed towards promoting natural spatial heterogeneity of Yungas, giving special emphasis to habitat mosaics that constitute each different stratum.Se estudia la diversidad de arañas de vegetación de las yungas del noroeste argentino, integrando dos

Sequence analysis of a "true" chalcone synthase (chs_H1) oligofamily from hop (Humulus lupulus L.) and PAP1 activation of chs_H1 in heterologous systems

Czech Academy of Sciences Publication Activity Database

Matoušek, Jaroslav; Vrba, Lukáš; Škopek, Josef; Orctová, Lidmila; Pešina, Karel; Heyerick, A.; Baulcombe, D.; De Keukeleire, D.

2006-01-01

Roč. 54, - (2006), s. 7606-7615 ISSN 0021-8561 R&D Projects: GA ČR GA521/03/0072; GA ČR(CZ) GP521/06/P323 Institutional research plan: CEZ:AV0Z50510513 Keywords : cDNA library * Humulus lupulus L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.322, year: 2006

Efficient extraction of RNA from various Camellia species rich in ...

African Journals Online (AJOL)

use

2011-11-23

Nov 23, 2011 ... of Camellia sinensis, embodied by GenBank, showed that the homology was more than 90%. It preliminarily confirmed that the Chs gene was a functional gene, whose sequen-ces were conserved among Camellias. As another important gene, fatty acid desaturase 2. (Fad2) is involved in the conversion of ...

Introducing routine enquiry about domestic violence in a paediatric setting.

Science.gov (United States)

Asiegbunam, Nkiru

2018-02-01

Implementation of routine enquiry (RE) about domestic abuse in the multidisciplinary Evelina London Guys and St. Thomas Trust (GSTT) Community Health Services (CHS). © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

77 FR 1690 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

Science.gov (United States)

2012-01-11

... Chase & Co.; Wright Medical Group, Inc.; JP Morgan Chase & Co. 12/06/2011 20111253 G Hellman & Friedman Capital Partners VI, L.P.; SunGard Capital Corp.; Hellman & Friedman Capital Partners VI, L.P. 20120164 G... Investors L.P. 20120256 G CareGroup, Inc.; Milton Hospital Foundation, Inc.; CareGroup, Inc. 20120331 G CHS...

UV-B inhibition of hypocotyl growth in etiolated Arabidopsis thaliana seedlings is a consequence of cell cycle arrest initiated by photodimer accumulation

Science.gov (United States)

Biever, Jessica J.; Brinkman, Doug; Gardner, Gary

2014-01-01

Ultraviolet (UV) radiation is an important constituent of sunlight that determines plant morphology and growth. It induces photomorphogenic responses but also causes damage to DNA. Arabidopsis mutants of the endonucleases that function in nucleotide excision repair, xpf-3 and uvr1-1, showed hypersensitivity to UV-B (280–320nm) in terms of inhibition of hypocotyl growth. SOG1 is a transcription factor that functions in the DNA damage signalling response after γ-irradiation. xpf mutants that carry the sog1-1 mutation showed hypocotyl growth inhibition after UV-B irradiation similar to the wild type. A DNA replication inhibitor, hydroxyurea (HU), also inhibited hypocotyl growth in etiolated seedlings, but xpf-3 was not hypersensitive to HU. UV-B irradiation induced accumulation of the G2/M-specific cell cycle reporter construct CYCB1;1-GUS in wild-type Arabidopsis seedlings that was consistent with the expected accumulation of photodimers and coincided with the time course of hypocotyl growth inhibition after UV-B treatment. Etiolated mutants of UVR8, a recently described UV-B photoreceptor gene, irradiated with UV-B showed inhibition of hypocotyl growth that was not different from that of the wild type, but they lacked UV-B-specific expression of chalcone synthase (CHS), as expected from previous reports. CHS expression after UV-B irradiation was not different in xpf-3 compared with the wild type, nor was it altered after HU treatment. These results suggest that hypocotyl growth inhibition by UV-B light in etiolated Arabidopsis seedlings, a photomorphogenic response, is dictated by signals originating from UV-B absorption by DNA that lead to cell cycle arrest. This process occurs distinct from UVR8 and its signalling pathway responsible for CHS induction. PMID:24591052

Identification of Methylosome Components as Negative Regulators of Plant Immunity Using Chemical Genetics.

Science.gov (United States)

Huang, Shuai; Balgi, Aruna; Pan, Yaping; Li, Meng; Zhang, Xiaoran; Du, Lilin; Zhou, Ming; Roberge, Michel; Li, Xin

2016-12-05

Nucleotide-binding leucine-rich repeat (NLR) proteins serve as immune receptors in both plants and animals. To identify components required for NLR-mediated immunity, we designed and carried out a chemical genetics screen to search for small molecules that can alter immune responses in Arabidopsis thaliana. From 13 600 compounds, we identified Ro 8-4304 that was able to specifically suppress the severe autoimmune phenotypes of chs3-2D (chilling sensitive 3, 2D), including the arrested growth morphology and heightened PR (Pathogenesis Related) gene expression. Further, six Ro 8-4304 insensitive mutants were uncovered from the Ro 8-4304-insensitive mutant (rim) screen using a mutagenized chs3-2D population. Positional cloning revealed that rim1 encodes an allele of AtICln (I, currents; Cl, chloride; n, nucleotide). Genetic and biochemical analysis demonstrated that AtICln is in the same protein complex with the methylosome components small nuclear ribonucleoprotein D3b (SmD3b) and protein arginine methyltransferase 5 (PRMT5), which are required for the biogenesis of small nuclear ribonucleoproteins (snRNPs) involved in mRNA splicing. Double mutant analysis revealed that SmD3b is also involved in the sensitivity to Ro 8-4304, and the prmt5-1 chs3-2D double mutant is lethal. Loss of AtICln, SmD3b, or PRMT5 function results in enhanced disease resistance against the virulent oomycete pathogen Hyaloperonospora arabidopsidis Noco2, suggesting that mRNA splicing plays a previously unknown negative role in plant immunity. The successful implementation of a high-throughput chemical genetic screen and the identification of a small-molecule compound affecting plant immunity indicate that chemical genetics is a powerful tool to study whole-organism plant defense pathways. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

Feeding a diet devoid of choline to lactating rodents restricts growth and lymphocyte development in offspring.

Science.gov (United States)

Lewis, E D; Goruk, S; Richard, C; Dellschaft, N S; Curtis, J M; Jacobs, R L; Field, C J

2016-09-01

The nutrient choline is necessary for membrane synthesis and methyl donation, with increased requirements during lactation. The majority of immune development occurs postnatally, but the importance of choline supply for immune development during this critical period is unknown. The objective of this study was to determine the importance of maternal supply of choline during suckling on immune function in their offspring among rodents. At parturition, Sprague-Dawley dams were randomised to either a choline-devoid (ChD; n 7) or choline-sufficient (ChS, 1 g/kg choline; n 10) diet with their offspring euthanised at 3 weeks of age. In a second experiment, offspring were weaned to a ChS diet until 10 weeks of age (ChD-ChS, n 5 and ChS-ChS, n 9). Splenocytes were isolated, and parameters of immune function were measured. The ChD offspring received less choline in breast milk and had lower final body and organ weight compared with ChS offspring (P<0·05), but this effect disappeared by week 10 with choline supplementation from weaning. ChD offspring had a higher proportion of T cells expressing activation markers (CD71 or CD28) and a lower proportion of total B cells (CD45RA+) and responded less to T cell stimulation (lower stimulation index and less IFN-γ production) ex vivo (P<0·05). ChD-ChS offspring had a lower proportion of total and activated CD4+ T cells, and produced less IL-6 after mitogen stimulation compared with cells from ChS-ChS (P<0·05). Our study suggests that choline is required in the suckling diet to facilitate immune development, and choline deprivation during this critical period has lasting effects on T cell function later in life.

Dutch National Plan combat nuclear accidents

International Nuclear Information System (INIS)

1988-01-01

This document presents the Dutch National Plan combat nuclear accidents (NPK). Ch. 2 discusses some important starting points which are determining for the framework and the performance of the NPK, in particular the accident typology which underlies the plan. Also the new accident-classification system for the Dutch nuclear power plants, the standardization for the measures to be taken and the staging around nuclear power plants are pursued. In ch. 3 the legal framework of the combat nuclear accidents is described. In particular the Nuclear-power law, the Accident law and the Municipality law are pursued. Also the role of province and municipality are described. Ch. 4 deals with the role of the owner/licensee of the object where the accident occurs, in the combat of accident. In ch. 5 the structure of the nuclear-accident combat at national level is outlined, subdivided in alarm phase, combat phase and the winding-up phase. In ch.'s 6-12 these phases are elaborated more in detail. In ch.'s 10-13 the measures to be taken in nuclear accidents, are described. These measures are distinguished with regard to: protection of the population and medical aspects, water economy, drinking-water supply, agriculture and food supply. Ch. 14 describes the responsibility of the burgomaster. Ch.'s 15 and 16 present an overview of the personnel, material, procedural and juridical modifications and supplements of existing structures which are necessary with regard to the new and modified parts of the structure. Ch. 17 indicates how by means of the appropriate education and exercise it can be achieved that all personnel, services and institutes concerned possess the knowledge and experience necessary for the activities from the NKP to be executed as has been described. Ch. 18 contains a survey of activities to be performed and a proposal how these can be realized. (H.W.). figs.; tabs

Omega-3 Fatty Acids and Incident Ischemic Stroke and Its Atherothrombotic and Cardioembolic Subtypes in 3 US Cohorts.

Science.gov (United States)

Saber, Hamidreza; Yakoob, Mohammad Yawar; Shi, Peilin; Longstreth, W T; Lemaitre, Rozenn N; Siscovick, David; Rexrode, Kathryn M; Willett, Walter C; Mozaffarian, Dariush

2017-10-01

The associations of individual long-chain n-3 polyunsaturated fatty acids with incident ischemic stroke and its main subtypes are not well established. We aimed to investigate prospectively the relationship of circulating eicosapentaenoic acid, docosapentaenoic acid (DPA), and docosahexaenoic acid (DHA) with risk of total ischemic, atherothrombotic, and cardioembolic stroke. We measured circulating phospholipid fatty acids at baseline in 3 separate US cohorts: CHS (Cardiovascular Health Study), NHS (Nurses' Health Study), and HPFS (Health Professionals Follow-Up Study). Ischemic strokes were prospectively adjudicated and classified into atherothrombotic (large- and small-vessel infarctions) or cardioembolic by imaging studies and medical records. Risk according to fatty acid levels was assessed using Cox proportional hazards (CHS) or conditional logistic regression (NHS, HPFS) according to study design. Cohort findings were pooled using fixed-effects meta-analysis. A total of 953 incident ischemic strokes were identified (408 atherothrombotic, 256 cardioembolic, and 289 undetermined subtypes) during median follow-up of 11.2 years (CHS) and 8.3 years (pooled, NHS and HPFS). After multivariable adjustment, lower risk of total ischemic stroke was seen with higher DPA (highest versus lowest quartiles; pooled hazard ratio [HR], 0.74; 95% confidence interval [CI], 0.58-0.92) and DHA (HR, 0.80; 95% CI, 0.64-1.00) but not eicosapentaenoic acid (HR, 0.94; 95% CI, 0.77-1.19). DHA was associated with lower risk of atherothrombotic stroke (HR, 0.53; 95% CI, 0.34-0.83) and DPA with lower risk of cardioembolic stroke (HR, 0.58; 95% CI, 0.37-0.92). Findings in each individual cohort were consistent with pooled results. In 3 large US cohorts, higher circulating levels of DHA were inversely associated with incident atherothrombotic stroke and DPA with cardioembolic stroke. These novel findings suggest differential pathways of benefit for DHA, DPA, and eicosapentaenoic acid. © 2017

Improvement of the design and generation of highly specific plant knockdown lines using primary synthetic microRNAs (pri-smiRNAs

Directory of Open Access Journals (Sweden)

Alves Leonardo

2010-03-01

Full Text Available Abstract Background microRNAs (miRNAs are endogenous small non-coding RNAs that post-transcriptionally regulate gene expression. In plants, they typically show high complementarity to a single sequence motif within their target mRNAs and act by catalyzing specific mRNA cleavage and degradation. miRNAs are processed from much longer primary transcripts via precursor miRNAs containing fold-back structures. Leaving these secondary structures intact, miRNAs can be re-designed experimentally to target mRNAs of choice. Results We designed primary synthetic miRNAs (pri-smiRNAs on the basis of the primary transcript of the Arabidopsis MIR159A gene by replacing the original miR159a and the corresponding miR159a* with novel sequences, keeping the overall secondary structure as predicted by the program RNAfold. We used the program RNAhybrid to optimize smiRNA design and to screen the complete Arabidopsis transcriptome for potential off-targets. To improve the molecular cloning of the pri-smiRNA we inserted restriction sites in the original MIR159A primary transcript to easily accommodate the smiRNA/smiRNA* DNA fragment. As a proof-of-concept, we targeted the single gene encoding chalcone synthase (CHS in Arabidopsis. We demonstrate smiRNA(CHS expression and CHS mRNA cleavage in different transgenic lines. Phenotypic changes in these lines were observed for seed color and flavonol derivatives, and quantified with respect to anthocyanin content. We also tested the effect of mismatches and excess G:U base pairs on knockdown efficiency. Conclusions RNAhybrid-assisted design of smiRNAs and generation of pri-smiRNAs using a novel vector containing restriction sites greatly improves specificity and speed of the generation of stable knockdown lines for functional analyses in plants.

