caninas cannis familiaris: Topics by WorldWideScience.org

Sample records for caninas cannis familiaris

Canny edge-based deformable image registration.

Science.gov (United States)

Kearney, Vasant; Huang, Yihui; Mao, Weihua; Yuan, Baohong; Tang, Liping

2017-02-07

This work focuses on developing a 2D Canny edge-based deformable image registration (Canny DIR) algorithm to register in vivo white light images taken at various time points. This method uses a sparse interpolation deformation algorithm to sparsely register regions of the image with strong edge information. A stability criterion is enforced which removes regions of edges that do not deform in a smooth uniform manner. Using a synthetic mouse surface ground truth model, the accuracy of the Canny DIR algorithm was evaluated under axial rotation in the presence of deformation. The accuracy was also tested using fluorescent dye injections, which were then used for gamma analysis to establish a second ground truth. The results indicate that the Canny DIR algorithm performs better than rigid registration, intensity corrected Demons, and distinctive features for all evaluation matrices and ground truth scenarios. In conclusion Canny DIR performs well in the presence of the unique lighting and shading variations associated with white-light-based image registration.
Information theoretic analysis of canny edge detection in visual communication

Science.gov (United States)

Jiang, Bo; Rahman, Zia-ur

2011-06-01

In general edge detection evaluation, the edge detectors are examined, analyzed, and compared either visually or with a metric for specific an application. This analysis is usually independent of the characteristics of the image-gathering, transmission and display processes that do impact the quality of the acquired image and thus, the resulting edge image. We propose a new information theoretic analysis of edge detection that unites the different components of the visual communication channel and assesses edge detection algorithms in an integrated manner based on Shannon's information theory. The edge detection algorithm here is considered to achieve high performance only if the information rate from the scene to the edge approaches the maximum possible. Thus, by setting initial conditions of the visual communication system as constant, different edge detection algorithms could be evaluated. This analysis is normally limited to linear shift-invariant filters so in order to examine the Canny edge operator in our proposed system, we need to estimate its "power spectral density" (PSD). Since the Canny operator is non-linear and shift variant, we perform the estimation for a set of different system environment conditions using simulations. In our paper we will first introduce the PSD of the Canny operator for a range of system parameters. Then, using the estimated PSD, we will assess the Canny operator using information theoretic analysis. The information-theoretic metric is also used to compare the performance of the Canny operator with other edge-detection operators. This also provides a simple tool for selecting appropriate edgedetection algorithms based on system parameters, and for adjusting their parameters to maximize information throughput.
Implementing a Parallel Image Edge Detection Algorithm Based on the Otsu-Canny Operator on the Hadoop Platform.

Science.gov (United States)

Cao, Jianfang; Chen, Lichao; Wang, Min; Tian, Yun

2018-01-01

The Canny operator is widely used to detect edges in images. However, as the size of the image dataset increases, the edge detection performance of the Canny operator decreases and its runtime becomes excessive. To improve the runtime and edge detection performance of the Canny operator, in this paper, we propose a parallel design and implementation for an Otsu-optimized Canny operator using a MapReduce parallel programming model that runs on the Hadoop platform. The Otsu algorithm is used to optimize the Canny operator's dual threshold and improve the edge detection performance, while the MapReduce parallel programming model facilitates parallel processing for the Canny operator to solve the processing speed and communication cost problems that occur when the Canny edge detection algorithm is applied to big data. For the experiments, we constructed datasets of different scales from the Pascal VOC2012 image database. The proposed parallel Otsu-Canny edge detection algorithm performs better than other traditional edge detection algorithms. The parallel approach reduced the running time by approximately 67.2% on a Hadoop cluster architecture consisting of 5 nodes with a dataset of 60,000 images. Overall, our approach system speeds up the system by approximately 3.4 times when processing large-scale datasets, which demonstrates the obvious superiority of our method. The proposed algorithm in this study demonstrates both better edge detection performance and improved time performance.
Aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus- PI e região metropolitana do Recife- PE, Brasil.

OpenAIRE

Jamile Prado dos Santos

2010-01-01

A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania infantum a qual é relatada em várias regiões. O objetivo desta pesquisafoi verificar aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus PI e Região Metropolitana de Recife - PE, Brasil. Cães do município de Bom Jesus, Piauí, e do bairro de Muribeca, município de Jaboatão dos Guararapes, Pernambuco...
A new edge detection algorithm based on Canny idea

Science.gov (United States)

Feng, Yingke; Zhang, Jinmin; Wang, Siming

2017-10-01

The traditional Canny algorithm has poor self-adaptability threshold, and it is more sensitive to noise. In order to overcome these drawbacks, this paper proposed a new edge detection method based on Canny algorithm. Firstly, the media filtering and filtering based on the method of Euclidean distance are adopted to process it; secondly using the Frei-chen algorithm to calculate gradient amplitude; finally, using the Otsu algorithm to calculate partial gradient amplitude operation to get images of thresholds value, then find the average of all thresholds that had been calculated, half of the average is high threshold value, and the half of the high threshold value is low threshold value. Experiment results show that this new method can effectively suppress noise disturbance, keep the edge information, and also improve the edge detection accuracy.
ANTIMICROBIAL ACTIVITY OF ROSA CANINA FLOWERS AGAINST SELECTED MICROORGANISMS

Directory of Open Access Journals (Sweden)

Katarína Rovná

2015-02-01

Full Text Available Rosa canina flowers were screened against various plant pathogenic microbial strains to study the antimicrobial properties of the plant. Ethanolic and methanolic extracts of flowers were screened applying agar well diffusion method against two Gram-negative bacteria including Escherichia coli CCM 3988 and Pseudomonas aeruginosa CCM 1960 and three microscopic filamentous fungi strains Aspergillus niger, Fusarium culmorum and Alternaria alternata, respectively. The best antimicrobial effect of ethanolic extract of Rosa canina flowers was found against Pseudomonas aeruginosa and the best antimicrobial effect of methanolic extract of Rosa canina flowers was found against Escherichia coli.
Implementation of Canny and Isotropic Operator with Power Law Transformation to Identify Cervical Cancer

Science.gov (United States)

Amalia, A.; Rachmawati, D.; Lestari, I. A.; Mourisa, C.

2018-03-01

Colposcopy has been used primarily to diagnose pre-cancer and cancerous lesions because this procedure gives an exaggerated view of the tissues of the vagina and the cervix. But, the poor quality of colposcopy image sometimes makes physician challenging to recognize and analyze it. Generally, Implementation of image processing to identify cervical cancer have to implement a complex classification or clustering method. In this study, we wanted to prove that by only applying the identification of edge detection in the colposcopy image, identification of cervical cancer can be determined. In this study, we implement and comparing two edge detection operator which are isotropic and canny operator. Research methodology in this paper composed by image processing, training, and testing stages. In the image processing step, colposcopy image transformed by nth root power transformation to get better detection result and continued with edge detection process. Training is a process of labelling all dataset image with cervical cancer stage. This process involved pathology doctor as an expert in diagnosing the colposcopy image as a reference. Testing is a process of deciding cancer stage classification by comparing the similarity image of colposcopy results in the testing stage with the image of the results of the training process. We used 30 images as a dataset. The result gets same accuracy which is 80% for both Canny or Isotropic operator. Average running time for Canny operator implementation is 0.3619206 ms while Isotropic get 1.49136262 ms. The result showed that Canny operator is better than isotropic operator because Canny operator generates a more precise edge with a fast time instead.
Age McCanni büroo = Offices of Age McCann

Index Scriptorium Estoniae

2010-01-01

Tallinnas Rotermanni 8 asuva Age McCanni büroo sisekujundusest. Sisekujunduse autorid: sisearhitekt Kerli Valk (Kukuhaus OÜ) ja arhitekt Tomomi Hayashi (HG Arhitektuur OÜ), nende tähtsamate tööde loetelu
Performance evaluation of canny edge detection on a tiled multicore architecture

Science.gov (United States)

Brethorst, Andrew Z.; Desai, Nehal; Enright, Douglas P.; Scrofano, Ronald

2011-01-01

In the last few years, a variety of multicore architectures have been used to parallelize image processing applications. In this paper, we focus on assessing the parallel speed-ups of different Canny edge detection parallelization strategies on the Tile64, a tiled multicore architecture developed by the Tilera Corporation. Included in these strategies are different ways Canny edge detection can be parallelized, as well as differences in data management. The two parallelization strategies examined were loop-level parallelism and domain decomposition. Loop-level parallelism is achieved through the use of OpenMP,1 and it is capable of parallelization across the range of values over which a loop iterates. Domain decomposition is the process of breaking down an image into subimages, where each subimage is processed independently, in parallel. The results of the two strategies show that for the same number of threads, programmer implemented, domain decomposition exhibits higher speed-ups than the compiler managed, loop-level parallelism implemented with OpenMP.
Epidemiología de la rabia canina en colombia

OpenAIRE

Cediel Becerra, Natalia Margarita; De la Hoz Restrepo, Fernando; Romero Prada, Jaime Ricardo; Villamil Jimenez, Luis Carlos; Diaz Gomez, Arturo

2011-01-01

Objetivo Se realizó un estudio epidemiológico ecológico para describir la tendencia de la rabia canina desde 1976-2006 y explorar posibles factores relacionados con su presentación en Colombia, Metodología Las variables fueron recolectadas mediante un cuestionario aplicado a los responsables del programa en cada departamento y mediante fuentes de información oficiales nacionales. Se calculó la incidencia de la rabia canina entre 2001-2006. Se emplearon razones de tasas de incidencia y prueba...
Epidemiología de la rabia canina en Colombia

OpenAIRE

Cediel, Natalia; de la Hoz, Fernando; Villamil, Luis C; Romero, Jaime; Díaz, Arturo

2010-01-01

Objetivo Se realizó un estudio epidemiológico ecológico para describir la tendencia de la rabia canina desde 1976-2006 y explorar posibles factores relacionados con su presentación en Colombia. Metodología Las variables fueron recolectadas mediante un cuestionario aplicado a los responsables del programa en cada departamento y mediante fuentes de información oficiales nacionales. Se calculó la incidencia de la rabia canina entre 2001-2006. Se emplearon razones de tasas de incidencia y pruebas...
Iris Location Algorithm Based on the CANNY Operator and Gradient Hough Transform

Science.gov (United States)

Zhong, L. H.; Meng, K.; Wang, Y.; Dai, Z. Q.; Li, S.