Cloning and expression analysis of chalcone synthase gene from ...

Indian Academy of Sciences (India)

Expression analysis of CfCHS in different tissues and elicitor treatments showed that methyl jasmonate ... Journal of Genetics, DOI 10.1007/s12041-016-0680-8, Vol. 95, No. ... leaf of C. forskohlii. Quantitative real time RT-PCR was used ..... SGG acknowledges the financial support for this work from CSIR. 12th FYP project ...

Productivity and biochemical properties of green tea in response to ...

Indian Academy of Sciences (India)

The expression of three homologues of the expansin genes, which regulate plant cell growth, and the CsCHS gene encoding a tea chalcone synthase, which critically regulates the biosynthesis of catechols, were induced in germinal leaves of tea plants following treatment with HpaG1–94 or HpaGXooc. Higher levels of ...

Nonlinear parametric phenomena in plasma during radio frequency heating in the ion cyclotron frequency range

International Nuclear Information System (INIS)

Stepanov, K.N.

1996-01-01

Parametric phenomena in plasma which occur due to varying electric fields with the ion cyclotron frequency are reviewed. Beam-like lower hybrid instability emerges in strong pumping fields provided that the transverse relative velocity of particles is larger than the ion thermal speed (υ Ti ). The resulting turbulence and the following numerous manifestations observed experimentally are addressed. The turbulence may prove important for experiments aimed at plasma production or radio frequency (RF) cleaning of metallic surfaces of vacuum chambers in stellarators, tokamaks and helicon devices. In contrast, for a weak field (U Ti ) the kinetic parametric instabilities of ion cyclotron oscillations arise due to electrons. The issues of the turbulence, mathematical modelling, its role in turbulent heating observed on the torsatron Uragan-3M, decay instabilities associated with ion cyclotron oscillations and the triggering of ion quasimodes are considered. (author)

Magnetic field structure near the plasma boundary in helical systems and divertor tokamaks

International Nuclear Information System (INIS)

Nagasaki, Kazunobu; Itoh, Kimitaka

1990-02-01

Magnetic field structure of the scrape off layer (SOL) region in both helical systems and divertor tokamaks is studied numerically by using model fields. The connection length of the field line to the wall is calculated. In helical systems, the connection length, L, has a logarithmic dependence on the distance from the outermost magnetic surface or that from the residual magnetic islands. The effect of axisymmetric fields on the field structure is also determined. In divertor tokamaks, the connection length also has logarithmic properties near the separatrix. Even when the perturbations, which resonate to rational surfaces near the plasma boundary, are added, logarithmic properties still remain. We compare the connection length of torsatron/helical-heliotron systems with that of divertor tokamaks. It is found that the former is shorter than the latter by one order magnitude with similar aspect ratio. (author)

Structural design and analysis for the ISX-C/ATF tokamak of the vacuum vessel, coil joints, and supports

International Nuclear Information System (INIS)

Mayhall, J.A.; Cain, W.D.; Hammonds, C.J.; Johnson, R.L.; Gray, W.H.

1981-01-01

The ISX-C/ATF is being designed as a test bed for advanced toroidal concepts. Because of numerous design concepts being evaluated, a flexible, easily changeable structural-design math-model was needed to afford quick evalution of the structural feasibility of the many proposed concepts. To satisfy this need, the NASTRAN Automated Multi-Stage Substructures technique was used to build a quick-changeable math model. This technique was especially needed because all the coils, first wall and diagnostic devices are to be supported by the vacuum vessel, requiring the entire structure to be analyzed as a system. Without the use of the substructuring technique, the required man hours and computer core would have made timely design analysis impossible. To illustrate the technique, the detailed design analysis of the concept Torsatron (with helical coils and T.F. coils) is presented

Seismic Risk of the Base Isolation System Protected by the Hard Stop

International Nuclear Information System (INIS)

Kim, Jung Han; Choi, In-Kil; Kim, Min Kyu

2015-01-01

The concept of base isolation is to permit the deformation of isolator for absorbing seismic input wave from the ground. In a nuclear power plant design, allowable shear deformation of isolators should be enough to absorb the displacement response by extended design basis (EDB) ground motions. However isolators cannot resist over its displacement capacity. So, the clearance of hard stop (CHS) needs to be set between the response of base isolation system excited by the EDB ground motion and the displacement capacity of isolators. The isolation system must survive with high confidence in any seismic accident because it is a non-redundant system. Therefore, the CHS should be determined carefully based on the failure risk of base isolation system considering the uncertainties of earthquake responses and isolator capacities. In this research, the fragility curve of isolation system and its failure risk were estimated. The procedure to calculate the acceleration based fragility curve of the isolation system was developed. The fragility curve and failure risk for example case was estimated and its result was compared with different isolator capacities

Histopathological findings in a surgically resected thalamic cavernous hemangioma 1 year after 40-Gy irradiation.

Science.gov (United States)

Nyáry, István; Major, Otto; Hanzély, Zoltán; Szeifert, György T

2005-01-01

Stereotactic radiosurgery is a controversial treatment modality in the management of cerebral cavernous hemangiomas (CHs), and results vary from center to center. Even the interpretation of treatment failure is controversial. It is suggested that the systematic pathological investigation of irradiated specimens could help to resolve the controversy. A hemorrhagic lesion in the posterior part of the thalamus had been diagnosed as a tumor and was treated with 40-Gy fractionated radiotherapy. One year after this treatment the case was reconsidered based on new imaging evidence, and the lesion was removed by conventional craniotomy. Histopathological examination revealed a CH with postirradiation changes. Compared with nonirradiated control CH tissue samples, there was endothelial cell destruction and marked fibrosis with scar tissue formation in the stroma of the treated lesion. The histopathological findings in this specimen were similar to those described in arteriovenous malformations after gamma knife surgery. The results of light microscopic investigations suggest that the ionizing effect of radiation energy evokes vascular and connective tissue stroma changes in CHs as well.

Seismic Risk of the Base Isolation System Protected by the Hard Stop

Energy Technology Data Exchange (ETDEWEB)

Kim, Jung Han; Choi, In-Kil; Kim, Min Kyu [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2015-10-15

The concept of base isolation is to permit the deformation of isolator for absorbing seismic input wave from the ground. In a nuclear power plant design, allowable shear deformation of isolators should be enough to absorb the displacement response by extended design basis (EDB) ground motions. However isolators cannot resist over its displacement capacity. So, the clearance of hard stop (CHS) needs to be set between the response of base isolation system excited by the EDB ground motion and the displacement capacity of isolators. The isolation system must survive with high confidence in any seismic accident because it is a non-redundant system. Therefore, the CHS should be determined carefully based on the failure risk of base isolation system considering the uncertainties of earthquake responses and isolator capacities. In this research, the fragility curve of isolation system and its failure risk were estimated. The procedure to calculate the acceleration based fragility curve of the isolation system was developed. The fragility curve and failure risk for example case was estimated and its result was compared with different isolator capacities.

Histopathological findings in a surgically resected thalamic cavernous hemangioma 1 year after 40-Gy irradiation.

Science.gov (United States)

Nyáry, István; Major, Otto; Hanzély, Zoltán; Szeifert, György T

2005-01-01

✓ Stereotactic radiosurgery is a controversial treatment modality in the management of cerebral cavernous hemangiomas (CHs), and results vary from center to center. Even the interpretation of treatment failure is controversial. It is suggested that the systematic pathological investigation of irradiated specimens could help to resolve the controversy. A hemorrhagic lesion in the posterior part of the thalamus had been diagnosed as a tumor and was treated with 40-Gy fractionated radiotherapy. One year after this treatment the case was reconsidered based on new imaging evidence, and the lesion was removed by conventional craniotomy. Histopathological examination revealed a CH with postirradiation changes. Compared with nonirradiated control CH tissue samples, there was endothelial cell destruction and marked fibrosis with scar tissue formation in the stroma of the treated lesion. The histopathological findings in this specimen were similar to those described in arteriovenous malformations after gamma knife surgery. The results of light microscopic investigations suggest that the ionizing effect of radiation energy evokes vascular and connective tissue stroma changes in CHs as well.

Metal ion displacements in noncentrosymmetric chalcogenides La{sub 3}Ga{sub 1.67}S{sub 7}, La{sub 3}Ag{sub 0.6}GaCh{sub 7} (Ch=S, Se), and La{sub 3}MGaSe{sub 7} (M=Zn, Cd)

Energy Technology Data Exchange (ETDEWEB)

Iyer, Abishek K. [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Yin, Wenlong [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Institute of Chemical Materials, China Academy of Engineering Physics, Mianyang 621900 (China); Rudyk, Brent W. [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Lin, Xinsong [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Centre for Oil Sands Sustainability, Northern Alberta Institute of Technology, Edmonton, Alberta, Canada T6N1E5 (Canada); Nilges, Tom [Department of Chemistry, Technical University of Munich, 85748 Garching b. München (Germany); Mar, Arthur, E-mail: arthur.mar@ualberta.ca [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada)

2016-11-15

The quaternary Ga-containing chalcogenides La{sub 3}Ag{sub 0.6}GaS{sub 7}, La{sub 3}Ag{sub 0.6}GaSe{sub 7}, La{sub 3}ZnGaSe{sub 7}, and La{sub 3}CdGaSe{sub 7}, as well as the related ternary chalcogenide La{sub 3}Ga{sub 1.67}S{sub 7}, were prepared by reactions of the elements at 950 °C. They adopt noncentrosymmetric hexagonal structures (space group P6{sub 3}, Z=2) with cell parameters (a=10.2 Å, c=6.1 Å for the sulfides; a=10.6 Å, c=6.4 Å for the selenides) that are largely controlled by the geometrical requirements of one-dimensional stacks of Ga-centered tetrahedra separated by the La atoms. Among these compounds, which share the common formulation La{sub 3}M{sub 1–x}GaCh{sub 7} (M=Ga, Ag, Zn, Cd; Ch=S, Se), the M atoms occupy sites within a stacking of trigonal antiprisms formed by Ch atoms. The location of the M site varies between extremes with trigonal antiprismatic (CN6) and trigonal planar (CN3) geometry. Partial occupation of these sites and intermediate ones accounts for the considerable versatility of these structures and the occurrence of large metal displacement parameters. The site occupations can be understood in a simple way as being driven by the need to satisfy appropriate bond valence sums for both the M and Ch atoms. Band structure calculations rationalize the substoichiometry observed in the Ag-containing compounds (La{sub 3}Ag{sub 0.6}GaS{sub 7}, La{sub 3}Ag{sub 0.6}GaSe{sub 7}) as a response to overbonding. X-ray photoelectron spectroscopy supports the presence of monovalent Ag atoms in these compounds, which are not charge-balanced. - Graphical abstract: Partial occupation of metal atoms in multiple sites accounts for versatility in Ga-containing chalcogenides La{sub 3}M{sub 1–x}GaCh{sub 7} with noncentrosymmetric hexagonal structures. - Highlights: • La{sub 3}M{sub 1–x}GaCh{sub 7} (M =Ga, Ag, Zn, Cd; Ch =S, Se) adopt related hexagonal structures. • Large displacements of M atoms originate from partial occupation of multiple

The unbiasedness of a generalized mirage boundary correction method for Monte Carlo integration estimators of volume

Science.gov (United States)

Thomas B. Lynch; Jeffrey H. Gove

2014-01-01

The typical "double counting" application of the mirage method of boundary correction cannot be applied to sampling systems such as critical height sampling (CHS) that are based on a Monte Carlo sample of a tree (or debris) attribute because the critical height (or other random attribute) sampled from a mirage point is generally not equal to the critical...

More practical critical height sampling.