2017-12-01

In the iris recognition system, the accuracy of the localization of the inner and outer edges of the iris directly affects the performance of the recognition system, so iris localization has important research meaning. Our iris data contain eyelid, eyelashes, light spot and other noise, even the gray transformation of the images is not obvious, so the general methods of iris location are unable to realize the iris location. The method of the iris location based on Canny operator and gradient Hough transform is proposed. Firstly, the images are pre-processed; then, calculating the gradient information of images, the inner and outer edges of iris are coarse positioned using Canny operator; finally, according to the gradient Hough transform to realize precise localization of the inner and outer edge of iris. The experimental results show that our algorithm can achieve the localization of the inner and outer edges of the iris well, and the algorithm has strong anti-interference ability, can greatly reduce the location time and has higher accuracy and stability.
The status of Demodex cornei: description of the species and developmental stages, and data on demodecid mites in the domestic dog Canis lupus familiaris.

Science.gov (United States)

Izdebska, J N; Rolbiecki, L

2018-03-30

Demodecosis canina is one of the most important dog parasitoses, but its aetiology is still not well known. There are currently two known species of demodecid mite specific to the domestic dog Canis lupus familiaris Linnaeus, 1758 (Carnivora: Canidae). These are Demodex canis Leydig, 1859 (Acariformes: Demodecidae) and Demodex injai Desch & Hillier, 2003. There have also been many reports of the so-called 'short form', considered to be a separate species functioning under the name Demodex cornei nomen nudum, for which, however, no formal valid description has been documented. Taxonomic analysis of short forms of dog demodecid mites, associated with the stratum corneum, was performed, in line with the taxonomic criteria of Demodecidae systematics. This form was found to be a distinct species with features that differ from those of the other known species of this family. The species, including the adult and immature stages, is described. It is likely that different Demodex species parasitizing the domestic dog may be responsible for differentiated symptoms and different courses of demodecosis. However, the basis for clarifying this issue should be the correct, unambiguous identification of the species causing parasitosis. © 2018 The Royal Entomological Society.
Improvement and implementation for Canny edge detection algorithm

Science.gov (United States)

Yang, Tao; Qiu, Yue-hong

2015-07-01

Edge detection is necessary for image segmentation and pattern recognition. In this paper, an improved Canny edge detection approach is proposed due to the defect of traditional algorithm. A modified bilateral filter with a compensation function based on pixel intensity similarity judgment was used to smooth image instead of Gaussian filter, which could preserve edge feature and remove noise effectively. In order to solve the problems of sensitivity to the noise in gradient calculating, the algorithm used 4 directions gradient templates. Finally, Otsu algorithm adaptively obtain the dual-threshold. All of the algorithm simulated with OpenCV 2.4.0 library in the environments of vs2010, and through the experimental analysis, the improved algorithm has been proved to detect edge details more effectively and with more adaptability.
Threshold-adaptive canny operator based on cross-zero points

Science.gov (United States)

Liu, Boqi; Zhang, Xiuhua; Hong, Hanyu

2018-03-01

Canny edge detection[1] is a technique to extract useful structural information from different vision objects and dramatically reduce the amount of data to be processed. It has been widely applied in various computer vision systems. There are two thresholds have to be settled before the edge is segregated from background. Usually, by the experience of developers, two static values are set as the thresholds[2]. In this paper, a novel automatic thresholding method is proposed. The relation between the thresholds and Cross-zero Points is analyzed, and an interpolation function is deduced to determine the thresholds. Comprehensive experimental results demonstrate the effectiveness of proposed method and advantageous for stable edge detection at changing illumination.
La gender diversity nelle aziende familiari italiane: Una risorsa da valorizzare

OpenAIRE

D. Montemerlo; P. Profeta

2009-01-01

Questo articolo ha per oggetto la diversity relazionale di genere nelle imprese familiari italiane di medie e grandi dimensioni, misurata in termini di presenza femminile. Qual è lo stato effettivo della diversity di genere nelle aziende familiari medie e grandi, con riguardo non solo alle posizioni di imprenditore – capo azienda ma anche agli altri ruoli chiave della proprietà, del consiglio di amministrazione e del top management? La diversity di genere varia in funzione di caratteris...
Rosa canina Extracts Have Antiproliferative and Antioxidant Effects on Caco-2 Human Colon Cancer.

Directory of Open Access Journals (Sweden)

Sandra Jiménez

Full Text Available The in vitro antiproliferative and antioxidant effects of different fractions of Rosa canina hips on human colon cancer cell lines (Caco-2 was studied. The compounds tested were total extract (fraction 1, vitamin C (fraction 2, neutral polyphenols (fraction 3 and acidic polyphenols (fraction 4. All the extracts showed high cytotoxicity after 72 h, both low and high concentrations. The flow cytometric analysis revealed that all the fractions produce disturbances in the cell cycle resulting in a concomitant cell death by an apoptotic pathway. Changes in the redox status of Caco-2 cells in response to Rosa canina hips were determined. Cells were exposed to hydrogen peroxide in presence of plant fractions and the production of Reactive Oxygen Species (ROS was significantly decreased. Therefore, our data demonstrate that rosehip extracts are a powerful antioxidant that produces an antiproliferative effect in Caco-2 cells. Therefore, these results predict a promising future for Rosa canina as a therapeutic agent. Thus, this natural plant could be an effective component of functional foods addressed towards colorectal carcinoma.
Toxoplasmose em animais silvestres e domésticos da região de Botucatu, estado de São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Ednir Salata

1985-02-01

Full Text Available Os Autores analisaram soros de 47 Cannis familiaris, de 9 Felis cattus, de 64 Didelphis marsupialis aurita, de 9 Dasypus novemcinctus, de 4 Cabassous tatouay e de 29 Rattus rattus, através da reação de imunofluorescência indireta, para pesquisar a presença de anticorpos anti Toxoplasma gondii. Estes foram encontrados apenas em C. familiaris (63,8% e em D. m. aurita (4,7%. Frente aos resultados obtidos, os Autores sugerem que novas pesquisas nesta área sejam realizadas, para que se conheça melhor a importância epidemiológica de várias espécies animais na disseminação da toxoplasmose.
Canny Edge Detection in Cross-Spectral Fused Images

Directory of Open Access Journals (Sweden)

Patricia Suárez

2017-02-01

Full Text Available Considering that the images of different spectra provide an ample information that helps a lo in the process of identification and distinction of objects that have unique spectral signatures. In this paper, the use of cross-spectral images in the process of edge detection is evaluated. This study aims to assess the Canny edge detector with two variants. The first relates to the use of merged cross-spectral images and the second the inclusion of morphological filters. To ensure the quality of the data used in this study the GQM (Goal-Question- Metrics, framework, was applied to reduce noise and increase the entropy on images. The metrics obtained in the experiments confirm that the quantity and quality of the detected edges increases significantly after the inclusion of a morphological filter and a channel of near infrared spectrum in the merged images.
CanisOme--The protein signatures of Canis lupus familiaris diseases.

Science.gov (United States)

Fernandes, Mónica; Rosa, Nuno; Esteves, Eduardo; Correia, Maria José; Arrais, Joel; Ribeiro, Paulo; Vala, Helena; Barros, Marlene

2016-03-16

Although the applications of Proteomics in Human Biomedicine have been explored for some time now, in animal and veterinary research, the potential of this resource has just started to be explored, especially when companion animal health is considered. In the last years, knowledge on the Canis lupus familiaris proteome has been accumulating in the literature and a resource compiling all this information and critically reviewing it was lacking. This article presents such a resource for the first time. CanisOme is a database of all proteins identified in Canis lupus familiaris tissues, either in health or in disease, annotated with information on the proteins present on the sample and on the donors. This database reunites information on 549 proteins, associated with 63 dog diseases and 33 dog breeds. Examples of how this information may be used to produce new hypothesis on disease mechanisms is presented both through the functional analysis of the proteins quantified in canine cutaneous mast cell tumors and through the study of the interactome of C. lupus familiaris and Leishmania infantum. Therefore, the usefulness of CanisOme for researchers looking for protein biomarkers in dogs and interested in a comprehensive analysis of disease mechanisms is demonstrated. This paper presents CanisOme, a database of proteomic studies with relevant protein annotation, allowing the enlightenment of disease mechanisms and the discovery of novel disease biomarkers for C. lupus familiaris. This knowledge is important not only for the improvement of animal health but also for the use of dogs as models for human health studies. Copyright © 2016 Elsevier B.V. All rights reserved.

Locating An IRIS From Image Using Canny And Hough Transform

Directory of Open Access Journals (Sweden)

Poorvi Bhatt

2017-11-01

Full Text Available Iris recognition a relatively new biometric technology has great advantages such as variability stability and security thus it is the most promising for high security environments. The proposed system here is a simple system design and implemented to find the iris from the image using Hough Transform Algorithm. Canny Edge detector has been used to get edge image to use it as an input to the Hough Transform. To get the general idea of Hough Transform the Hough Transform for circle is also implemented. RGB value of 3-D accumulator array of peaks of inner circle and outer circle has been performed. And at the end some suggestions are made to improve the system and performance gets discussed.
Leptospira interrogans en una población canina del Gran Buenos Aires: variables asociadas con la seropositividad

OpenAIRE

Rubel Diana; Seijo Alfredo; Cernigoi Beatriz; Viale Alberto; Wisnivesky-Colli Cristina

1997-01-01

Se determinó la seroprevalencia de leptospirosis en una población canina suburbana con el objeto de analizar la asociación entre distintas variables individuales y ambientales y la seropositividad a leptospirosis. El estudio, de diseño transversal, se llevó a cabo durante julio de 1992 en un barrio del Gran Buenos Aires en el que viven unos 9 500 habitantes y una población canina de unos 2 000 animales. Se estudió una muestra aleatoria de 223 perros, de cada uno de los cuales se obtuvo una mu...
Comparative study of biological activities and phytochemical composition of two rose hips and their preserves: Rosa canina L. and Rosa arvensis Huds.

Science.gov (United States)

Nađpal, Jelena D; Lesjak, Marija M; Šibul, Filip S; Anačkov, Goran T; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N

2016-02-01

The aim of this study was to compare phenolic profile, vitamin C content, antioxidant, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of two Rosa species: renowned Rosa canina L. and unexplored Rosa arvensis Huds. The liquid chromatography-tandem mass spectrometry analysis of 45 phenolics resulted in quantification of 14 compounds, with quercitrin, gallic and protocatechuic acids as the most dominant. High antioxidant potential of R. canina and a moderate activity of R. arvensis extracts were determined through several assays. Purée of both species and methanol extract of air-dried R. canina hips showed some anti-inflammatory (cyclooxygenase-1 and 12-lipooxygense inhibition potency) activity. Purée of R. canina exerted cytotoxic activity only against the HeLa cell line among several others (HeLa, MCF7, HT-29 and MRC-5). The presented results support traditional use of rose hips and their fruit preserves as food with health and nutritional benefits. Copyright © 2015 Elsevier Ltd. All rights reserved.
Resposta imune celular na vacinação anti-rábica canina

Directory of Open Access Journals (Sweden)

Jorge Timenetsky

1985-02-01

Full Text Available Os Autores estudaram a resposta imune celular e os níveis de anticorpos na vacinação e re-vacinação canina. A vacina utilizada foi a Fuenzalida & Palacios, empregada rotineiramente na imunização humana e canina, no Brasil. A avaliação da resposta mediada por células foi feita por testes de inibição de migração de leucócitos periféricos. Os níveis de anticorpos foram determinados por provas de soro-neutralização e fixação do complemento. Os cinco cães envolvidos no experimento receberam um esquema inicial de 5 doses e uma dose de reforço 210 dias após. Todos os animais exibiram níveis moderados de anticorpos após o esquema inicial e uma nítida resposta secundária após o reforço. A resposta imune celular, contudo, ocorreu apenas após a imunização inicial, não sendo detectada em resposta à dose de reforço. Concluem os Autores que a resposta imune celular ocorre na primo-vacinação anti-rábica canina nas condições experimentais empregadas e que embora a resposta secundária não tenha sido obtida neste estudo sua existência não pode ser descartada e deve ser reestudada em outras condições.
Distribuição espacial e temporal da raiva canina e felina em Minas Gerais, 2000 a 2006

OpenAIRE

Barbosa, A.D.; Silva, J.A.; Moreira, E.C.; Meneses, J.N.C.; Magalhães, D.F.; Menezes, F.L.; Oliveira, C.S.F.

2008-01-01

Estudou-se a epidemiologia da raiva em cães e gatos, em Minas Gerais, e realizou-se um estudo descritivo de seu comportamento, de 2000 a 2006. Utilizaram-se, como fonte de dados, os relatórios mensais dos laboratórios do Centro de Controle de Zoonoses de Belo Horizonte e do Instituto Mineiro de Agropecuária. Os resultados demonstraram positividade de 1,5% para raiva canina e 0,7% para raiva felina. Houve tendência ao decréscimo do número de casos positivos de raiva canina (y = -3,2143x + 19,7...
Rabia canina en san Juan de Lurigancho y en Jicamarca

OpenAIRE

Días, Albina; Condori, René Edgar

2004-01-01

Hasta la tercera semana de noviembre se han confirmado cuatro casos de rabia canina en la DISA Lima Norte, el último caso se presentó el 20 de noviembre en la granja porcina «Pradera del Paraíso» en el distrito de San Juan de Lurigancho (SJL), perteneciente a la referida Dirección de Salud. Dicho caso sucedió en momentos que un trabajador de la granja trató de separar la pelea entre los perros guardianes de la granja y un perro de origen desconocido, siendo finalmente mordido en una de...
Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.)

DEFF Research Database (Denmark)

Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise

2011-01-01

A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis and...
Uso do fluralaner no tratamento da demodicidose canina juvenil generalizada: relato de caso

Directory of Open Access Journals (Sweden)

J.A.B. Bezerra

Full Text Available RESUMO O objetivo do presente trabalho foi relatar a eficácia do fluralaner no tratamento da demodicidose juvenil generalizada canina. Dois caninos, apresentando dois e três meses de idade, com diagnóstico clínico e parasitológico de demodicidose generalizada, foram tratados com administração única de fluralaner, na dose recomendada em bula pelo fabricante. Além disso, foi realizada a terapia adjuvante à base de xampu de peróxido de benzoíla e domperidona. Observou-se uma resposta terapêutica satisfatória, com repilação completa ao 30º dia após a administração do fármaco. Para cada paciente, foi realizado exame parasitológico do raspado cutâneo aos 75 e 90 dias seguintes ao início do tratamento, e todos foram negativos. Tendo em vista a elevada eficácia do tratamento proposto, sugere-se a inclusão do fluralaner nos protocolos terapêuticos destinados à demodicidose canina, particularmente nos pacientes pediátricos e com a forma generalizada da doença.
Surreal and Canny Selves: Photographic Figures in Claude Cahun

Directory of Open Access Journals (Sweden)

Gayle Zachmann

2003-06-01

Full Text Available In her 1975 essay, Le Rire de la méduse , Hélène Cixous enthusiastically announced that it was high time for women to enter into discourse. A full half-century earlier, Claude Cahun (1894-1954, a powerful writer and a haunting photographer and artist, was already inscribing herself, Woman, and a woman's voice in visual and verbal self-portraits, photomontages, prose texts, poetry, and aesthetic and political treatises. Cahun's uncanny interventions in both verbal and visual discourse cannily interrogate conventions of literary and pictorial representation and the constructions of self, gender and culture that they exhibit. Insistently asking readers and spectators, "What's wrong with this picture?," her carnivalesque play with the doxa and the politics of identity, destabilizes not only gender and genre norms, but the boundaries and distinctions between visual and verbal representation. Surreal and Canny Selves explores the aesthetic frameworks of writer/artist Claude Cahun. Elucidating how Cahun's questioning of her self and Surrealist representations of woman were part of a much more expansive adventure that questioned more than femininity—the manuscript moves on to trace how and what Cahun's foregrounding of figuration and, more specifically, photographic figuration, might signify for the uncanny aesthetic practices deployed in the hybrid text Aveux non avenus .
Multiple and asymmetrical origin of polyploid dog rose hybrids (Rosa L. sect. Caninae (DC.) Ser.) involving unreduced gametes.

Science.gov (United States)

Herklotz, V; Ritz, C M

2017-08-01

Polyploidy and hybridization are important factors for generating diversity in plants. The species-rich dog roses ( Rosa sect. Caninae ) originated by allopolyploidy and are characterized by unbalanced meiosis producing polyploid egg cells (usually 4 x ) and haploid sperm cells (1 x ). In extant natural stands species hybridize spontaneously, but the extent of natural hybridization is unknown. The aim of the study was to document the frequency of reciprocal hybridization between the subsections Rubigineae and Caninae with special reference to the contribution of unreduced egg cells (5 x ) producing 6 x offspring after fertilization with reduced (1 x ) sperm cells. We tested whether hybrids arose by independent multiple events or via a single or few incidences followed by a subsequent spread of hybrids. Population genetics of 45 mixed stands of dog roses across central and south-eastern Europe were analysed using microsatellite markers and flow cytometry. Hybrids were recognized by the presence of diagnostic alleles and multivariate statistics were used to display the relationships between parental species and hybrids. Among plants classified to subsect. Rubigineae , 32 % hybridogenic individuals were detected but only 8 % hybrids were found in plants assigned to subsect. Caninae . This bias between reciprocal crossings was accompanied by a higher ploidy level in Rubigineae hybrids, which originated more frequently by unreduced egg cells. Genetic patterns of hybrids were strongly geographically structured, supporting their independent origin. The biased crossing barriers between subsections are explained by the facilitated production of unreduced gametes in subsect. Rubigineae . Unreduced egg cells probably provide the highly homologous chromosome sets required for correct chromosome pairing in hybrids. Furthermore, the higher frequency of Rubigineae hybrids is probably influenced by abundance effects because the plants of subsect. Caninae are much more abundant
[Diphyllobothrium pacificum (Nybelin,1931) margolis, 1956 in Canis familiaris from Chincha city, Peru].

Science.gov (United States)

Cabrera, R; Tantaleán, M; Rojas, R

2001-01-01

In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast.
Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

Directory of Open Access Journals (Sweden)

Carine Fernandes B.

2012-08-01

Full Text Available Objetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquímica la técnica de la avidina- biotina- peroxidasa, con utilización del anticuerpo monoclonal 32-2B (anti-desmogléina-1. Resultados. A los estudios histológicos y morfológicos las células de la glándula mamaria normal humana demostraron semejanzas con las células de la glándula mamaria normal canina. Se observó adhesión y proliferación de células normales en ambas especies por aproximadamente tres meses de cultivo. Las células normales de las especies humana y canina mostraron baja actividad de proliferación cuando se compararon con las cancerosas de las especies en estudio. Los grupos de células epiteloides que se adhirieron al sustrato de los dos cultivos tuvieron dependencia de las células estromales, porque en la medida que las células fibroblastoides se retiraron, las células epiteloides detuvieron su crecimiento. Conclusiones. Comparando los resultados obtenidos por medio de análisis inmuno-histoquímico de células normales de mujeres y perras fue posible observar cambios en el patrón de coloración en células cancerosas en ambas especies, demostrando que las estructuras relacionadas con la adhesión celular (desmosomas pueden estar alteradas.
Enteric Parasitic in canines (Canis familiaris in the urban area of Coroico, Nor Yungas department of La Paz Bolivia

Directory of Open Access Journals (Sweden)

Llanos Mariana

2010-10-01

Full Text Available A wide variety species of intestinal protozoa and helminthes are pathogen for the domestic animals. Between April and November 2009, a study was done with the purpose of determining the enteric parasitic infection in dogs (Cannis familiaris, 96 dogs (58 males and 38 females with owner of 10 species, one hybrid, eight age groups in two seasons of the urban area of the Coroico town, Nor Yungas, department of La Paz, Bolivia. The coproparasitology diagnostic was made by direct examination, with the Willis-Molloy flotation simple technique with a solution oversaturated of sodium chloride. It was detected one or more species of helminthes and protozoa, was used the chi-square and descriptive method for the statistical analysis. The results were: from the 96 sampled dogs, in 87% is present at less one type of parasitic shape, were identify: Ancylostoma spp, Toxocara canis, Strogyloides spp, Giardia spp, Isospora canis, Trichuris vulpis, Ancylostoma spp/Uncinaria spp and Dipylidium caninum. The evaluation by season show a (p ≤ 0,05 for the Giardia spp. In a humidity season, but not for a dry season, the rest of parasites can be found in both seasons. By sex in a humidity season T.canis in females 43% and 22% in males, in dry season by sex was found T.vulpis in female with a high frequency (p ≤ 0,05, the rest of parasites do not show statistic differences in both seasons. By age in dry season T. canis and Stronyiloides sp. prevails 1-24 months and 49-72 months respectively, in a humidity season T. canis prevails in the same age (p ≤ 0,05. By race in dry season Ancylostoma spp Uncinaria spp prevails in the race Pekingese, in humidity season Strongyloides sp prevails in the Cocker race. Prevail in both seasons A. canis y T. canis. In relation to the mono-parasitism and multi-parasitism, was viewed, in both seasons the dogs multi-parasitism are more than the mono-parasitism.
Isolation of immunomodulatory triterpene acids from a standardized rose hip powder (Rosa canina L.).