Science.gov (United States)

Thomas B. Lynch; Jeffrey H. Gove

2015-01-01

Critical Height Sampling (CHS) (Kitamura 1964) can be used to predict cubic volumes per acre without using volume tables or equations. The critical height is defined as the height at which the tree stem appears to be in borderline condition using the point-sampling angle gauge (e.g. prism). An estimate of cubic volume per acre can be obtained from multiplication of the...

Fundamental modes of new dispersive SH-waves in ...

Indian Academy of Sciences (India)

[3] M Fiebig, V V Pavlov and R V Pisarev, J. Opt. Soc. Am. B 22(1), 96 (2005). [4] T Kimura, Ann. Rev. Condens. Matter Phys. 3(1), 93 (2012). [5] Ch-S Park and Sh Priya, Advances in condensed matter physics (Hindawi Publishing. Corporation, 2012) Vol. 2012, 12 pages. [6] R C Pullar, Prog. Mater. Sci. 57(7), 1191 (2012).

Stochastic layers of magnetic field lines and formation of ITB in a toroidal plasma

International Nuclear Information System (INIS)

Volkov, E.D.; Bererzhnyi, V.L.; Bondarenko, V.N.

2003-01-01

The results of local measurements of RF discharge plasma parameters in the process of ITB formation in the vicinity of rational magnetic surfaces in the Uragan-3M torsatron are presented. The next phenomena were observed in the process of ITB formation: the widening of the radial density distribution, the formation of pedestals on radial density and electron temperature distributions, the formation of regions with high shear of poloidal plasma rotation velocity and radial electric field in the vicinity of stochastic layers of magnetic field lines, the decrease of density fluctuations and their radial correlation length, the decorrelation of density fluctuations, the increase of the bootstrap current. After the ITB formation, the transition to the improved plasma confinement regime takes place. The transition moves to the beginning of the discharge with the increase of heating power. The possible mechanism of ITB formation near rational surfaces is discussed. (orig.)

Energy and round time estimation method for mobile wireless sensor networks

International Nuclear Information System (INIS)

Ismat, M.; Qureshi, R.; Imam, M.U.

2018-01-01

Clustered WSN (Wireless Sensor Networks) is a hierarchical network structure that conserves energy by distributing the task of sensing and data transfer to destination among the non-CH (Cluster-Head) and CH (Cluster Head) node in a cluster. In clustered MWSN (Mobile Wireless Sensor Network), cluster maintenance to increase at a reception at the destination during communication operation is difficult due to the movement of CHs and non-CH nodes in and out of the cluster. To conserve energy and increased data transfer to the destination, it is necessary to find the duration after which sensor node’s role should be changed from CH to non-CH and vice-versa. In this paper, we have proposed an energy independent round time scheme to identify the duration after which re-clustering procedure should be invoked for changing roles of sensor nodes as CHs and associated nodes to conserve energy and increased data delivery. This depends on the dissemination interval of the sensor nodes rather than sensor node’s energy. We have also provided a complete analytical estimate of network energy consumption with energy consumed in every phase of a around. (author)

Health and Environmental Risk Assessment Project for bottlenose dolphins Tursiops truncatus from the southeastern USA. I. Infectious diseases.

Science.gov (United States)

Bossart, Gregory D; Fair, Patricia; Schaefer, Adam M; Reif, John S

2017-07-24

From 2003 to 2015, 360 free-ranging Atlantic bottlenose dolphins Tursiops truncatus inhabiting the Indian River Lagoon (IRL, n = 246), Florida, and coastal waters of Charleston (CHS, n = 114), South Carolina, USA, were captured, given comprehensive health examinations, and released as part of a multidisciplinary and multi-institutional study of individual and population health. The aim of this review is to summarize the substantial health data generated by this study and to examine morbidity between capture sites and over time. The IRL and CHS dolphin populations are affected by complex infectious and neoplastic diseases often associated with immunologic disturbances. We found evidence of infection with cetacean morbillivirus, dolphin papilloma and herpes viruses, Chlamydiaceae, a novel uncultivated strain of Paracoccidioides brasiliensis (recently identified as the causal agent of dolphin lobomycosis/lacaziasis), and other pathogens. This is the first long-term study documenting the various types, progression, seroprevalence, and pathologic interrelationships of infectious diseases in dolphins from the southeastern USA. Additionally, the study has demonstrated that the bottlenose dolphin is a valuable sentinel animal that may reflect environmental health concerns and parallel emerging public health issues.

Over-expression of Gene FaASR Promotes Strawberry Fruit Coloring

Directory of Open Access Journals (Sweden)

Liu Zhongjie

2015-11-01

Full Text Available Fruit development and ripening is a complicate process. Although much progress has been made on the ripenig process, the molecular mechamism of fruit development is not yet clear. In this study, we used ‘Sweet Charlie’ strawberry as test materials, based on cloning the strawberries ASR homologous gene, we carried out the bioinformatics and temporal expression analysis of FaASR, by manipulating ASR gene expression level in strawberry fruit, we tested the changes of physiological indicators, including sugar, ABA, pigments content, and fruit firmness, as well as phenotypic changes. In addition, we measured the expression changes of some anthocyanin-related gene, such as CHS and UFGT, by which we revealed the regulation mechanisms of ASR gene over strawberry fruit ripening. Strawberry ASR contained a typical domain of ABA/WDS that was related to fruit ripening and stress-resistance, and ASR gene over-expression could promote strawberry fruit coloring, endogenous ABA and sucrose accumulation, fruit softening, and induced the transcription levels of anthocyanin-related genes CHS and UFGT. The present study will further reveal the molecular mechanisms of information transmission in fruit development, and will also play an important foundation for future molecular improvement of strawberries breeding.

Treatment of silymarin, a plant flavonoid, prevents ultraviolet light-induced immune suppression and oxidative stress in mouse skin.

Science.gov (United States)

Katiyar, Santosh K

2002-12-01

It is well documented that ultraviolet (UV) light-induced immune suppression and oxidative stress play an important role in the induction of skin cancers. Earlier, we have shown that topical treatment of silymarin, a plant flavonoid from milk thistle (Silybum marianum L. Gaertn.), to mouse skin prevents photocarcinogenesis, but the preventive mechanism of photocarcinogenesis in vivo animal system by silymarin is not well defined and understood. To define the mechanism of prevention, we employed immunostaining, analytical assays and ELISA which revealed that topical treatment of silymarin (1 mg/cm2 skin area) to C3H/HeN mice inhibits UVB (90 mJ/cm2)-induced suppression of contact hypersensitivity (CHS) response to contact sensitizer dinitrofluorobenzene. Prevention of UVB-induced suppression of CHS by silymarin was found to be associated with the inhibition of infiltrating leukocytes, particularly CD11b+ cell type, and myeloperoxidase activity (50-71%). Silymarin treatment also resulted in significant reduction of UVB-induced immunosuppressive cytokine interleukin-10 producing cells and its production (58-72%, pskin cancer risk human population and ii) development of sunscreen containing silymarin as an antioxidant (chemopreventive agent) or silymarin can be supplemented in skin care products.

Automated coronal hole identification via multi-thermal intensity segmentation

Science.gov (United States)

Garton, Tadhg M.; Gallagher, Peter T.; Murray, Sophie A.

2018-01-01

Coronal holes (CH) are regions of open magnetic fields that appear as dark areas in the solar corona due to their low density and temperature compared to the surrounding quiet corona. To date, accurate identification and segmentation of CHs has been a difficult task due to their comparable intensity to local quiet Sun regions. Current segmentation methods typically rely on the use of single Extreme Ultra-Violet passband and magnetogram images to extract CH information. Here, the coronal hole identification via multi-thermal emission recognition algorithm (CHIMERA) is described, which analyses multi-thermal images from the atmospheric image assembly (AIA) onboard the solar dynamics observatory (SDO) to segment coronal hole boundaries by their intensity ratio across three passbands (171 Å, 193 Å, and 211 Å). The algorithm allows accurate extraction of CH boundaries and many of their properties, such as area, position, latitudinal and longitudinal width, and magnetic polarity of segmented CHs. From these properties, a clear linear relationship was identified between the duration of geomagnetic storms and coronal hole areas. CHIMERA can therefore form the basis of more accurate forecasting of the start and duration of geomagnetic storms.

Fluorescence-based optimization of human bitter taste receptor expression in Saccharomyces cerevisiae

International Nuclear Information System (INIS)

Sugawara, Taishi; Ito, Keisuke; Shiroishi, Mitsunori; Tokuda, Natsuko; Asada, Hidetsugu; Yurugi-Kobayashi, Takami; Shimamura, Tatsuro; Misaka, Takumi; Nomura, Norimichi; Murata, Takeshi; Abe, Keiko; Iwata, So

2009-01-01

Human TAS2 receptors (hTAS2Rs) perceive bitter tastants, but few studies have explored the structure-function relationships of these receptors. In this paper, we report our trials on the large-scale preparations of hTAS2Rs for structural analysis. Twenty-five hTAS2Rs were expressed using a GFP-fusion yeast system in which the constructs and the culture conditions (e.g., the signal sequence, incubation time and temperature after induction) were optimized by measuring GFP fluorescence. After optimization, five hTAS2Rs (hTAS2R7, hTAS2R8, hTAS2R16, hTAS2R41, and hTAS2R48) were expressed at levels greater than 1 mg protein/L of culture, which is a preferable level for purification and crystallization. Among these five bitter taste receptors, hTAS2R41 exhibited the highest detergent solubilization efficiency of 87.1% in n-dodecyl-β-D-maltopyranoside (DDM)/cholesteryl hemisuccinate (CHS). Fluorescence size-exclusion chromatography showed that hTAS2R41 exhibited monodispersity in DDM/CHS without aggregates, suggesting that hTAS2R41 is a good target for future crystallization trials.

Determining equilibrium osmolarity in poly(ethylene glycol)/chondrotin sulfate gels mimicking articular cartilage.

Science.gov (United States)

Sircar, S; Aisenbrey, E; Bryant, S J; Bortz, D M

2015-01-07

We present an experimentally guided, multi-phase, multi-species polyelectrolyte gel model to make qualitative predictions on the equilibrium electro-chemical properties of articular cartilage. The mixture theory consists of two different types of polymers: poly(ethylene gylcol) (PEG), chondrotin sulfate (ChS), water (acting as solvent) and several different ions: H(+), Na(+), Cl(-). The polymer chains have covalent cross-links whose effect on the swelling kinetics is modeled via Doi rubber elasticity theory. Numerical studies on equilibrium polymer volume fraction and net osmolarity (difference in the solute concentration across the gel) show a complex interplay between ionic bath concentrations, pH, cross-link fraction and the average charge per monomer. Generally speaking, swelling is aided due to a higher average charge per monomer (or a higher particle fraction of ChS, the charged component of the polymer), low solute concentration in the bath, a high pH or a low cross-link fraction. A peculiar case arises at higher values of cross-link fraction, where it is observed that increasing the average charge per monomer leads to gel deswelling. Copyright © 2014 Elsevier Ltd. All rights reserved.

Suppression of the cutaneous immune response following topical application of the prostaglandin PGE2

International Nuclear Information System (INIS)

Rheins, L.A.; Barnes, L.; Amornsiripanitch, S.; Collins, C.E.; Nordlund, J.J.

1987-01-01

UVB irradiation (290-320 nm) and topical applications of arachidonic acid (AA) in mice decrease the number of identifiable Langerhans cells and alter the cutaneous immune response. Application of contact allergens such as dinitrofluorobenzene (DNFB) to irradiated or AA-treated skin induces antigen-specific tolerance. Indomethacin (IM), a cyclooxygenase inhibitor, administered orally to mice prior to UVB irradiation or prior to the topical application of arachidonic acid, abrogates suppression of contact hypersensitivity (CHS) to DNFB. This suggests a byproduct of arachidonic acid generated through the cyclooxygenase pathway may be involved in the immune suppression. Topical application of various prostaglandins (PGE2, PGD2, PGF2 alpha, and CTXA2) did not cause alterations in the population density of the identifiable Ia+ dendritic Langerhans cells. PGE2, but no other tested agent, produced a suppression of the CHS response to DNFB. These observations suggests that of the various prostaglandins, PGE2 might be one of several biochemical signals which mediate the suppression of contact hypersensitivity reactions following ultraviolet radiation exposure. However, the mechanisms by which PGE2 produces its suppressive effects have not been identified

Regulation of Flavonoid Biosynthetic Genes in Germinating Arabidopsis Seedlings.