Science.gov (United States)

Saaby, Lasse; Jäger, Anna Katharina; Moesby, Lise; Hansen, Erik Wind; Christensen, Søren Brøgger

2011-02-01

A previously published systematic review and a metaanalysis have concluded that the consumption of standardized rose hip powder (Rosa canina L.) can reduce pain in osteoarthritis patients. Synovial inflammation has been suggested to play an important role in the pathogenesis of osteoarthritis and mainly to involve infiltration of the synovial membrane by macrophages. Therefore, the immunomodulatory effect of standardized rose hip powder of Rosa canina L. was investigated and active principles isolated using the Mono Mac 6 cell line as a model for human macrophages. Treatment of Mono Mac 6 cells with the residue of a crude dichloromethane extract of rose hip powder significantly and concentration dependently inhibited the lipopolysaccharide induced interleukin-6 release. Through bioassay-guided fractionation the immunomodulatory effect of the dichloromethane extract was correlated to a mixture of three triterpene acids; oleanolic acid, betulinic acid and ursolic acid (IC(50) 21 ± 6 µm). Further studies revealed that only oleanolic acid and ursolic acid, but not betulinic acid, could inhibit the lipopolysaccharide induced interleukin-6 release from Mono Mac 6 cells when tested separately. Combination of either oleanolic acid or ursolic acid with betulinic acid enhanced the immunomodulatory effect of the two triterpene acids. Copyright © 2010 John Wiley & Sons, Ltd.
Susceptibilidad canina a rabia después de una campaña de vacunación en zonas endémicas del Perú

OpenAIRE

Ricardo López I; Albina Díaz O; Edgar Condori C

2007-01-01

Objetivo: Determinar el nivel de la respuesta inmune posterior a una campaña de vacunación antirrábica canina en dos zonas que han presentado en los últimos años casos de rabia canina. Materiales y métodos: Se realizó una encuesta serológica, en 101 y 199 canes localizados en los distritos de Tambo Grande (Piura) y Juliaca (Puno) respectivamente y se efectuó la prueba del seroneutralización en ratón para determinar la proporción de canes con anticuerpos protectores (¡Ý 0,5 UI/mL) según zona d...
The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls: A prospective cohort study

DEFF Research Database (Denmark)

Kirkeskov, Bente; Christensen, Robin; Bügel, Susanne Gjedsted

2011-01-01

OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains antioxid......OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains...
AVALIAÇÃO DE INICIADORES E PROTOCOLO PARA O DIAGNÓSTICO DA PANCITOPENIA TROPICAL CANINA POR PCR

Directory of Open Access Journals (Sweden)

Daniel C. L. Linhares

2006-10-01

Full Text Available Este trabalho foi desenvolvido com o objetivo de padronizar um protocolo para a reação em cadeia da polimerase (PCR e selecionar oligonucleotídeos iniciadores para a detecção específica de Ehrlichia canis, em uma única etapa de reação. Inicialmente foram obtidas seqüências depositadas no Genbank, referentes ao gene que codifica o 16S rRNA das espécies E. canis (número de acesso = AF162860, E. ewingii (U96436, E. platys (AF1567844, E. chaffeensis, (U86665, E. phagocytophila genogrupo (U02521, E. bovis (AF294789 e E. risticii (M21290, as quais foram submetidas ao alinhamento genético para a construção dos iniciadores. Do alinhamento foi selecionado, a partir de uma região semiconservada, um iniciador específico para E. canis, designado EBR1 (5’-cctctggctataggaaattg- 3’ e, de uma região conservada, um iniciador genérico EBR5 (5’-ggagtgcttaacgcgttag- 3’. Paralelamente foram obtidas amostras de sangue de dez cães que apresentavam infecção aguda por E. canis, confirmado pela presença de mórulas intracitoplasmáticas, características da riquétsia, em células mononucleares sangüíneas. O DNA genômico extraído dessas amostras foi utilizado para a avaliação da reação de PCR, empregando-se um protocolo adaptado de outros autores e o par de oligos EBR1/EBR5, selecionado neste trabalho. A reação de PCR apresentou resultados positivos para os 10 isolados de E. canis, amplificando o fragmento esperado de 765 pares de bases do gene 16S rRNA. Resultados negativos verificados nas reações de PCR para amostras de DNA genômico de Babesia canis, Hepatozoon canis, Haemobartonella sp., Trypanosoma evansi e do hospedeiro (Canis familiaris livre de infecção indicaram a segurança do método quanto à especificidade para a discriminação de E. canis. PALAVRAS-CHAVE: Cães, Ehrlichia canis, erliquiose canina, hemoparasitose, reação em cadeia da polimerase
Proyecciones de rabia canina en Argentina, Bolivia y Paraguay, usando series de tiempo

OpenAIRE

SCORTTI, M.; CATTAN, P.; CANALS, M.

1997-01-01

Se estudió el número de casos mensuales de rabia canina en Argentina (1971-1993), Bolivia (1987-1993) y Paraguay (1976-1993), a fin de identificar fluctuaciones regulares y predecir el comportamiento futuro de la rabia en dichos países. Los métodos empleados consistieron en análisis de series de tiempo, incluyendo el análisis armónico de Fourier y los modelos multiplicativos ARIMA-SARIMA de Box-Jenkins. Se evidenciaron ciclos en Argentina y Paraguay. La estacionalidad ocurrió a fines de invie...
Diphyllobothrium pacificum (Nybelin, 1931) Margolis, 1956 en Canis familiaris de la ciudad de Chincha, Perú

OpenAIRE

Cabrera, Ch; Tantaleán V, Manuel; Rojas M, Ricardo

2001-01-01

In this communication is presented the finding of the tapeworm Diphyllobothrium pacificum, parasite of sea lions, in Canis familiaris (dog) in Chincha city, Peru. This is the first canine infection with D. pacificum in the South Peruvian coast
Fungal lectin of Peltigera canina induces chemotropism of compatible Nostoc cells by constriction-relaxation pulses of cyanobiont cytoskeleton.

Science.gov (United States)

Díaz, Eva Maria; Vicente-Manzanares, Miguel; Sacristan, Mara; Vicente, Carlos; Legaz, Maria-Estrella

2011-10-01

A glycosylated arginase acting as a fungal lectin from Peltigera canina is able to produce recruitment of cyanobiont Nostoc cells and their adhesion to the hyphal surface. This implies that the cyanobiont would develop organelles to motility towards the chemoattractant. However when visualized by transmission electron microscopy, Nostoc cells recently isolated from P. canina thallus do not reveal any motile, superficial organelles, although their surface was covered by small spindles and serrated layer related to gliding. The use of S-(3,4-dichlorobenzyl)isothiourea, blebbistatin, phalloidin and latrunculin A provide circumstantial evidence that actin microfilaments rather than MreB, the actin-like protein from prokaryota, and, probably, an ATPase which develops contractile function similar to that of myosin II, are involved in cell motility. These experimental facts, the absence of superficial elements (fimbriae, pili or flagellum) related to cell movement, and the appearance of sunken cells during of after movement verified by scanning electron microscopy, support the hypothesis that the motility of lichen cyanobionts could be achieved by contraction-relaxation episodes of the cytoskeleton induced by fungal lectin act as a chemoattractant.

Rose hip (Rosa canina L: A functional food perspective

Directory of Open Access Journals (Sweden)

Cui Fan

2014-12-01

Full Text Available Rose hip (Rosa canina L. is the pseudo-fruit of the rose plant, which is widely known as a valuable source of polyphenols and vitamin C. Both in vivo and in vitro studies have demonstrated that this fruit exhibits anti-inflammatory, antioxidant, and antiobesogenic activities. The health benefits of Rose hip (RH have been attributed to its wide range of bioactive compounds including the anti-inflammatory galactolipid: (2S-1,2-di-O-[(9Z,12Z,15Z-octadeca-9,12,15-trienoyl]-3-O-β-D galactopyranosyl glycerol (GOPO, vitamin C, phenolics, lycopene, lutein, zeaxanthin, and other carotenoids. As cyclooxygenase inhibitors, RH compounds may reduce the risk of cancer, heart disease, and various inflammatory conditions. The aim of this review is to present an overview of the functional, medical, and physiological properties of RH.
Cross-sectional study of object permanence in domestic puppies (Canis familiaris).