Science.gov (United States)

Kubasek, WL; Shirley, BW; McKillop, A; Goodman, HM; Briggs, W; Ausubel, FM

1992-01-01

Many higher plants, including Arabidopsis, transiently display purple anthocyanin pigments just after seed germination. We observed that steady state levels of mRNAs encoded by four flavonoid biosynthetic genes, PAL1 (encoding phenylalanine ammonia-lyase 1), CHS (encoding chalcone synthase), CHI (encoding chalcone isomerase), and DFR (encoding dihydroflavonol reductase), were temporally regulated, peaking in 3-day-old seedlings grown in continuous white light. Except for the case of PAL1 mRNA, mRNA levels for these flavonoid genes were very low in seedlings grown in darkness. Light induction studies using seedlings grown in darkness showed that PAL1 mRNA began to accumulate before CHS and CHI mRNAs, which, in turn, began to accumulate before DFR mRNA. This order of induction is the same as the order of the biosynthetic steps in flavonoid biosynthesis. Our results suggest that the flavonoid biosynthetic pathway is coordinately regulated by a developmental timing mechanism during germination. Blue light and UVB light induction experiments using red light- and dark-grown seedlings showed that the flavonoid biosynthetic genes are induced most effectively by UVB light and that blue light induction is mediated by a specific blue light receptor. PMID:12297632

Anomaly Detection for Internet of Vehicles: A Trust Management Scheme with Affinity Propagation

Directory of Open Access Journals (Sweden)

Shu Yang

2016-01-01

Full Text Available Anomaly detection is critical for intelligent vehicle (IV collaboration. Forming clusters/platoons, IVs can work together to accomplish complex jobs that they are unable to perform individually. To improve security and efficiency of Internet of Vehicles, IVs’ anomaly detection has been extensively studied and a number of trust-based approaches have been proposed. However, most of these proposals either pay little attention to leader-based detection algorithm or ignore the utility of networked Roadside-Units (RSUs. In this paper, we introduce a trust-based anomaly detection scheme for IVs, where some malicious or incapable vehicles are existing on roads. The proposed scheme works by allowing IVs to detect abnormal vehicles, communicate with each other, and finally converge to some trustworthy cluster heads (CHs. Periodically, the CHs take responsibility for intracluster trust management. Moreover, the scheme is enhanced with a distributed supervising mechanism and a central reputation arbitrator to assure robustness and fairness in detecting process. The simulation results show that our scheme can achieve a low detection failure rate below 1%, demonstrating its ability to detect and filter the abnormal vehicles.

Induction of resveratrol biosynthesis in skins of three grape cultivars by ultraviolet irradiation

International Nuclear Information System (INIS)

Takayanagi, Tsutomu; Okuda, Tohru; Mine, Yohei; Yokotsuka, Koki

2004-01-01

Resveratrol production and expression of the genes related to resveratrol biosynthesis were investigated in the skins of three Vitis vinifera cultivars Chardonnay, Koshu and an American hybrid grape, Muscat Bailey A (Bailey x Muscat Hamburg). Resveratrol concentration in the skins of all the grapes increased significantly when exposed to ultraviolet (UV-C, 254 nm) irradiation. The UV-induced resveratrol concentration in the grape skins was lower after veraison (onset of ripening) than before it. The maximum concentration of the UV-induced resveratrol in 'Muscat Bailey A' was higher than those in the other two cultivars. The relative mRNA expression levels of stilebene synthase (STS), phenylalanine ammonia-lyase (PAL) and chalcone synthase (CHS) genes in grape skins 8 hr after UV irradiation were determined by quantitative reverse transcription-polymerase chain reaction (RT-PCR). The results revealed that STS- and PAL-mRNA expressions were significantly increased by UV irradiation. STS-mRNA expressions in 'Muscat Bailey A' were higher than those in 'Chardonnay' throughout berry development. The UV-induced CHS-mRNA expression in the grape skins decreased before veraison and subsequently increased. (author)

Final Environmental Assessment Addressing Aerial Application of Herbicides at Joint Base Charleston-Weapons Station Charleston, South Carolina

Science.gov (United States)

2013-02-01

a degree that interferes with or interrupts normal breeding, feeding , or sheltering habits , and causes injury, death, or nest abandonment. Pursuant...disrupts the natural shoreline, and impedes drainage of storm water. Fish, mollusks, crustaceans , and other aquatic organisms are also negatively...JB CHS-WS Joint Base Charleston, South Carolina February 2013 3-8 food, feed , forage, fiber, and oilseed crops, and is also available for these

Phylogenetic analysis reveals a cryptic species Blastomyces gilchristii, sp. nov. within the human pathogenic fungus Blastomyces dermatitidis.

Directory of Open Access Journals (Sweden)

Elizabeth M Brown

Full Text Available Analysis of the population genetic structure of microbial species is of fundamental importance to many scientific disciplines because it can identify cryptic species, reveal reproductive mode, and elucidate processes that contribute to pathogen evolution. Here, we examined the population genetic structure and geographic differentiation of the sexual, dimorphic fungus Blastomyces dermatitidis, the causative agent of blastomycosis.Criteria for Genealogical Concordance Phylogenetic Species Recognition (GCPSR applied to seven nuclear loci (arf6, chs2, drk1, fads, pyrF, tub1, and its-2 from 78 clinical and environmental isolates identified two previously unrecognized phylogenetic species. Four of seven single gene phylogenies examined (chs2, drk1, pyrF, and its-2 supported the separation of Phylogenetic Species 1 (PS1 and Phylogenetic Species 2 (PS2 which were also well differentiated in the concatenated chs2-drk1-fads-pyrF-tub1-arf6-its2 genealogy with all isolates falling into one of two evolutionarily independent lineages. Phylogenetic species were genetically distinct with interspecific divergence 4-fold greater than intraspecific divergence and a high Fst value (0.772, P<0.001 indicative of restricted gene flow between PS1 and PS2. Whereas panmixia expected of a single freely recombining population was not observed, recombination was detected when PS1 and PS2 were assessed separately, suggesting reproductive isolation. Random mating among PS1 isolates, which were distributed across North America, was only detected after partitioning isolates into six geographic regions. The PS2 population, found predominantly in the hyper-endemic regions of northwestern Ontario, Wisconsin, and Minnesota, contained a substantial clonal component with random mating detected only among unique genotypes in the population.These analyses provide evidence for a genetically divergent clade within Blastomyces dermatitidis, which we use to describe a novel species

Divertors for helical devices: Concepts, plans, results and problems

International Nuclear Information System (INIS)

Koenig, R.; Grigull, P.; McCormick, K.

2003-01-01

With LHD and W7-X stellarator development is now taking a large leap forward on the path to a steady-state fusion reactor. Important issues that need to be settled in these machines are particle flux and heat control, and the impact of divertors on plasma performance in future continuously burning fusion plasmas. The divertor concepts that will initially be explored in these large stellarators were carefully prepared in smaller scale devices like Heliotron E, CHS and W7-AS. While advanced divertor scenarios relevant for W7-X were already studied in W7-AS, other smaller scale experiments like Heliotron-J, CHS and NCSX will be used for the further development of divertor concepts. The two divertor configurations that are presently being investigated, are the helical and the island divertor, as well as the local island divertor (LID), which was successfully demonstrated on CHS and just went into operation on LHD. Presently, on its route to a fully closed helical divertor, LHD operates in an open helical divertor configuration. W7-X will be equipped right from the start with an actively cooled discrete island divertor which will allow quasi continuous operation. The divertor design is very similar to the one explored on W7-AS. For sufficiently large island sizes and not too long field line connection lengths, this divertor gives access to a partially detached quasi steady-state operating scenario in a newly found high density H-mode operating regime, which benefits from high energy and extremely low impurity confinement times, with edge radiation levels of up to 90 % and sufficient neutral compression in the subdivertor region (> 10) for active pumping. The basic physics of the different divertor concepts and associated implementation problems, like asymmetries due to drifts, accessibility of essential operating scenarios and toroidal asymmetries due to symmetry breaking error fields, etc. will be discussed. (orig.)

Detection of Sleeping Beauty transposition in the genome of host cells by non-radioactive Southern blot analysis

Energy Technology Data Exchange (ETDEWEB)

Aravalli, Rajagopal N., E-mail: aravalli@umn.edu [Department of Radiology, University of Minnesota Medical School, MMC 292, 420 Delaware Street SE, Minneapolis, MN 55455 (United States); Park, Chang W. [Department of Medicine, University of Minnesota Medical School, MMC 36, 420 Delaware Street SE, Minneapolis, MN 55455 (United States); Steer, Clifford J., E-mail: steer001@umn.edu [Department of Medicine, University of Minnesota Medical School, MMC 36, 420 Delaware Street SE, Minneapolis, MN 55455 (United States); Department of Genetics, Cell Biology and Development, University of Minnesota, Minneapolis, MN 55455 (United States)

2016-08-26

The Sleeping Beauty transposon (SB-Tn) system is being used widely as a DNA vector for the delivery of therapeutic transgenes, as well as a tool for the insertional mutagenesis in animal models. In order to accurately assess the insertional potential and properties related to the integration of SB it is essential to determine the copy number of SB-Tn in the host genome. Recently developed SB100X transposase has demonstrated an integration rate that was much higher than the original SB10 and that of other versions of hyperactive SB transposases, such as HSB3 or HSB17. In this study, we have constructed a series of SB vectors carrying either a DsRed or a human β-globin transgene that was encompassed by cHS4 insulator elements, and containing the SB100X transposase gene outside the SB-Tn unit within the same vector in cis configuration. These SB-Tn constructs were introduced into the K-562 erythroid cell line, and their presence in the genomes of host cells was analyzed by Southern blot analysis using non-radioactive probes. Many copies of SB-Tn insertions were detected in host cells regardless of transgene sequences or the presence of cHS4 insulator elements. Interestingly, the size difference of 2.4 kb between insulated SB and non-insulated controls did not reflect the proportional difference in copy numbers of inserted SB-Tns. We then attempted methylation-sensitive Southern blots to assess the potential influence of cHS4 insulator elements on the epigenetic modification of SB-Tn. Our results indicated that SB100X was able to integrate at multiple sites with the number of SB-Tn copies larger than 6 kb in size. In addition, the non-radioactive Southern blot protocols developed here will be useful to detect integrated SB-Tn copies in any mammalian cell type.

Detection of Sleeping Beauty transposition in the genome of host cells by non-radioactive Southern blot analysis

International Nuclear Information System (INIS)

Aravalli, Rajagopal N.; Park, Chang W.; Steer, Clifford J.

2016-01-01

The Sleeping Beauty transposon (SB-Tn) system is being used widely as a DNA vector for the delivery of therapeutic transgenes, as well as a tool for the insertional mutagenesis in animal models. In order to accurately assess the insertional potential and properties related to the integration of SB it is essential to determine the copy number of SB-Tn in the host genome. Recently developed SB100X transposase has demonstrated an integration rate that was much higher than the original SB10 and that of other versions of hyperactive SB transposases, such as HSB3 or HSB17. In this study, we have constructed a series of SB vectors carrying either a DsRed or a human β-globin transgene that was encompassed by cHS4 insulator elements, and containing the SB100X transposase gene outside the SB-Tn unit within the same vector in cis configuration. These SB-Tn constructs were introduced into the K-562 erythroid cell line, and their presence in the genomes of host cells was analyzed by Southern blot analysis using non-radioactive probes. Many copies of SB-Tn insertions were detected in host cells regardless of transgene sequences or the presence of cHS4 insulator elements. Interestingly, the size difference of 2.4 kb between insulated SB and non-insulated controls did not reflect the proportional difference in copy numbers of inserted SB-Tns. We then attempted methylation-sensitive Southern blots to assess the potential influence of cHS4 insulator elements on the epigenetic modification of SB-Tn. Our results indicated that SB100X was able to integrate at multiple sites with the number of SB-Tn copies larger than 6 kb in size. In addition, the non-radioactive Southern blot protocols developed here will be useful to detect integrated SB-Tn copies in any mammalian cell type.

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality; Extracción de aceite de nuez y almendra a escala industrial: efecto de parámetros del proceso sobre el rendimiento y la calidad del aceite

Energy Technology Data Exchange (ETDEWEB)

Martínez, M. L.; Bordón, M.G.; Bodoira, R. M.; Penci, M.C.; Ribotta, P.D.; Maestri, D.M.

2017-07-01

Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC), and restriction die (RD) as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY), fine solid content (FC) in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 %) at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5%) was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO) standards for virgin (non-refined) oils. [Spanish] La nuez y almendra son frutos sumamente nutritivos debido a su alto contenido de aceite. Mediante un diseño experimental de tipo factorial 32 se optimizó el proceso de extracción de estos aceites con prensa de tornillo a escala industrial. Las variables de proceso analizadas fueron el contenido de humedad de la semilla (CHS) y el diámetro de reducción (DR). Los modelos ajustados para rendimiento de aceite (RA) indicaron valores máximos predichos similares a los valores experimentales. Las extracciones de aceite de nuez mostraron un RA máximo (84,5 ± 2,3%) a 7,21% CHS, y 10 mm DR. Para almendra, se obtuvo un máximo de RA (71,9 ± 3,5%) con 9,42% de CHS y 12 mm de DR. Los parámetros de calidad química de ambos aceites se encontraban en los rangos establecidos en las normas del Codex (FAO / OMS) para aceites vírgenes (no refinados).

Divertors for Helical Devices: Concepts, Plans, Results, and Problems

International Nuclear Information System (INIS)

Koenig, R.; Grigull, P.; McCormick, K.

2004-01-01

With Large Helical Device (LHD) and Wendelstein 7-X (W7-X), the development of helical devices is now taking a large step forward on the path to a steady-state fusion reactor. Important issues that need to be settled in these machines are particle flux and heat control and the impact of divertors on plasma performance in future continuously burning fusion plasmas. The divertor concepts that will initially be explored in these large machines were prepared in smaller-scale devices like Heliotron E, Compact Helical System (CHS), and Wendelstein 7-AS (W7-AS). While advanced divertor scenarios relevant for W7-X were already studied in W7-AS, other smaller-scale experiments like Heliotron-J, CHS, and National Compact Stellarator Experiment will be used for the further development of divertor concepts. The two divertor configurations that are being investigated are the helical and the island divertor, as well as the local island divertor, which was successfully demonstrated on CHS and just went into operation on LHD. At present, on its route to a fully closed helical divertor, LHD operates in an open helical divertor configuration. W7-X will be equipped right from the start with an actively cooled discrete island divertor that will allow quasi-continuous operation. The divertor design is very similar to the one explored on W7-AS. For sufficiently large island sizes and not too long field line connection lengths, this divertor gives access to a partially detached quasi-steady-state operating scenario in a newly found high-density H-mode operating regime, which benefits from high energy and low impurity confinement times, with edge radiation levels of up to 90% and sufficient neutral compression in the subdivertor region (>10) for active pumping. The basic physics of the different divertor concepts and associated implementation problems, like asymmetries due to drifts, accessibility of essential operating scenarios, toroidal asymmetries due to symmetry breaking error fields

Methods for transient assay of gene function in floral tissues

Directory of Open Access Journals (Sweden)

Pathirana Nilangani N

2007-01-01

Full Text Available Abstract Background There is considerable interest in rapid assays or screening systems for assigning gene function. However, analysis of gene function in the flowers of some species is restricted due to the difficulty of producing stably transformed transgenic plants. As a result, experimental approaches based on transient gene expression assays are frequently used. Biolistics has long been used for transient over-expression of genes of interest, but has not been exploited for gene silencing studies. Agrobacterium-infiltration has also been used, but the focus primarily has been on the transient transformation of leaf tissue. Results Two constructs, one expressing an inverted repeat of the Antirrhinum majus (Antirrhinum chalcone synthase gene (CHS and the other an inverted repeat of the Antirrhinum transcription factor gene Rosea1, were shown to effectively induce CHS and Rosea1 gene silencing, respectively, when introduced biolistically into petal tissue of Antirrhinum flowers developing in vitro. A high-throughput vector expressing the Antirrhinum CHS gene attached to an inverted repeat of the nos terminator was also shown to be effective. Silencing spread systemically to create large zones of petal tissue lacking pigmentation, with transmission of the silenced state spreading both laterally within the affected epidermal cell layer and into lower cell layers, including the epidermis of the other petal surface. Transient Agrobacterium-mediated transformation of petal tissue of tobacco and petunia flowers in situ or detached was also achieved, using expression of the reporter genes GUS and GFP to visualise transgene expression. Conclusion We demonstrate the feasibility of using biolistics-based transient RNAi, and transient transformation of petal tissue via Agrobacterium infiltration to study gene function in petals. We have also produced a vector for high throughput gene silencing studies, incorporating the option of using T-A cloning to

Síntese de proteína microbiana em bovinos alimentados com resíduos de mandioca e cana-de-açúcar ensilados com polpa cítrica Efficiency of microbial protein in bovine fed with cassava residues and sugar cane ensiled with citric pulp

Directory of Open Access Journals (Sweden)

Ana Karina Dias Salman

2002-04-01

Full Text Available Objetivando-se estudar a síntese de proteína microbiana em bovinos, quatro animais canulados no rúmen e duodeno foram alimentados com 4 dietas: 1- Dieta basal (DB, composta por silagem de milho (SMi e farelo de soja participando na proporção de 60% da matéria seca total das dietas à base de casca e raspa de mandioca; 2- DB + silagem de raspa de mandioca (SRp; 3- DB + silagem de casca de mandioca (SCc e 4- silagem de cana-de-açúcar (SCn, sendo as silagens SRp, SCc e SCn acrescidas da polpa cítrica peletizada como aditivo. O delineamento utilizado foi o quadrado latino 4x4. Não houve diferença (P > 0,05 em relação à composição das bactérias isoladas do conteúdo ruminal de animais que recebiam as diferentes dietas. A eficiência de síntese de proteína microbiana das dietas com SMi, SRp e SCc foram maiores (P With the goal to study the microbial protein synthesis in bovines, four duodenal and ruminant canuleted animals were arranged in a 4 x 4 Latin square and fed with diets formulated with: corn (CS, cassava meal (CMS, cassava hull (CHS or sugar cane (SCS silage. The CMS, CHS and SCS were mixed with citric pulp. The basal diet, composed by CS and soybean meal, participated in 60% of total dry matter of cassava diets. There was no difference (p > 0.05 among diets in relation to bacterial composition isolated from the animal's ruminant contents. The efficiency of microbial protein synthesis of diets on CS, CMS and CHS were larger (p < 0.05 (32.1; 22.2; 26.1 gN/kg of organic matter apparently rumen degraded, respectively than CS (16.4 gN/kg OMARD.

Situational analysis of teaching and learning of medicine and nursing students at Makerere University College of Health Sciences

Directory of Open Access Journals (Sweden)

Kiguli Juliet

2011-03-01

Full Text Available Abstract Background Makerere University College of Health Sciences (MakCHS in Uganda is undergoing a major reform to become a more influential force in society. It is important that its medicine and nursing graduates are equipped to best address the priority health needs of the Ugandan population, as outlined in the government’s Health Sector Strategic Plan (HSSP. The assessment identifies critical gaps in the core competencies of the MakCHS medicine and nursing and ways to overcome them in order to achieve HSSP goals. Methods Documents from the Uganda Ministry of Health were reviewed, and medicine and nursing curricula were analyzed. Nineteen key informant interviews (KII and seven focus group discussions (FGD with stakeholders were conducted. The data were manually analyzed for emerging themes and sub-themes. The study team subsequently used the checklists to create matrices summarizing the findings from the KIIs, FGDs, and curricula analysis. Validation of findings was done by triangulating information from the different data collection methods. Results The core competencies that medicine and nursing students are expected to achieve by the end of their education were outlined for both programs. The curricula are in the process of reform towards competency-based education, and on the surface, are well aligned with the strategic needs of the country. But implementation is inadequate, and can be changed: • Learning objectives need to be more applicable to achieving competencies. • Learning experiences need to be more relevant for competencies and setting in which students will work after graduation (i.e. not just clinical care in a tertiary care facility. • Student evaluation needs to be better designed for assessing these competencies. Conclusion MakCHS has made a significant attempt to produce relevant, competent nursing and medicine graduates to meet the community needs. Ways to make them more effective though deliberate efforts to

Temperature-based modeling of reference evapotranspiration using several artificial intelligence models: application of different modeling scenarios

Science.gov (United States)

Sanikhani, Hadi; Kisi, Ozgur; Maroufpoor, Eisa; Yaseen, Zaher Mundher

2018-02-01

The establishment of an accurate computational model for predicting reference evapotranspiration (ET0) process is highly essential for several agricultural and hydrological applications, especially for the rural water resource systems, water use allocations, utilization and demand assessments, and the management of irrigation systems. In this research, six artificial intelligence (AI) models were investigated for modeling ET0 using a small number of climatic data generated from the minimum and maximum temperatures of the air and extraterrestrial radiation. The investigated models were multilayer perceptron (MLP), generalized regression neural networks (GRNN), radial basis neural networks (RBNN), integrated adaptive neuro-fuzzy inference systems with grid partitioning and subtractive clustering (ANFIS-GP and ANFIS-SC), and gene expression programming (GEP). The implemented monthly time scale data set was collected at the Antalya and Isparta stations which are located in the Mediterranean Region of Turkey. The Hargreaves-Samani (HS) equation and its calibrated version (CHS) were used to perform a verification analysis of the established AI models. The accuracy of validation was focused on multiple quantitative metrics, including root mean squared error (RMSE), mean absolute error (MAE), correlation coefficient (R 2), coefficient of residual mass (CRM), and Nash-Sutcliffe efficiency coefficient (NS). The results of the conducted models were highly practical and reliable for the investigated case studies. At the Antalya station, the performance of the GEP and GRNN models was better than the other investigated models, while the performance of the RBNN and ANFIS-SC models was best compared to the other models at the Isparta station. Except for the MLP model, all the other investigated models presented a better performance accuracy compared to the HS and CHS empirical models when applied in a cross-station scenario. A cross-station scenario examination implies the

Estudo das indicações de partos cesáreas entre hospitais de atendimento ao Sistema Único de Saúde: baixo e alto riscos

Directory of Open Access Journals (Sweden)

Caroline Rosa Pellicciari

2015-10-01

Full Text Available A alta incidência de partos cesáreas  sem indicações precisas é motivo de preocupação mundial.  As cesáreas sem indicações médicas estão associadas a maiores riscos maternos e fetais. De acordo com a Organização Mundial da Saúde (OMS não há justificativa, para qualquer região do mundo possuir  taxas de partos cesáreas maiores do que 10-15%.  Este projeto investigou  os fatores indicativos para a  realização de partos cesáreas  entre hospitais da rede SUS em Sorocaba-SP: Hospital Santa Lucinda – HSL (baixo risco e Conjunto Hospitalar de Sorocaba – CHS (alto risco. Durante o período de 03/2014 a 03/2015 foi realizada análise retrospectiva de 300 prontuários das pacientes internadas nestes hospitais. Analisou-se parâmetros maternos sócio-epidemiológicos, reprodutivos, clínicos e  indicações dos partos cesáreas.  No CHS prevaleceu o tipo de parto cesárea (56,3%, enquanto no HSL a porcentagem do parto cesárea foi 32,4% (p<0,001.  Em relação ao tipo de parto anterior, o número de pacientes com cesárea anterior prevalece no HSL: 77% (n=83 em comparação com o CHS: 56,4% (n=62, (p=0,0009.   Em relação às indicações de cesárea, as mais prevalentes no HSL foram: sofrimento fetal agudo: 24% (n=36, falha na indução ao parto: 22% (n=33 e desproporção céfalo-pélvica: 18,7% (n=28. No CHS  as maiores proporções foram: sofrimento fetal agudo: 35,3% (n=53  e iteratividade: 25,3% (n=38 (p<0,0001.  A observação dos resultados demonstra a realização de partos cesáreas em porcentagens superiores àquelas preconizadas pela OMS. Sua redução poderá ser conseguida preparando-se e conscientizando-se melhor a mulher perante a futura parturição, com procedimentos precisos de indução ao parto, utilizando a aplicação de procedimentos analgésicos, e, ainda com a devida prática da extração baixa pelo fórcipe de alívio às parturientes.

Statistical properties of turbulent transport and fluctuations in tokamak and stellarator devices

Energy Technology Data Exchange (ETDEWEB)

Hidalgo, C; Pedrosa, M A; Milligen, B Van; Sanchez, E; Balbin, R; Garcia-Cortes, I [Euratom-CIEMAT Association, Madrid (Spain); Bleuel, J; Giannone, L.; Niedermeyer, H [Euratom-IPP Association, Garching (Germany)

1997-05-01

The statistical properties of fluctuations and turbulent transport have been studied in the plasma boundary region of stellarator (TJ-IU, W7-AS) and tokamak (TJ-I) devices. The local flux probability distribution function shows the bursty character of the flux and presents a systematic change as a function of the radial location. There exist large amplitude transport bursts that account for a significant part of the total flux. There is a strong similarity between the statistical properties of the turbulent fluxes in different devices. The value of the radial coherence associated with fluctuations and turbulent transport is strongly intermittent. This result emphasizes the importance of measurements with time resolution in understanding the interplay between the edge and the core regions in the plasma. For measurements in the plasma edge region of the TJ-IU torsatron, the turbulent flux does not, in general, show a larger radial coherence than the one associated with the fluctuations. (author). 14 refs, 6 figs.