Science.gov (United States)

Gagnon, S; Doré, F Y

1994-09-01

Visual accommodation and object permanence tests were administered to 70 puppies (Canis familiaris), aged 4 weeks to 9 months. The results showed that understanding of visible displacement problems emerged at the 5th weeks and developed rapidly until the 8th week. Although the search behaviors of older puppies were more flexible, no further significant development was observed between 8 weeks and 9 months. The results on invisible displacement tests suggest that understanding of invisible displacement problems appears around the 1st year in dogs' development.
EHRLICHIOSIS CANINA | CANINE EHRLICHIOSIS

Directory of Open Access Journals (Sweden)

Clara Nancy Gutiérrez

2016-10-01

Full Text Available La ehrlichiosis canina es una enfermedad infecciosa emergente transmitida por garrapatas, producida por Ehrlichia spp. (Proteobacteria: Ricketsiales, la cual afecta a miembros de la familia Canidae. Los agentes etiológicos son bacterias Gram negativas, intracelulares obligatorias, redondeadas y pleomórficas, esto último especialmente en cultivos celulares. Estas bacterias se localizan en vacuolas rodeadas de membranas (mórulas en el citoplasma de células sanguíneas y dependiendo de la especie, tienen tropismo por linfocitos, monocitos y granulocitos. Históricamente la enfermedad es endémica en regiones tropicales y subtropicales, pero se reporta cada vez más en regiones de clima templado. Ello puede atribuirse a varios factores, los cuales incluyen el mejoramiento en las herramientas de diagnóstico, los cambios ambientales y climáticos (calentamiento global que influyen directamente en la distribución de las garrapatas y la gran cantidad de viajes con mascotas de un lugar a otro del planeta, lo cual ha contribuido al establecimiento de esta enfermedad en áreas no endémicas. Es común la presencia de coinfección con otros patógenos transmitidos por garrapatas y esto complica la patogénesis, las manifestaciones clínicas, el diagnóstico y el tratamiento. Frecuentemente, el patógeno no puede ser eliminado por completo a pesar de la terapia con antibióticos y la resolución de los signos clínicos. Actualmente, no se dispone de una vacuna, por lo que el uso de ectoparasiticidas resulta ser una buena opción para la prevención de la enfermedad. Esta enfermedad constituye un problema en medicina veterinaria y el potencial zoonótico de estos agentes es una consideración de gran relevancia para la salud humana.
HARDWARE REALIZATION OF CANNY EDGE DETECTION ALGORITHM FOR UNDERWATER IMAGE SEGMENTATION USING FIELD PROGRAMMABLE GATE ARRAYS

Directory of Open Access Journals (Sweden)

ALEX RAJ S. M.

2017-09-01

Full Text Available Underwater images raise new challenges in the field of digital image processing technology in recent years because of its widespread applications. There are many tangled matters to be considered in processing of images collected from water medium due to the adverse effects imposed by the environment itself. Image segmentation is preferred as basal stage of many digital image processing techniques which distinguish multiple segments in an image and reveal the hidden crucial information required for a peculiar application. There are so many general purpose algorithms and techniques that have been developed for image segmentation. Discontinuity based segmentation are most promising approach for image segmentation, in which Canny Edge detection based segmentation is more preferred for its high level of noise immunity and ability to tackle underwater environment. Since dealing with real time underwater image segmentation algorithm, which is computationally complex enough, an efficient hardware implementation is to be considered. The FPGA based realization of the referred segmentation algorithm is presented in this paper.
Aspectos epidemiológicos da dirofilariose canina no perímetro urbano de Cuiabá, Mato Grosso: emprego do "Immunoblot" e do teste de Knott modificado

Directory of Open Access Journals (Sweden)

Cláudia Gorgulho Nogueira Fernandes

2000-12-01

Full Text Available O presente trabalho refere-se a pesquisa dos aspectos epidemiológicos da dirofilariose canina no perímetro urbano de Cuiabá, através de exame de sangue e sorologia. Examinou-se o sangue de 822 cães: em 11,81% das amostras, detectaram-se, por meio de "Immunoblot", anticorpos contra antígenos de Dirofilaria immitis adulto, enquanto em 0,41% foram encontradas, por meio do teste de Knott modificado, microfilárias de D. immitis. A prevalência da dirofilariose canina em Cuiabá, no período de junho a novembro de 1997, e com a metodologia aplicada, foi de 120,8 casos em cada 1.000 animais. O "Immunoblot" diagnosticou como positivas 11,27% das amostras que estavam consideradas negativas pelo teste de Knott modificado. Os autores analisaram estatisticamente informações sobre raça, sexo, idade e região administrativa de origem dos cães pesquisados. Foi questionada a possibilidade de que os animais pesquisados tivessem viajado a regiões endêmicas, usado microfilaricidas, ou apresentado sintomatologia compatível, bem como estudadas as características ecológicas do local de moradia. Cães com idade variando entre um e nove anos e residentes na região Centro-Oeste apresentaram maior índice de positividade. A maioria não apresentava sintomatologia compatível com a doença, não tinha história clínica do uso de microfilaricidas e/ou preventivos contra dirofilariose canina e nunca havia saído do perímetro urbano de Cuiabá, mas residiam em bairros próximos a rios ou córregos e/ou em casas contíguas a áreas de vegetação nativa. Pela primeira vez, o "Immunoblot" foi empregado no diagnóstico de dirofilariose canina no Brasil.
Production, crystallization and preliminary X-ray diffraction analysis of the allergen Can f 2 from Canis familiaris

International Nuclear Information System (INIS)

Madhurantakam, Chaithanya; Nilsson, Ola B.; Jönsson, Klas; Grönlund, Hans; Achour, Adnane

2009-01-01

The recombinant form of the allergen Can f 2 from C. familiaris was produced, isolated and crystallized in two different forms. Preliminary X-ray diffraction analyses are reported for the two crystal forms of Can f 2. The allergen Can f 2 from dog (Canis familiaris) present in saliva, dander and fur is an important cause of allergic sensitization worldwide. Here, the production, isolation, crystallization and preliminary X-ray diffraction analysis of two crystal forms of recombinant Can f 2 are reported. The first crystal form belonged to space group C222, with unit-cell parameters a = 68.7, b = 77.3, c = 65.1 Å, and diffracted to 1.55 Å resolution, while the second crystal form belonged to space group C2, with unit-cell parameters a = 75.7, b = 48.3, c = 68.7 Å, β = 126.5°, and diffracted to 2.1 Å resolution. Preliminary data analysis indicated the presence of a single molecule in the asymmetric unit for both crystal forms
Prevalência de hepatozoonose canina no município de Areia, Paraíba, Brasil

Directory of Open Access Journals (Sweden)

Maria das Graças da Silva Bernardino

2016-02-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2016v29n1p175 A hepatozoonose canina é uma doença parasitária de caráter debilitante, imunossupressora e de difícil diagnóstico clínico. A prevalência da doença em cães já foi descrita em vários estados brasileiros, todavia na região Nordeste os estudos ainda são escassos. Em virtude disso, o trabalho objetivou determinar a prevalência da hepatozoonose canina no município de Areia, Paraíba, Brasil. Os cães foram examinados clinicamente e foram colhidas amostras de sangue circulante e periférico (ponta de orelha. Das 151 amostras analisadas, 9,3% dos cães foram positivos para Hepatozoon canis, a partir da visualização de gamontes parasitando neutrófilos. O grau de parasitemia variou de leve a intenso. As alterações hematológicas observadas foram diferentes entre os animais, não apresentando padrão de resposta à infecção. A forma subclínica foi observada em 50% dos cães e os demais apresentaram sinais clínicos inespecíficos. Conclui-se que há a ocorrência da hepatozoonose em cães da área urbana do município. Além disso, os cães infectados com H. canis apresentaram alterações hematológicas e sinais clínicos inespecíficos.
Prevalencia de anticuerpos contra leptospira en población urbana humana y canina del departamento del tolima

OpenAIRE

Romero, Marlyn H.; Sánchez, Jorge A.; Hayek, Linda C.

2012-01-01

Objetivo Determinar la seroprevalencia de anticuerpos contra Leptospira sp. y los serovares dominantes, en población urbana humana y canina de tres municipios del departamento del Tolima, Colombia. Materiales y Métodos Se realizó un estudio epidemiológico trasversal con selección de sujetos por conveniencia en 62 barrios. Se obtuvieron muestras de 850 personas.y 850 caninos durante los meses de junio, julio y agosto de 2007, las cuales fueron procesadas utilizando la prueba de microaglutinaci...
CISTICERCOSE (Cysticercus cellulosae CANINA GENERALIZADA

Directory of Open Access Journals (Sweden)

Eulógio Carlos Queiroz de Carvalho

2006-10-01

Full Text Available O complexo teníase-cisticercose tem enorme repercussão na saúde pública, não só no Brasil, mas também em várias regiões do mundo consideradas em desenvolvimento, corroborando, para tal, o baixo nível socioeconômico e cultural da população. O exame pos mortem de um cão errante (Canis familiaris sem história clínica, adulto, cedido para estudo às Faculdades Integradas do Planalto Central(FIPLAC, revelou lesões císticas disseminadas por todas as musculaturas estriadas cardíaca e esquelética. As lesões, que impressionavam pelo grande número, eram do estroma, continham líquido sob tensão e, transparentes, deixavam ver uma formação interna e opaca. Num exame microscópico “a fresco”, e por inclusão em parafina e colo-ração pela hematoxilina e eosina, essa formação possibilitou a caracterização de uma estrutura parasitária com quatro ventosas e uma coroa dupla de ganchos, estrutura própria do escólice do Cysticercus cellulosae, forma larvar da Taeniasolium. Embora um comprometimento de sistema nervoso tenha sido observado por outros autores, não se observaram tais lesões neste trabalho. PALAVRAS-CHAVE: Cysticercus cellulosae, cisticercose, canino, saúde publica.
The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls

DEFF Research Database (Denmark)

Nielsen, Bente Kirkeskov; Christensen, Robin; Bügel, Susanne Gjedsted

2011-01-01

OBJECTIVES: Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains antioxid...
Susceptibilidad canina a rabia después de una campaña de vacunación en zonas endémicas del Perú

Directory of Open Access Journals (Sweden)

Ricardo López I

2007-01-01

Full Text Available Objetivo: Determinar el nivel de la respuesta inmune posterior a una campaña de vacunación antirrábica canina en dos zonas que han presentado en los últimos años casos de rabia canina. Materiales y métodos: Se realizó una encuesta serológica, en 101 y 199 canes localizados en los distritos de Tambo Grande (Piura y Juliaca (Puno respectivamente y se efectuó la prueba del seroneutralización en ratón para determinar la proporción de canes con anticuerpos protectores (¡Ý 0,5 UI/mL según zona de estudio, antecedentes de vacunación, edad del perro y sexo. Resultados: Después de tres meses de la campaña antirrábica 32% del total de canes estuvieron protegidos adecuadamente, 66% tuvieron antecedentes de vacunación y 44% de los canes vacunados tenían anticuerpos ( 0,1 UI/mL. En Juliaca se encontró mayor protección, contra la rabia, que en Tambo Grande en los perros vacunados (51% frente a 34%, p<0,05. Los canes mayores de un año estaban más protegidos que los menores de un año (p<0,01, sin embargo el sexo del perro no tuvo relación con la protección (p0,05. Conclusiones: Existe una deficiente protección inmune contra la rabia en los distritos de Tambo Grande y Juliaca, lo cual hace estas zonas muy susceptibles a desarrollar brotes de rabia canina.
Brazilian canine hepatozoonosis Hepatozoonose canina brasileira