Bootstrap currents in stellarators and tokamaks

International Nuclear Information System (INIS)

Okamoto, Masao; Nakajima, Noriyoshi.

1990-09-01

The remarkable feature of the bootstrap current in stellarators is it's strong dependence on the magnetic field configuration. Neoclassical bootstrap currents in a large helical device of torsatron/heliotron type (L = 2, M = 10, R = 4 m, B = 4 T) is evaluated in the banana (1/ν) and the plateau regime. Various vacuum magnetic field configurations are studied with a view to minimizing the bootstrap current. It is found that in the banana regime, shifting of the magnetic axis and shaping of magnetic surfaces have a remarkable influence on the bootstrap current; a small outward shift of the magnetic axis and vertically elongated magnetic surfaces are favourable for a reduction of the bootstrap current. It is noted, however, that the ripple diffusion in the 1/ν regime has opposite tendency to the bootstrap current; it increases with the outward shift and increases as the plasma cross section is vertically elongated. The comparison will be made between bootstrap currents in stellarators and tokamaks. (author)

Numerical study of whisker field lines in the periphery of the Large Helical Device

International Nuclear Information System (INIS)

Akao, Hideki

1990-01-01

The behavior of periphery magnetic field lines in the standard Large-Helical Device (l=2 heliotron/torsatron type) configuration is studied numerically. Three different types of behavior are found, corresponding to three different regions: the stochastic region near the outermost magnetic surface, the whisker region, and the inter-whisker region outside the stochastic region. The behavior of whisker and inter-whisker field lines is specifically analyzed. It is found that whisker field lines exhibit both regular and irregular types of behavior, whereas inter-whisker field lines exhibit only regular behavior. The connection lengths for the whisker field lines are usually as long as several tens of toroidal pitches, whereas those for the inter-whisker field lines are usually less than ten toroidal pitch lengths. Whisker field lines are characterized by three fundamental processes; stretching, folding, and nesting associated with the motion of a residual X-point of the separatrix. Simple modeling is performed to reproduce these three fundamental processes. (author)

Improved Harmony Search Algorithm with Chaos for Absolute Value Equation

Directory of Open Access Journals (Sweden)

Shouheng Tuo

2013-11-01

Full Text Available In this paper, an improved harmony search with chaos (HSCH is presented for solving NP-hard absolute value equation (AVE Ax - |x| = b, where A is an arbitrary square matrix whose singular values exceed one. The simulation results in solving some given AVE problems demonstrate that the HSCH algorithm is valid and outperforms the classical HS algorithm (CHS and HS algorithm with differential mutation operator (HSDE.

Large meta-analysis of genome-wide association studies identifies five loci for lean body mass

OpenAIRE

Zillikens, Carola M.; Demissie, Serkalem; Hsu, Yi-Hsiang; Yerges-Armstrong, Laura M.; Chou, Wen-Chi; Stolk, Lisette; Demuth, Ilja; Steinhagen-Thiessen, Elisabeth [u.v.m.

2017-01-01

We acknowledge the essential role of the Cohorts for Heart and Aging Research in Genome Epidemiology (CHARGE) Consortium in development and support of this manuscript. CHARGE members include the Netherland’s Rotterdam Study (RS), Framingham Heart Study (FHS), Cardiovascular Health Study (CHS), the NHLBI’s Atherosclerosis Risk in Communities (ARIC) Study, and Iceland’s Age, Gene/Environment Susceptibility (AGES) Reykjavik Study. Age, Gene/Environment Susceptibility Reykjavik Study (AGES-Reykja...

Overexpression of snapdragon Delila (Del) gene in tobacco enhances anthocyanin accumulation and abiotic stress tolerance

OpenAIRE

Naing, Aung Htay; Park, Kyeung Il; Ai, Trinh Ngoc; Chung, Mi Young; Han, Jeung Sul; Kang, Young-Wha; Lim, Ki Byung; Kim, Chang Kil

2017-01-01

Background Rosea1 (Ros1) and Delila (Del) co-expression controls anthocyanin accumulation in snapdragon flowers, while their overexpression in tomato strongly induces anthocyanin accumulation. However, little data exist on how Del expression alone influences anthocyanin accumulation. Results In tobacco (Nicotiana tabacum ?Xanthi?), Del expression enhanced leaf and flower anthocyanin production through regulating NtCHS, NtCHI, NtF3H, NtDFR, and NtANS transcript levels. Transgenic lines display...

Distribution of radioactivity in the mouse organism after administration of 35S-chondroitin sulphate

International Nuclear Information System (INIS)

Konador, A.; Kawiak, J.

1976-01-01

The follow-up of chondroitin sulphate (ChS) distribution in the organism after its administration by various routes is interesting in view of the possibility of clinical applications. Mice received intraperitoneally and intragastrically 35 S-ChS and the distribution of radioactivity was followed in 10 chosen organs. The dynamics of changes in radioactivity were found to differ in dependence on the type of organ and route of administration. (author)

GesprächsStoff Farbe Beiträge aus Wissenschaft, Kunst und Gesellschaft

CERN Document Server

Karliczek, Andre

2017-01-01

Die Gegenwart eröffnet eine völlig neue Bedeutung und Funktionsaufladung von Farbe. Diese hat in zahlreiche Lebensbereiche Einzug gehalten und reagiert ebenso intelligent auf individuelle Kommunikations- und Unterhaltungsbedürfnisse wie auf hochspezialisierte technologische Anforderungen in Gefahrensituationen. Farbe präsentiert sich als Partner der Energiegewinnung wie als künstlerisches, gestaltendes, gar therapeutisches Medium. Im Rahmen des interdisziplinären Forschungsprojekts „Farbe als Akteur und Speicher“ (FARBAKS) haben in Rückbindung an den Verlauf der Farbgeschichte der vergangenen 200 Jahre zahlreiche Geistes- und Naturwissenschaftler sowie Künstlerinnen und Künstlern den fundamentalen Wandel, dem Farbe seit Beginn der Industrialisierung durch neue technologische Produktions- und Anwendungsformen, durch theoretisch-wissenschaftliche Bewertung und durch neue Bedeutungszuweisungen unterworfen wurde, in den Blick genommen. Der reich bebilderte Band präsentiert Analysen und Ergebnisse un...

Co-transfer of gfp, CHS and hptII genes into Oncidium Sharry Baby ...

African Journals Online (AJOL)

STORAGESEVER

2008-08-04

Aug 4, 2008 ... 3Malaysian Institute for Nuclear Technology Research (MINT), Bangi, 43000, ... Key words: Biolistic gun, co-transformation, orchidaceae, protocorm-like-body. ... *Corresponding author: E-mail: janna@biotech.upm.edu.my.

Control of oxygen impurity and hydrogen recycling in the compact helical system (CHS)

International Nuclear Information System (INIS)

Noda, N.; Okamura, S.; Aoki, T.; Yamada, H.; Tsuzuki, K.; Matsuoka, K.; Iguchi, H.; Hosokawa, M.; Kaneko, O.; Kubo, S.; Morita, S.; Nishimura, K.; Sagara, A.; Shoji, T.; Takahashi, C.; Takeiri, Y.; Takita, Y.; Amemiya, H.; Okazaki, K.; Oyama, Y.; Shimizu, K.; Yano, K.

1990-01-01

In order to reduce oxygen impurity and hydrogen recycling, ECR discharge cleaning with hydrogen, glow discharge with helium, and titanium gettering have been applied. The ECR discharge cleaning was found to be effective in reducing oxygen impurities in ECRH discharges. However, it was not sufficiently effective to give a wide operational density range in NBI heated discharges. Titanium gettering is essential for this purpose, and controllable discharges have been achieved in the density range 1-10x10 19 m -3 , with discharge length more than 850 ms with the aid of titanium gettering. Both helium-glow discharge and Ti gettering are useful to control hydrogen recycling even with a stainless steel wall. (orig.)

Metabolic reduction of phenylpropanoid compounds in primary leaves of rye (Secale cereale L.) leads to increased UV-B sensitivity of photosynthesis

International Nuclear Information System (INIS)

Reuber, S.; Leitsch, J.; Krause, G.H.; Weissenböck, G.

1993-01-01

The present study was undertaken in order to investigate the suitability of certain markers for UV plant response. In addition, we attempted to link the internal tissue distribution of specific UV-absorbing compounds to profiles of radiation gradients within intact primary rye leaves (Secale cereale L. cv. Kustro). Etiolated rye seedlings irradiated with low visible light (LL) and/or UV radiation were used to study enzyme activities of the two key enzymes, phenylalanine ammonia-lyase (PAL) and chalcone synthase (CHS), together with the tissue-specific accumulation of soluble phenylpropanoid products. Plants grown under relatively high visible light (HL) with or without supplementary UV-B radiation were used for further characterization. Apparent quantum yield and fluorescence quenching parameters were monitored to assess potential physiological changes due to UV-B exposure in HL-grown seedlings. A quartz fibreoptic microprobe was used to characterize the internal UV-B gradient of the leaf. The response of the phenylpropanoid metabolism to UV radiation was similar in primary leaves of both etiolated and HL-treated green plants. The epidermis-specific flavonoids together with CHS activity turned out to be suitable markers for assessing the effect of UV on the phenolic metabolism. The functional role of phenylpropanoid compounds was strongly implicated in protecting rye from UV-B radiation

to generation

Directory of Open Access Journals (Sweden)

Michał Otręba

2014-09-01

Full Text Available Inherited diseases of pigmentation were among the first traits studied in humans because of their easy recognition. This article presents selected hypopigmentary disorders, which can be divided into hypomelanocytoses and hypomelanoses. Hereditary hypomelanoses are caused by abnormal melanin biosynthesis as well as by abnormal transfer of mature melanosomes to melanocyte dendrites and to neighboring cells. These disorders are represented by oculocutaneous albinism, Hermansky-Pudlak syndrome, Chediak-Higashi syndrome, Griscelli syndrome, Menkes syndrome and phenylketonuria, and are caused by different mutations of the following genes: TYR, P, TRP1, MATP, HPS, CHS, MYO5A, RAB27A, MLPH, ATP7A and PAH. Oculocutaneous albinism is caused by a deficiency of melanin pigment in the skin, hair, and eye and results from mutations in the TYR, P, TRP1 and MATP genes involved in the biosynthesis of melanin pigment. Mutations in the HPS, CHS, MYO5A, RAB27A and MLPH genes, which regulate the biogenesis, maturation and transfer of me-lanosomes to neighboring cells, are responsible for such disorders as Hermansky-Pudlak, Chediak-Higashi and Griscelli syndromes. In turn, mutations of the ATP7A and PAH genes, regulating intracellular copper concentration and activity of phenylalanine hydroxylase, lead to Menkes syndrome and phenylketonuria.

Genes up-regulated during red coloration in UV-B irradiated lettuce leaves.

Science.gov (United States)

Park, Jong-Sug; Choung, Myoung-Gun; Kim, Jung-Bong; Hahn, Bum-Soo; Kim, Jong-Bum; Bae, Shin-Chul; Roh, Kyung-Hee; Kim, Yong-Hwan; Cheon, Choong-Ill; Sung, Mi-Kyung; Cho, Kang-Jin

2007-04-01

Molecular analysis of gene expression differences between green and red lettuce leaves was performed using the SSH method. BlastX comparisons of subtractive expressed sequence tags (ESTs) indicated that 7.6% of clones encoded enzymes involved in secondary metabolism. Such clones had a particularly high abundance of flavonoid-metabolism proteins (6.5%). Following SSH, 566 clones were rescreened for differential gene expression using dot-blot hybridization. Of these, 53 were found to overexpressed during red coloration. The up-regulated expression of six genes was confirmed by Northern blot analyses. The expression of chalcone synthase (CHS), flavanone 3-hydroxylase (F3H), and dihydroflavonol 4-reductase (DFR) genes showed a positive correlation with anthocyanin accumulation in UV-B-irradiated lettuce leaves; flavonoid 3',5'-hydroxylase (F3',5'H) and anthocyanidin synthase (ANS) were expressed continuously in both samples. These results indicated that the genes CHS, F3H, and DFR coincided with increases in anthocyanin accumulation during the red coloration of lettuce leaves. This study show a relationship between red coloration and the expression of up-regulated genes in lettuce. The subtractive cDNA library and EST database described in this study represent a valuable resource for further research for secondary metabolism in the vegetable crops.