Directory of Open Access Journals (Sweden)

Lucia Helena O'Dwyer

2011-09-01

Full Text Available The genus Hepatozoon includes hundreds of species that infect birds, reptiles, amphibians and mammals, in all continents with tropical and subtropical climates. Two species have been described in domestic dogs: H. canis, reported in Europe, Asia, Africa, South America and the United States; and H. americanum, which so far has only been diagnosed in the United States. In Brazil, the only species found infecting dogs is H. canis. The objective of this review was to detail some aspects of canine hepatozoonosis, caused by H. canis, and the main points of its biology, transmission, pathogenicity, symptoms, epidemiology and diagnostic methods, with emphasis on research developed in Brazil.O gênero Hepatozoon compreende centenas de espécies que infectam aves, répteis, anfíbios e mamíferos, em todos os continentes de clima tropical e subtropical. No cão doméstico duas espécies são descritas, H. canis e H. americanum; a primeira presente na Europa, Ásia, África, América do Sul e nos Estados Unidos da América do Norte (EUA, e a segunda, diagnosticada até o momento somente nos EUA. No Brasil, a espécie que infecta o cão foi caracterizada como H. canis. Esta revisão objetiva detalhar alguns aspectos da hepatozoose canina, causada pelo H. canis e principais pontos de biologia, transmissão, patogenia e sintomas, epidemiologia e métodos de diagnóstico, enfatizando as pesquisas desenvolvidas no Brasil.
Canis familiaris As a Model for Non-Invasive Comparative Neuroscience.

Science.gov (United States)

Bunford, Nóra; Andics, Attila; Kis, Anna; Miklósi, Ádám; Gácsi, Márta

2017-07-01

There is an ongoing need to improve animal models for investigating human behavior and its biological underpinnings. The domestic dog (Canis familiaris) is a promising model in cognitive neuroscience. However, before it can contribute to advances in this field in a comparative, reliable, and valid manner, several methodological issues warrant attention. We review recent non-invasive canine neuroscience studies, primarily focusing on (i) variability among dogs and between dogs and humans in cranial characteristics, and (ii) generalizability across dog and dog-human studies. We argue not for methodological uniformity but for functional comparability between methods, experimental designs, and neural responses. We conclude that the dog may become an innovative and unique model in comparative neuroscience, complementing more traditional models. Copyright © 2017 Elsevier Ltd. All rights reserved.
Distribuição espacial e temporal da raiva canina e felina em Minas Gerais, 2000 a 2006 Spatial and temporal distribution of canine and feline rabies in Minas Gerais, Brazil, from 2000 to 2006

OpenAIRE

A.D. Barbosa; J.A. Silva; E.C. Moreira; J.N.C. Meneses; D.F. Magalhães; F.L. Menezes; C.S.F. Oliveira

2008-01-01

Estudou-se a epidemiologia da raiva em cães e gatos, em Minas Gerais, e realizou-se um estudo descritivo de seu comportamento, de 2000 a 2006. Utilizaram-se, como fonte de dados, os relatórios mensais dos laboratórios do Centro de Controle de Zoonoses de Belo Horizonte e do Instituto Mineiro de Agropecuária. Os resultados demonstraram positividade de 1,5% para raiva canina e 0,7% para raiva felina. Houve tendência ao decréscimo do número de casos positivos de raiva canina (y = -3,2143x + 19,7...
Canine hypertrophic osteopathy associated with extra-thoracic lesions Osteopatia hipertrófica canina associada com lesões extratorácicas

OpenAIRE

Selwyn Arlington Headley; Eduardo Alcântara Ribeiro; Gustavo José Von G. dos Santos; Carlos Maia Bettini; Ewaldo Mattos Júnior

2005-01-01

Canine hypertrophic osteopathy is described in a dog that presented extra-thoracic lesions, mainly in the liver. Hepatic lesions were characterized by necrosis, hemorrhage, severe hydropic degeneration of centrolobular hepatocytes, proliferation of epithelial cells of bile ducts, and mild biliary stasis. The disease syndrome was diagnosed based on clinical signs, radiological evaluation, and inspection of macerated bones.Osteopatia hipertrófica canina é descrita em um cão que apresentou lesõe...
Neuroprotective Effects of Herbal Extract (Rosa canina, Tanacetum vulgare and Urtica dioica) on Rat Model of Sporadic Alzheimer's Disease.

Science.gov (United States)

Daneshmand, Parvaneh; Saliminejad, Kioomars; Dehghan Shasaltaneh, Marzieh; Kamali, Koorosh; Riazi, Gholam Hossein; Nazari, Reza; Azimzadeh, Pedram; Khorram Khorshid, Hamid Reza

2016-01-01

Sporadic Alzheimer's Disease (SAD) is caused by genetic risk factors, aging and oxidative stresses. The herbal extract of Rosa canina (R. canina), Tanacetum vulgare (T. vulgare) and Urtica dioica (U. dioica) has a beneficial role in aging, as an anti-inflammatory and anti-oxidative agent. In this study, the neuroprotective effects of this herbal extract in the rat model of SAD was investigated. The rats were divided into control, sham, model, herbal extract -treated and ethanol-treated groups. Drug interventions were started on the 21(st) day after modeling and each treatment group was given the drugs by intraperitoneal (I.P.) route for 21 days. The expression levels of the five important genes for pathogenesis of SAD including Syp, Psen1, Mapk3, Map2 and Tnf-α were measured by qPCR between the hippocampi of SAD model which were treated by this herbal extract and control groups. The Morris Water Maze was adapted to test spatial learning and memory ability of the rats. Treatment of the rat model of SAD with herbal extract induced a significant change in expression of Syp (p=0.001) and Psen1 (p=0.029). In Morris Water Maze, significant changes in spatial learning seen in the rat model group were improved in herbal-treated group. This herbal extract could have anti-dementia properties and improve spatial learning and memory in SAD rat model.
Book review. Conoscere gli animali familiari. Francesca Bellini, Alessia Liverini, Vincenzo Rosa

Directory of Open Access Journals (Sweden)

Manuel Graziani

2014-03-01

Full Text Available Conoscere gli animali familiari è la settima uscita della collana diretta da Paolo Polidori "produzioni animali e sicurezza alimentare" sulla ricerca nell'ambito della nutrizione e alimentazione animale, zootecnia, ispezione degli alimenti di origine animale, clinica medica e parassitologia veterinaria con risvolti di natura tecnica, scientifica e pratica. Il volume, redatto da medici veterinari in servizio presso differenti Aziende Sanitarie italiane, è un sintetico manuale su domesticazione, cura sanitaria, etnografia e addestramento del proprio cane (o gatto. Gli autori partono dall'assunto che i proprietari scelgono il cane per lo più sulla base del gusto visivo o sulla consuetudine tramandata in famiglia, senza un'esaustiva conoscenza degli aspetti riguardanti l'origine dell'animale, la sua attitudine prevalente, le sue patologie ricorrenti e le eventuali predisposizioni genetiche nei confronti di una determinata patologia. Puntano l'accento sin dalle prime battute sul cambiamento culturale che ha modificato anche il rapporto uomo-animale sotto l'aspetto sociale, effettuale e giuridico. L'animale da semplice "res" si è da tempo affermato come un essere diverso ma senziente, quindi destinatario di tutele, con diritti contemplati dalle carte costituzionali di diversi Paesi. Per questo motivo chi detiene un animale domestico deve prepararsi ad un impegno non riducibile al possesso di un oggetto, al punto di risponderne penalmente per eventuali sofferenze fisiche o psicologiche, per l'abbandono (anche solo temporaneo o per l'incuria. Conoscere gli animali familiari fornisce nozioni scientifiche e sanitarie alla portata di tutti, utili soprattutto nelle occasioni in cui i proprietari dovranno recarsi dal veterinario o affrontare visite legate alla profilassi e alle vaccinazioni di routine.
Seroprevalencia de leishmaniosis visceral canina en la comuna 8 de Neiva y en cuatro municipios de Huila, Colombia

OpenAIRE

José Fernández; Felio Bello; Myriam Consuelo López; Ligia Inés Moncada; Jimmy Jolman Vargas; Martha Stella Ayala; Rubén Santiago Nicholls; Carlos Alberto Lozano

2006-01-01

Introducción. La leishmaniosis visceral canina en áreas endémicas de Colombia se constituye en un factor de riesgo para la salud pública, dado el carácter zoonótico de la enfermedad. Durante el año 2004 se registraron 96 casos de leishmaniosis visceral humana en el país, de los cuales cinco correspondieron al departamento del Huila, zona de influencia del vector Lutzomyia longipalpis. Objetivo. Determinar la prevalencia de anticuerpos IgG contra Leishmania chagasi en sueros de caninos rec...
Cuantificación de citocinas caninas mediante reacción en cadena de la polimerasa de transcriptasa reversa en tiempo real

Directory of Open Access Journals (Sweden)

Omar A. Saldarriaga

2006-10-01

Full Text Available Introducción. Los caninos son el principal reservorio domestico de la leishmaniasis visceral en el Nuevo y Viejo mundo. La reacción en cadena de la polimerasa de transcriptasa reversa en tiempo real para la medición de citocinas caninas no ha sido implementada para el estudio de la leishmaniasis visceral. Objetivo. Estandarizar la cuantificación relativa de IFN-g, IL-4, IL-10, IL-12p40 y IL-12p35 caninas utilizando reacción en cadena de la polimerasa de transcriptasa reversa en tiempo real. Materiales y métodos. Células mononucleares de sangre periférica de perros Fox-Hound fueron estimuladas con ConA, LPS y extracto de Staphylococcus aureus. El ARN fue utilizado en la reacción en cadena de la polimerasa de transcriptasa reversa en tiempo real de un solo paso para optimizar las concentraciones de iniciadores y sondas especificas de cada citocina, generar curvas estándar, confirmar la eficiencia de amplificación de las citocinas y del normalizador (18S ARNr y cuantificar la expresión de ARN. El método comparativo Ct fue utilizado para determinar los niveles relativos de expresión de ARN en las muestras, expresado como el incremento en el número de veces comparado con los controles. Resultados. El coeficiente de regresión para las curvas estándar y las eficiencias de amplificación de las citocinas y el normalizador, indicaron que la cuantificación fue confiable en un amplio rango de concentraciones de ARN. La activación de células mononucleares de sangre periférica resultó en un incremento en la expresión de IFN-g (132, IL-4 (8.8, IL-10 (7,2, y IL-12p40 (275, relativo a células control. La expresión basal de IL-12p35 fue también detectada. Conclusión. Esta metodología, comparada con los métodos convencionales disponibles para la medición de citocinas, ofrece varias ventajas y podría ser utilizada en estudios sobre inmunopatogenia e inmunidad en leishmaniasis visceral canina.
Leptospira interrogans en una población canina del Gran Buenos Aires: variables asociadas con la seropositividad