Oligo-carrageenan kappa-induced reducing redox status and activation of TRR/TRX system increase the level of indole-3-acetic acid, gibberellin A3 and trans-zeatin in Eucalyptus globulus trees.

Science.gov (United States)

González, Alberto; Contreras, Rodrigo A; Zúiga, Gustavo; Moenne, Alejandra

2014-08-20

Eucalyptus globulus trees treated with oligo-carrageenan (OC) kappa showed an increase in NADPH, ascorbate and glutathione levels and activation of the thioredoxin reductase (TRR)/thioredoxin (TRX) system which enhance photosynthesis, basal metabolism and growth. In order to analyze whether the reducing redox status and the activation of thioredoxin reductase (TRR)/thioredoxin (TRX) increased the level of growth-promoting hormones, trees were treated with water (control), with OC kappa, or with inhibitors of ascorbate synthesis, lycorine, glutathione synthesis, buthionine sulfoximine (BSO), NADPH synthesis, CHS-828, and thioredoxin reductase activity, auranofine, and with OC kappa, and cultivated for four additional months. Eucalyptus trees treated with OC kappa showed an increase in the levels of the auxin indole 3-acetic acid (IAA), gibberellin A3 (GA3) and the cytokinin trans-zeatin (t-Z) as well as a decrease in the level of the brassinosteroid epi-brassinolide (EB). In addition, treatment with lycorine, BSO, CHS-828 and auranofine inhibited the increase in IAA, GA3 and t-Z as well as the decrease in EB levels. Thus, the reducing redox status and the activation of TRR/TRX system induced by OC kappa increased the levels of IAA, GA3 and t-Z levels determining, at least in part, the stimulation of growth in Eucalyptus trees.

Pre-sowing Seed Treatment with 24-Epibrassinolide Ameliorates Pesticide Stress in Brassica juncea L. through the Modulation of Stress Markers

Directory of Open Access Journals (Sweden)

Parvaiz Ahmad

2016-11-01

Full Text Available The present experiment was designed to assess the effects of seed soaking with 24-epibrassinolide (EBR on the physiology of Brassica juncea L. seedlings grown under imidacloprid (IMI toxicity. Application of EBR increased the length of seedlings, dry weight, and pigment contents, polyphenols, total phenols and organic acids under IMI toxicity. The expression of genes coding key enzymes of pigment, phenols, polyphenols and organic acid biosynthetic pathways was also studied including CHLASE (chlorophyllase, PSY (phytoene synthase, CHS (chalcone synthase and PAL (phenylalanine ammonialyase, CS (citrate synthase, SUCLG1 (succinyl Co-A ligase,, SDH (succinate dehydrogenase, FH (fumarate hydratase, MS (malate synthase. Multiple linear regression analysis revealed that IMI application regressed negatively on seedling length, dry weight and total chlorophyll content. However, EBR seed treatment regressed positively on all of the parameters studied. Moreover, interaction between IMI and EBR showed positive regression for growth parameters, content of pigments, total polyphenol, total phenol and malate, and expression of PSY and PAL. Negative interactions were noticed for the contents of fumarate, succinate and citrate, and expression of CHS and all genes studied related to organic acid metabolism. In conclusion, EBR enhanced the growth and contents of all studied metabolites by regulating the gene expression of B. juncea seedlings under IMI stress.

Cyclic ADP-ribose and IP3 mediate abscisic acid-induced isoflavone accumulation in soybean sprouts

International Nuclear Information System (INIS)

Jiao, Caifeng; Yang, Runqiang; Gu, Zhenxin

2016-01-01

In this study, the roles of ABA-cADPR-Ca 2+ and ABA-IP3-Ca 2+ signaling pathways in UV-B-induced isoflavone accumulation in soybean sprouts were investigated. Results showed that abscisic acid (ABA) up regulated cyclic ADP-ribose (cADPR) and inositol 1,4,5-trisphosphate (IP3) levels in soybean sprouts under UV-B radiation. Furthermore, cADPR and IP3, as second messengers of UV-B-triggered ABA, induced isoflavone accumulation by up-regulating proteins and genes expression and activity of isoflavone biosynthetic-enzymes (chalcone synthase, CHS; isoflavone synthase, IFS). After Ca 2+ was chelated by EGTA, isoflavone content decreased. Overall, ABA-induced cADPR and IP3 up regulated isoflavone accumulation which was mediated by Ca 2+ signaling via enhancing the expression of proteins and genes participating in isoflavone biosynthesis in soybean sprouts under UV-B radiation. - Highlights: • UV-B-induced cADPR and IP3 synthesis was mediated by ABA. • cADPR and IP3 were involved in UV-B-ABA-induced isoflavone accumulation. • cADPR and IP3-induced isoflavone accumulation may be mediated by Ca 2+ . • ABA, cADPR, IP3 and Ca 2+ could activate proteins expression of CHS and IFS.

[Assessment of a risk from exposure to atmosphere bus industrial emissions].

Science.gov (United States)

Stepkin, Iu I; Kuzmichev, M K

2009-01-01

The carcinogenic and noncarcinogenic risks to health were estimated in accordance with the requirements stated in the guide P 2.1.10.1920-04 "Guidelines for assessing the health risk in the population exposed to the chemicals polluting the environment" (approved by G. G. Onishchenko, state sanitary inspector on March 5, 2004) and comprised four successive steps: 1) identification of a hazard; 2) estimation of a dose-response relationship; 3) evaluation of exposure of the population to chemical substances; 4) characterization of a risk, by calculating the individual carcinogenic risk, hazard coefficients and indices characterizing the noncarcinogenic risk. The performed assessment of the health risk to the population living in the area exposed to the ambient air pollutant emissions by the AOA "Shinnyi Kompleks Amtel-Chenozymye" (Amtel-Chernozem Tyre Complex) allowed determination of priority pollutants, by taking into account their effect on human health. The individual carcinogenic risk to health has been found to be higher than the acceptable (safe) level (10-4) was due to the probable exposure to a 2-heptane fraction (nefras ChS 94/99) and hexavalent chromium. The highest non-carcinogenic risk to human was also due to the heptane fraction (nefras ChS 94/99) (hazard coefficient > 1).

A chilling sensitive mutant of Arabidopsis with altered steryl-ester metabolism

International Nuclear Information System (INIS)

Hugly, S.; McCourt, P.; Somerville, C.; Browse, J.; Patterson, G.W.

1990-01-01

A chilling-sensitive mutant of Arabidopsis thaliana was isolated and subjected to genetic, physiological, and biochemical analysis. The chilling-sensitive nature of the mutant line is due to a single recessive nuclear mutation at a locus designated chs1. In contrast to wild-type plants, which are not adversely affected by low temperatures, the chs1 mutant is killed by several days of exposure to temperatures below 18 degree C. Following exposure to chilling temperatures, the mutant displays two common symptoms of chilling injury - leaf chlorosis and electrolyte leakage. In these respects, the physiological response of the mutant to low temperatures mimics the response observed in some naturally occurring chilling sensitive species. The biochemical basis of chilling sensitivity was explored by examining the pattern of incorporation of 14 CO 2 into soluble metabolites and lipids in wild-type and mutant plants. The only difference observed between the mutant and wild type was that following low temperature treatment, the mutant accumulated 10-fold more radioactivity in a specific class of neutral lipids which were identified by a variety of criteria to be steryl-esters. The accumulation of radioactivity in the steryl-ester fraction occurs 24 hours before there is any visible evidence of chilling injury

Femoral neck-shaft angle in extra-capsular proximal femoral fracture fixation; does it make a TAD of difference?

Science.gov (United States)

Walton, N P; Wynn-Jones, H; Ward, M S; Wimhurst, J A

2005-11-01

The effect of femoral neck-shaft angle and implant type on the accuracy of lag screw placement in extra-capsular proximal femoral fracture fixation was investigated. Radiographs of all extra-capsular proximal femoral fractures seen in one unit over 18 months were reviewed. Of 399 cases, 307 (237 female, 70 male) were included in the study as they had no contra-lateral proximal femoral metal work. Femoral neck-shaft angle (NSA) of the uninjured hip and magnification adjusted tip-apex distance (TAD) of femoral head lag screw were measured. Type of fixation implant was 135 degrees classic hip screw (CHS) (n=144) or 130 degrees intra-medullary hip screw (IMHS) (n=163). Mean contra-lateral NSA was 130.2 degrees (112.9--148 degrees ) and 64 patients (58 female, 6 male) had a NSA TAD was 18.7 mm (5.8--43.8mm) and 88.9% of cases had a TAD of less than 25 mm. TAD values were significantly greater using an IMHS if NSA was 125 degrees (p=0.028). This was not the case with the CHS. The use of the 130 degrees -IMHS in patients with a NSA 125 degrees and caution is advocated when using this device in such cases.

Demographic and biologic influences on survival in whites and blacks: 40 years of follow-up in the Charleston heart study

Directory of Open Access Journals (Sweden)

Bachman David L

2006-07-01

Full Text Available Abstract Background In the United States, life expectancy is significantly lower among blacks than whites. We examined whether socioeconomic status (SES and cardiovascular disease (CVD risk factors may help explain this disparity. Methods Forty years (1961 through 2000 of all-cause mortality data were obtained on a population-based cohort of 2,283 subjects in the Charleston Heart Study (CHS. We examined the influence of SES and CVD risk factors on all-cause mortality. Results Complete data were available on 98% of the original sample (647 white men, 728 white women, 423 black men, and 443 black women. After adjusting for SES and CVD risk factors, the hazard ratios (HRs for white ethnicity were 1.14 (0.98 to 1.32 among men and 0.90 (0.75 to 1.08 among women, indicating that the mortality risk was 14% greater for white men and 10% lower for white women compared to their black counterparts. However the differences were not statistically significant. Conclusion While there are marked contrasts in mortality among blacks and whites in the CHS, the differences can be largely explained by SES and CVD risk factors. Continued focus on improving and controlling cardiovascular disease risk factors may reduce ethnic disparities in survival.

Balanced Cluster Head Selection Based on Modified k-Means in a Distributed Wireless Sensor Network

OpenAIRE

Periyasamy, Sasikumar; Khara, Sibaram; Thangavelu, Shankar

2016-01-01

A major problem with Wireless Sensor Networks (WSNs) is the maximization of effective network lifetime through minimization of energy usage in the network nodes. A modified k-means (Mk-means) algorithm for clustering was proposed which includes three cluster heads (simultaneously chosen) for each cluster. These cluster heads (CHs) use a load sharing mechanism to rotate as the active cluster head, which conserves residual energy of the nodes, thereby extending network lifetime. Moreover, it re...

The Haw River Sites: Archaeological Investigations at Two Stratified Sites in the North Carolina Piedmont. Volume III.