Directory of Open Access Journals (Sweden)

Diana Rubel

1997-08-01

Full Text Available Se determinó la seroprevalencia de leptospirosis en una población canina suburbana con el objeto de analizar la asociación entre distintas variables individuales y ambientales y la seropositividad a leptospirosis. El estudio, de diseño transversal, se llevó a cabo durante julio de 1992 en un barrio del Gran Buenos Aires en el que viven unos 9 500 habitantes y una población canina de unos 2 000 animales. Se estudió una muestra aleatoria de 223 perros, de cada uno de los cuales se obtuvo una muestra de sangre. La ficha epidemiológica del animal se obtuvo por encuesta al ama de casa. Las determinaciones serológicas se realizaron por microaglutinación frente a 10 serotipos de Leptospira interrogans. Se halló seropositividad en 57% de los 223 perros examinados; 82% de los sueros positivos coaglutinaron con dos o más serotipos. Los serotipos detectados con mayor frecuencia fueron canicola y pyrogenes. La seroprevalencia en hembras fue menor que en machos (P <0,05 y entre los cachorros de menos de 1 año de edad, menor que en los animales de mayor edad (P <0,01. El callejeo del perro y la presencia de agua estancada frente a la vivienda del propietario fueron los factores de riesgo más importantes entre los que se estudiaron. Las asociaciones de la seropositividad con el contacto con un basural, con el comportamiento de caza del perro y con la presencia de roedores en la vivienda no fueron estadísticamente significativas. Se discuten distintas medidas de control.

Ectoparasitos e helmintos intestinais em Canis familiaris e Felis catus domesticus, da cidade de Lages, SC, Brasil

OpenAIRE

Stalliviere, Fernanda Magalhães

2007-01-01

Com os objetivos de determinar e comparar a prevalência de ectoparasitos e helmintos intestinais em cães e gatos domiciliados, das regiões central e periférica, da cidade de Lages, SC; de correlacionar aspectos sócio-econômicos e culturais das famílias proprietárias dos animais com a prevalência de ectoparasitos e helmintos intestinais; e de verificar a proporção entre a população humana com a canina e com a felina; no período de dezembro de 2005 a dezembro de 2006, foram aplicados 600 questi...
Neuroprotective Effects of Herbal Extract (Rosa canina, Tanacetum vulgare and Urtica dioica) on Rat Model of Sporadic Alzheimer’s Disease

Science.gov (United States)

Daneshmand, Parvaneh; Saliminejad, Kioomars; Dehghan Shasaltaneh, Marzieh; Kamali, Koorosh; Riazi, Gholam Hossein; Nazari, Reza; Azimzadeh, Pedram; Khorram Khorshid, Hamid Reza

2016-01-01

Background: Sporadic Alzheimer’s Disease (SAD) is caused by genetic risk factors, aging and oxidative stresses. The herbal extract of Rosa canina (R. canina), Tanacetum vulgare (T. vulgare) and Urtica dioica (U. dioica) has a beneficial role in aging, as an anti-inflammatory and anti-oxidative agent. In this study, the neuroprotective effects of this herbal extract in the rat model of SAD was investigated. Methods: The rats were divided into control, sham, model, herbal extract -treated and ethanol-treated groups. Drug interventions were started on the 21st day after modeling and each treatment group was given the drugs by intraperitoneal (I.P.) route for 21 days. The expression levels of the five important genes for pathogenesis of SAD including Syp, Psen1, Mapk3, Map2 and Tnf-α were measured by qPCR between the hippocampi of SAD model which were treated by this herbal extract and control groups. The Morris Water Maze was adapted to test spatial learning and memory ability of the rats. Results: Treatment of the rat model of SAD with herbal extract induced a significant change in expression of Syp (p=0.001) and Psen1 (p=0.029). In Morris Water Maze, significant changes in spatial learning seen in the rat model group were improved in herbal-treated group. Conclusion: This herbal extract could have anti-dementia properties and improve spatial learning and memory in SAD rat model. PMID:27563424
Investigation of Polyhenolic Content of Rose Hip (Rosa canina L.) Tea Extracts: A Comparative Study

Science.gov (United States)

İlbay, Zeynep; Şahin, Selin; Kırbaşlar, Ş. İsmail

2013-01-01

Three different brands of Rose hip (Rosa canina L.) tea were extracted with water, ethanol (EtOH), methanol (MeOH), and aqueous mixtures (50%, v/v) by ultrasound-assisted extraction (UAE) and Soxhlet methods. Total phenolic content was determined according to the Folin-Ciocalteu method. The results were presented by means of the extract yields and total phenolic contents, expressed in gallic acid equivalent (GAE) per g of dried matter (DM). The greatest amount of extract observed in tea samples was obtained by UAE through water with the value of 619.37 ± 0.58 mg/g DM. Regarding the phenolic content, the best result was achieved by the Soxhlet method through 50% MeOH mixture (59.69 ± 0.89 mg GAE/g DM), followed by the UAE method with water (48.59 ± 0.29 mg GAE/g DM). PMID:28239095
Gel state of the fictional body in Mario Bellatin’s 'Rosa Canina' and "Flores"

Directory of Open Access Journals (Sweden)

Isabel Jasinski

2015-12-01

Full Text Available Mario Bellatin creates a peculiar "space of sense" in fiction, related to the visual and performatic expressions of language. So, his literary project presents writing as body language, a territory of significance constantly deterritorialized by sensations connected to the narrative game, with images and symbols in the literary actions. A sense of creative destruction constitutes the paradox expressed by fiction as body and by the body as fiction, in what we call Bellatin’s "nomadic writing", by means of the abnormality of the characters, their sexuality and religiosity, as one can note in Flores (2000, especially in "Rosa canina", published online by Cosac Naify in 2009. The position adopted by the protagonist in this work seems to indicate a specific "regime of signification”, as Josefina Ludmer puts it, according to which art and reality, fiction and biography blur their borders in a “gel state exchange”.
Hyperhidrosis in naïve purpose-bred beagle dogs (Canis familiaris).

Science.gov (United States)

Carrier, Catherine A; Seeman, Jennifer L; Hoffmann, Guenther

2011-05-01

This case study details the unusual clinical findings in a unique paw-pad disorder that recently emerged among 2 male and 1 female naïve purpose-bred beagle dogs (Canis familiaris) newly received into our facility. During acclimation period physical examinations, the affected dogs demonstrated constantly moist, soft paw pads on all 4 feet. No information was available regarding the epidemiology and pathogenesis of this pad condition in beagle dogs. Here, we report the results of physical examination, clinical chemistry analysis, hematology, histopathology, detailed observations, and novel testing techniques performed during the acclimation period. Histopathology of several sections of affected footpads was compared with that of an age-matched dog with clinically normal paw pads. We describe the morphologic features of a distinctive cutaneous canine footpad condition and discuss the possible differential diagnoses. The histologic and clinical features were most consistent with those of hyperhidrosis; to our knowledge, this report is the first description of hyperhidrosis as a distinct condition in purpose-bred beagle dogs.
Investigation of Polyhenolic Content of Rose Hip (Rosa canina L. Tea Extracts: A Comparative Study

Directory of Open Access Journals (Sweden)

Zeynep İlbay

2013-02-01

Full Text Available Three different brands of Rose hip (Rosa canina L. tea were extracted with water, ethanol (EtOH, methanol (MeOH, and aqueous mixtures (50%, v/v by ultrasound-assisted extraction (UAE and Soxhlet methods. Total phenolic content was determined according to the Folin-Ciocalteu method. The results were presented by means of the extract yields and total phenolic contents, expressed in gallic acid equivalent (GAE per g of dried matter (DM. The greatest amount of extract observed in tea samples was obtained by UAE through water with the value of 619.37 ± 0.58 mg/g DM. Regarding the phenolic content, the best result was achieved by the Soxhlet method through 50% MeOH mixture (59.69 ± 0.89 mg GAE/g DM, followed by the UAE method with water (48.59 ± 0.29 mg GAE/g DM.
Dog rose (Rosa canina L.) as a functional ingredient in porcine frankfurters without added sodium ascorbate and sodium nitrite.

Science.gov (United States)

Vossen, Els; Utrera, Mariana; De Smet, Stefaan; Morcuende, David; Estévez, Mario

2012-12-01

The effect of dog rose (Rosa canina L.; RC), rich in polyphenols and ascorbic acid, on lipid and protein oxidation, colour stability and texture of frankfurters was investigated. Four treatments were prepared: with 5 or 30 g/kg RC extract and without sodium ascorbate and sodium nitrite (5RC and 30RC, respectively), a positive control (with sodium ascorbate and sodium nitrite; PC) and a negative control (without sodium ascorbate, sodium nitrite or RC extract; NC). Hexanal values were much higher throughout storage in NC compared to RC and PC frankfurters (Prose can act as a natural antioxidant in frankfurters, but not as full replacer for sodium nitrite. Copyright © 2012 Elsevier Ltd. All rights reserved.
Evolution of sociality, diet, and craniodental anatomy in the subfamly caninae; Evolucion de la socialidad, estrategias alimentarias y anatomia craneodental en la subfamilia caninae

Energy Technology Data Exchange (ETDEWEB)