Science.gov (United States)

1982-04-01

activity of the NBS Oxalic acid as a modem standard. .......... Table 1 Radiocarbon Age Determinations for Samples from 31ChS and 31Ch29 Lab Number...devitrified flow. Devitrification of both basic and acidic tuffs involves alteration of glass and glass fragments to other minerals (Howell, Turner...quartz as " hydrothermal veins" (Blatt at al. 1972:276-277) account for its white color. Additional trace minerals may add color to the quartz. In

MSCT对脑过度灌注综合征的预测、预防以及动态观察的意义%The Signiifcance of MSCT in the Prediction, Prevention and Dynamic Observation of Cerebral Hyperperfusion Syndrome

Institute of Scientific and Technical Information of China (English)

成明富; 常小娜; 李松; 戴美娜

2016-01-01

目的：探讨MSCT对脑过度灌注综合征(cerebral hyperperfusion syndrome,CHS)的预测、预防以及动态观察的意义。方法回顾性分析8例CHS患者的临床资料及影像学资料。结果8例中，动脉溶栓术后及DSA筛查术后各发生3例、颈动脉支架植入术后及动脉瘤弹簧圈填塞术后各发生1例。分别观察其超早期(1小时内)、早期(24小时内)、中期(1-5天)和晚期(＞5天)的MSCT动态表现：4例脑梗死患者术后超早期发生急性脑出血，3例脑出血逐渐吸收；1例脑出血早期增多并伴脑疝形成，中、晚期逐渐加重后死亡。4例脑出血患者术后，2例超早期出现脑水肿及脑肿胀，其后逐渐吸收至恢复；1例出血量逐渐增多，晚期略有吸收；另1例出血量在超早期明显增多并出现脑水肿及脑肿胀，其后症状无改善，家属最终放弃治疗后死亡。结论 MSCT在预测、预防CHS的发生、发展中具有重要价值，应列入常规检查；MSCT动态观察是显示CHS演变过程的最可靠、最直观的检查手段，可为治疗和判断预后提供重要依据。%Objective To investigate the signiifcance of MSCT in the prediction, prevention and dynamic observation of cerebral hyperperfusion syndrome (CHS). Methods The clinical and imaging data of 8 patients with CHS were analyzed retrospectively. Results In 8 cases, 1 cases occurred after arterial thrombolysis and DSA screening after the operation, 3 cases of carotid artery stenting and coil embolization of aneurysm after operation. Were observed in the ultra-early (1 hour) and early (within 24 hours), middle (1 to 5 days) and late (>5 days) of MSCT dynamic performance:4 cases of cerebral infarction patients with ultra-early occurrence of acute cerebral hemorrhage, 3 cases of cerebral hemorrhage absorbed gradually;1 cases intracerebral hemorrhage in early stage and increased with cerebral hernia formation, middle and late gradually increased after death

Detección del virus de la leucosis bovina en ganado criollo colombiano mediante PCR-anidado Bovine leukemia virus detection in Creole Colombian breeds using nested-PCR

Directory of Open Access Journals (Sweden)

Darwin Yovanny Hernández-Herrera

2011-12-01

Full Text Available Se evaluó la presencia del virus de la leucosis bovina (VLB en 360 muestras de ADN de ocho razas bovinas criollas: Blanco Orejinegro (BON, Casanareño (CAS, Costeño con Cuernos (CCC, Chino Santandereano (ChS, Caqueteño (CQT, Hartón del Valle (HV, Romosinuano (RS y San Martinero (SM, dos Razas Sintéticas Colombianas: Lucerna (LUC y Velásquez (VEL y dos razas foráneas: Brahmán (B y Holstein (H. Para la detección del pro-virus se amplificó una región del gen env viral, mediante PCR anidada. La presencia del VLB fue mayor en la raza HV seguido por ChS (83.3% y 60% respectivamente, VEL y LUC tuvieron el mismo porcentaje (50%, en CAS, CCC y CQT la presencia del virus fue de 26.7%, 23.3% y 16.7% respectivamente; no se encontró el virus en BON, SM y RS. En las razas foráneas la presencia fue de 83.3% para H y 6.7% para B. Se encontró dependencia altamente significativa entre la presencia del VLB y la raza, el sexo y región de origen de la muestra. El promedio de presencia en las razas criollas fue menor que en las foráneas, menor en los machos que en las hembras y en la región norte que en el suroccidente y el centro del país.Using 360 DNA samples from eight Creole bovine breeds Blanco Orejinegro (BON, Casanareño (CAS, Costeño con Cuernos (CCC, Chino Santandereano (ChS, Caqueteño (CQT, Hartón del Valle (HV, Romosinuano (RS and San Martinero (SM, two synthetic Colombian breeds: Lucerna (LUC and Velásquez (VEL and two introduced breeds Brahmán (B and Holstein (H; the presence of Bovine Leukemia Virus (BLV was evaluated through the amplification of a viral gene region env (provirus detection - nested-PCR. The percentage of presence and independence test were calculated (X². Presence of BLV was higher in HV breed, followed by ChS (83.3% and 60% respectively; VEL and LUC breeds showed the same percentage (50%. In CAS, CCC and CQT the presence of virus was 26.7%, 23.3% y 16.7% respectively. On the other hand, no virus presence was

The Liquid Metallic Hydrogen Model of the Sun and the Solar Atmosphere VI. Helium in the Chromosphere

Directory of Open Access Journals (Sweden)

Robitaille P.-M.

2013-07-01

Full Text Available Molecular hydrogen and hydrides have recently been advanced as vital agents in the generation of emission spectra in the chromosphere. This is a result of the role they play in the formation of condensed hydrogen structures (CHS within the chromosphere (P.M. Robitaille. The Liquid Metallic Hydrogen Model of the Sun and the Solar Atmosphere IV. On the Nature of the Chromosphere. Progr. Phys., 2013, v. 3, 15–21. Next to hydrogen, helium is perhaps the most intriguing component in this region of the Sun. Much like other elements, which combine with hydrogen to produce hydrides, helium can form the well-known helium hydride molecular ion, HeH+, and the excited neutral helium hydride molecule, HeH∗. While HeH+ is hypothesized to be a key cosmologicalmolecule, its possible presence in the Sun, and that of its excited neutral counterpart, has not been considered. Still, these hydrides are likely to play a role in the synthesis of CHS, as the He I and He II emission lines strongly suggest. In this regard, the study of helium emission spectra can provide insight into the condensed nature of the Sun, especially when considering the 10830 Å line associated with the 23P→2 3S triplet state transition. This line is strong in solar prominences and can be seen clearly on the disk. The excessive population of helium triplet states cannot be adequately explained using the gaseous models, since these states should be depopulated by collisional processes. Conversely, when He-based molecules are used to build CHS in a liquid metallic hydrogen model, an ever increasing population of the 23S and 23P states might be expected. The overpopulation of these triplet states leads to the conclusion that these emission lines are unlikely to be produced through random collisional or photon excitation, as required by the gaseous models. This provides a significant hurdle for these models. Thus, the strong 23P→2 3S lines and the overpopulation of the helium triplet

Competing definitions of contextual environments

Directory of Open Access Journals (Sweden)

Jerrett Michael

2006-12-01

Full Text Available Abstract Background The growing interest in the effects of contextual environments on health outcomes has focused attention on the strengths and weaknesses of alternate contextual unit definitions for use in multilevel analysis. The present research examined three methods to define contextual units for a sample of children already enrolled in a respiratory health study. The Inclusive Equal Weights Method (M1 and Inclusive Sample Weighted Method (M2 defined communities using the boundaries of the census blocks that incorporated the residences of the CHS participants, except that the former estimated socio-demographic variables by averaging the census block data within each community, while the latter used weighted proportion of CHS participants per block. The Minimum Bounding Rectangle Method (M3 generated minimum bounding rectangles that included 95% of the CHS participants and produced estimates of census variables using the weighted proportion of each block within these rectangles. GIS was used to map the locations of study participants, define the boundaries of the communities where study participants reside, and compute estimates of socio-demographic variables. The sensitivity of census variable estimates to the choice of community boundaries and weights was assessed using standard tests of significance. Results The estimates of contextual variables vary significantly depending on the choice of neighborhood boundaries and weights. The choice of boundaries therefore shapes the community profile and the relationships between its components (variables. Conclusion Multilevel analysis concerned with the effects of contextual environments on health requires careful consideration of what constitutes a contextual unit for a given study sample, because the alternate definitions may have differential impact on the results. The three alternative methods used in this research all carry some subjectivity, which is embedded in the decision as to what

A situation analysis of inter-professional education and practice for ethics and professionalism training at Makerere University College of Health Sciences.

Science.gov (United States)

Byakika-Kibwika, Pauline; Kutesa, Annet; Baingana, Rhona; Muhumuza, Christine; Kitutu, Freddy Eric; Mwesigwa, Catherine; Chalo, Rose Nabirye; Sewankambo, Nelson K

2015-10-23

Students at Makerere University College of Health Sciences (MakCHS) are introduced to ethics and professionalism using the inter-professional education (IPE) model. Ethics and professionalism should be running themes throughout succeeding years of study during which students are expected to develop qualities and skills for future inter-professional practice (IPP). We performed a situation analysis of IPE and IPP among students and teaching health professionals at MakCHS to guide development of a relevant training curriculum of ethics and professionalism. A cross sectional study with quantitative and qualitative methods which included questionnaires, focus group discussions and key informant interviews. We interviewed 236 undergraduate students (148, 63 % male) and 32 teaching health professionals (25, 78 % male). Two hundred fifteen (91 %) students indicated they had joint learning activities with students of other professions and 166 (70 %) stated there was benefit in having an IPE model training curriculum. Most students (140, 59 %) strongly agreed that learning with other students will make them more effective members of the health team. Whereas the respondents reported inter professionalism as being well articulated in their course curricula, more than half said IPE is only implemented in the pre-clinical years of study. They noted that IPE and IPP concepts were not well programmed, health professionals engaged in teaching had poor attitudes towards IPE and IPP, there were limited numbers of skilled health care workers to implement IPP and there was poor communication between students and teaching health professionals. Majority of teaching health professionals noted challenges in implementation of IPE such as poor coordination and large student population and major factors influencing ethics and professionalism in healthcare such as limited government support, low pay for the health care workers, disrespect and lack of appreciation of the health workers by the

Production of TNF-alpha by skin explants of dinitrochlorobenzene-challenged ears in rats: A model for the evaluation of contact hypersensitivity

Directory of Open Access Journals (Sweden)

Kataranovski Milena

2002-01-01

Full Text Available Background. Contact hypersensitivity (CHS is a local inflammatory response of the skin following challenge of hapten-sensitized animals. It is the consequence of cell infiltration of derm and the release of inflammation mediators, among which Tumor necrosis factor-alpha (TNF-α is one of the most important factors. The intensity of the inflammation could be quantified by ear swelling which is the classical manifestation of the reaction. This study was testing the working hypothesis that levels of TNF-α in skin organ culture medium should correlate with the intensity of CHS reaction measured in vivo by ear swelling assay, and with the density of dermal infiltrate in ear skin samples. In order to test the working hypothesis, the intensity of inflammatory reaction following challenge was evaluated by classical measurements of ear swelling, by the determination of TNF-α levels in culture fluids of ear skin following epicutaneous application of dinitrochlorobenzene (DNCB into the ears of sensitized animals. Methods. Animal model of CHS reaction to DNCB in Albino Oxford rats was used as described. Ear swelling was quantified in percentage terms as the difference in thickness between the challenged and nontreated ears of the same animal. Dermal infiltrate density in histopathologically analyzed samples of ear skin was evaluated by computer-assisted image analysis. Ear skin samples were cultured in standard medium for 24 h, and TNF-α concentration in the conditioned medium was subsequently determined with ELISA test. Results. Dose-dependent increase in the density of the dermal infiltrate and in TNF-α in CM were noted following the application of 0.65%, 1.3% and 2.6% of DNCB to the ears of previously sensitized rats. The correlation between ear swelling and the levels of TNF-α (r=0.933, p<0.001 in CM, and between ear swelling and dermal infiltrate density (r=0.916, p<0.001 was found. Correlation was also found between the density of the dermal

Short Pulse Laser Applications Design

International Nuclear Information System (INIS)

Town, R.J.; Clark, D.S.; Kemp, A.J.; Lasinski, B.F.; Tabak, M.

2008-01-01

We are applying our recently developed, LDRD-funded computational simulation tool to optimize and develop applications of Fast Ignition (FI) for stockpile stewardship. This report summarizes the work performed during a one-year exploratory research LDRD to develop FI point designs for the National Ignition Facility (NIF). These results were sufficiently encouraging to propose successfully a strategic initiative LDRD to design and perform the definitive FI experiment on the NIF. Ignition experiments on the National Ignition Facility (NIF) will begin in 2010 using the central hot spot (CHS) approach, which relies on the simultaneous compression and ignition of a spherical fuel capsule. Unlike this approach, the fast ignition (FI) method separates fuel compression from the ignition phase. In the compression phase, a laser such as NIF is used to implode a shell either directly, or by x rays generated from the hohlraum wall, to form a compact dense (∼300 g/cm 3 ) fuel mass with an areal density of ∼3.0 g/cm 2 . To ignite such a fuel assembly requires depositing ∼20kJ into a ∼35 (micro)m spot delivered in a short time compared to the fuel disassembly time (∼20ps). This energy is delivered during the ignition phase by relativistic electrons generated by the interaction of an ultra-short high-intensity laser. The main advantages of FI over the CHS approach are higher gain, a lower ignition threshold, and a relaxation of the stringent symmetry requirements required by the CHS approach. There is worldwide interest in FI and its associated science. Major experimental facilities are being constructed which will enable 'proof of principle' tests of FI in integrated subignition experiments, most notably the OMEGA-EP facility at the University of Rochester's Laboratory of Laser Energetics and the FIREX facility at Osaka University in Japan. Also, scientists in the European Union have recently proposed the construction of a new FI facility, called HiPER, designed to

Environmental Assessment for Terminal Area Improvements, Charleston International Airport

Science.gov (United States)

2011-11-17

34endangered species" is defined as any species in danger of extinction throughout all or a significant portion of its range. A "threatened species" is...brackish wetlands and nest In cypress or other wooded swamps Low wet forests with dense saw palmetto or giant cane understory - probably extinct Mature...and private haulers and then taken to the Bees Ferry Landfill, which is located approximately 3 miles southwest of CHS. In 2010, the Bees Ferry