Munoz Duran, Joao; Arturo Fuentes, Jesualdo

2012-07-01

Social carnivores affect population parameters, ecology, behavior and speciation and extinction rates of their prey and other sympatric carnivores. Therefore, social carnivores may have influenced the evolution of the structure and organization of ancestral and modern mammal communities. Thus, it is important to identify what extinct carnivore species may have been social and to determine when, where and under which environmental contexts they evolved. The first step is to establish if there is an association between morphological traits, susceptible of being preserved in the fossil record, and differences in the degree of sociality of present day carnivores. The aim of this research was to establish if there is an association between variation in shape and variables related to mechanical properties of the skulls, and differences in sociality level, diet and sex in modern canids. The sample included 972 specimens of 33 canid species. We analyzed the shape of the lateral side of the cranium, zygomatic arch, dentary bone and mandibular corpus, as well as 20 variables related to mechanical properties of the skull. Results suggest that hypercarnivorous social canids have shapes and mechanical properties that are different from other modern canids. We found that morphological variation is not affected by sex. Results may be used to identify extinct caninae species that were social and hypercarnivorous. Results also suggest that the evolution of sociality is dependent on phylogenetic relationships and ecological context, particularly the abundance of large prey and the presence of sympatric carnivores.
Prevalência, avaliação clínica e imunológica de cães (Canis familiaris) (Linnaeus, 1758) naturalmente infectados por Leishmania (Leishmania) chagasi (Cunha & Chagas, 1937) provenientes do município de Tamandaré, região litoral Sul do Estado de Pernambuco, Brasil

OpenAIRE

Marco Antônio Granja Barbosa

2009-01-01

A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania (Leishmania) chagasi a qual é relatada em várias regiões. O objetivo desta pesquisa foi verificar a prevalência, analisar a correlação espacial entre a Leishmaniose Visceral Canina e fatores ambientais, avaliar e comparar os níveis de citocinas (IL-12, IFN-γ, IL-2 e IL-4) expressões por PCR em tempo real em diferentes tecidos/órgãos, determinar os padrões bio-químicos e hematológicos em cães naturalmente infectados p...
Aspectos nutricionais e ambientais da obesidade canina

Directory of Open Access Journals (Sweden)

Karina Preising Aptekmann

2014-11-01

Full Text Available A obesidade é a doença nutricional mais frequente em cães, leva a uma série de alterações nas funções corporais e limita a longevidade dos animais. Vários fatores contribuem para o desenvolvimento da obesidade em cães, como genética, raça, idade, falta de atividade física, composição calórica dos alimentos, tipo e a forma de alimentação, distúrbios hormonais, medicamentos e fatores relacionados com os proprietários. Devido à falta de estudos sobre os aspectos nutricionais e ambientais envolvidos no desenvolvimento da obesidade canina, o presente trabalho objetivou obter estas informações por meio de enquetes a proprietários. Foram realizadas 254 entrevistas com proprietários de cães com sobrepeso ou obesos, atendidos em Hospitais Veterinários Universitários. Selecionaram-se cães com escore de condição corporal (ECC de 6 a 9, de acordo com escala descrita por LAFLAMME (1997. A maioria dos cães acometidos eram fêmeas adultas castradas, sem raça definida (33% ou Poodles (17%. De acordo com 36% dos respondentes, o excesso de alimento era a possível razão do ganho de peso dos animais. Apenas 52% dos proprietários tentaram realizar controle de peso do seu animal, principalmente reduzindo a quantidade de alimento. Não houve correlação entre a condição corporal do proprietário, nível de escolaridade, renda familiar e ambiente domiciliar dos proprietários com o ECC dos animais. As informações obtidas podem auxiliar na identificação dos fatores nutricionais e ambientais envolvidos no desenvolvimento da obesidade em cães, podendo adotar medidas preventivas e desenvolver melhores estratégias para o tratamento
Communication between domestic dogs (Canis familiaris) and humans: dogs are good learners.

Science.gov (United States)

Elgier, Angel M; Jakovcevic, Adriana; Barrera, Gabriela; Mustaca, Alba E; Bentosela, Mariana

2009-07-01

Communication involves a wide range of behaviours that animals emit in their daily lives and can take place between different species, as is the case of domestic dogs (Canis familiaris) and humans. Dogs have shown to be successful at following human cues to solve the object choice task. The question is what are the mechanisms involved in these communicative abilities. This article presents a review of studies about the communicative capacities of domestic dogs emphasizing the ones that considered the effect of associative learning upon these skills. In addition, evidence about differences in dogs' performance in following physical or social cues is summarized and two studies where both signals compete are presented here. The obtained results suggest that the training of a colour cue reverses the dogs' preference for the social one. These results are discussed in light of the findings that gave importance to the learning effect, concluding that the dogs fundamentally follow those cues that allowed them to obtain reinforcers in their previous learning history.
[Dog (Canis familiaris) infectivity to Lutzomyia youngi in Trujillo, Venezuela].

Science.gov (United States)

Hernández, Dalila; Rojas, Elina; Scorza, José Vicente; Jorquera, Alicia

2006-10-01

In Trujillo, Venezuela the prevalence for American tegumentary leishmaniasis (ATL) is 38 per 100,000 inhabitants. In a periurban, rural settlement of the capital city Trujillo, we studied the potential capability of the domestic dog (Canis familiaris) as a source of infection for Lutzomyia youngi, a phlebotomine sand fly species abundant in the study area and whose domestic vectorial activity has been proven. Dogs with dermal lesions suggestive of ATL and parasitological confirmation of infection, were selected for xenodiagnosis by allowing sylvatic phlebotomines from a ATL free area, to feed ad libitum over each animal's entire body surface. The insects' intestinal tracts were dissected 5 days after the blood meal in order to look for flagellate forms. When these were found, parasitological identification was performed by the multiplex-PCR technique. Four hundred and fifty five sand flies engorged over two dogs in three different assays; promastigotes were found in 4 (0.88%) of the specimens on only one occasion. PCR identified DNA of the Leishmania Viannia subgenus. The household dog has the potential of being a domestic risk factor in the ATL transmission cycle.
Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

DEFF Research Database (Denmark)

Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette

2014-01-01

This study compared vitamin D3 (vitD3) and 25-OH vitamin D3 (25OHD3) status in Greenland sledge dogs (Canis familiaris) given either minke whale (Balaenoptera acuterostrata) blubber high in organohalogen contaminants (OHCs) or clean porcine (Suis scrofa) fat for up to 636 days. A group of six...
The role of oxytocin in the ability of domestic dogs (Canis familiaris) to use human social cues and bond with humans.

OpenAIRE

Oliva, Jessica Lee

2017-01-01

The domestic dog (Canis familiaris) demonstrates attachment/bonding behaviour towards humans, whilst wolves (Canis lupus) do not. Domestic dogs also use humans’ non-verbal social cues to solve problems better than wolves do, even wolves raised in the same manner as domestic dogs. The neuropeptide oxytocin has been implicated in mammalian bonding and non-verbal intelligence and therefore the oxytocinergic system may have evolved in the dog during domestication in such a manner as to enable the...
Aspectos epidemiológicos sobre mordeduras caninas durante el año 2011 en la ciudad de Temuco, Chile.

Directory of Open Access Journals (Sweden)

Waldo Armstrong,

2016-03-01

Full Text Available Los accidentes causados por mordeduras de perros y gatos son un problema de salud pública y concretamente las mordeduras de perro constituyen el riesgo más grave que estos animales suponen para la salud de las personas. A los costes económicos derivados del tratamiento de las lesiones físicas debemos añadir las secuelas psicológicas que muchas veces aparecen tras las agresiones. La prevención es el único camino para resolver este problema y puede efectuarse mejor cuando se conocen los diversos factores involucrados en la génesis de este tipo de accidentedebido a lo anterior el objetivo del estudio fue describir las características epidemiológicas asociadas a las personas mordidas por perros. La metodología utilizada para la recolección de datos fue la aplicación de una encuesta a 9 centros asistenciales de la ciudad de Temuco. Se solicitó información sobre pacientes atendidos por mordeduras caninas durante el año 2011 y los datos recolectados se ingresaron en una planilla de cálculos. Los resultados indican que niños y adultos presentan 52% de las mordeduras durante el año. Los hombres presentan una mayor incidencia con un 47% a diferencia de las mujeres con un 44%. Con respecto a la región corporal afectada los miembros superiores alcanzan un 25% de frecuencia ante el ataque y los miembros inferiores un 31.3%. Por otra parte, las mordeduras por perros presentaron una marcada estacionalidad en los meses de verano con un 30% de casos. Se concluye que las mordeduras caninas son un problema frecuente y de real importancia en el ámbito de salud pública, generando en la población secuelas físicas y psicológicas por las lesiones generadas durante el ataque.
Characterization of biochemical traits of dog rose (Rosa canina L.) ecotypes in the central part of Iran.

Science.gov (United States)

Javanmard, Milad; Asadi-Gharneh, Hossein Ali; Nikneshan, Pejman

2018-07-01

Dog rose (Rosa canina L.) is a wild native species in Iran, with a significant genetic diversity. This plant serves as a rich source of vitamin C, anthocyanins, phenolic contents and carotenoids. Rose hips have been used in several food products, as well as perfumery and cosmetics industries. In this research, we investigate biochemical characteristics of five dog rose ecotypes (Kopehjamshid, Zarneh, Miyankish, Aghcheh and Sadeghiyeh), that were collected from the central part of Iran (Isfahan province). Amounts of vitamin C, total carotenoids, total phenolic contents, total anthocyanins, macro and micro minerals were measured. Seed oil are extracted by soxhlet method and analysed by gas chromatography. The macro and micro minerals levels in the fruit vary significantly among these regions. The results of this study demonstrate that dog rose have great diversity and can be used in breeding programmes in order to increase nutrient values as a food resource additive.
Comparison between lamellar keratoplasties produced by conjunctival pedicle and free corneal autografts. Experimental study in the dog (Canis familiaris - LINNAEUS, 1758

Directory of Open Access Journals (Sweden)

José Luiz Laus

1996-03-01

Full Text Available A comparative study of conjunctival pedicle and corneal autografts, for experimental healing of superficial keratectomies in dogs (Canis familiaris was performed. It was carried out by using 24 animals, and the technical procedures were analysed according to clinical, histologic and scanning electron microscopy parameters, in early and late postoperative periods. The obtained results are believed to represent feasible methods of proteresis, applied to the healing ophthalmic surgery. There were few, irrelevant differences between the two tested techniques.
Evolution of sociality, diet, and craniodental anatomy in the subfamly caninae

International Nuclear Information System (INIS)

Munoz Duran, Joao; Arturo Fuentes, Jesualdo

2012-01-01

Social carnivores affect population parameters, ecology, behavior and speciation and extinction rates of their prey and other sympatric carnivores. Therefore, social carnivores may have influenced the evolution of the structure and organization of ancestral and modern mammal communities. Thus, it is important to identify what extinct carnivore species may have been social and to determine when, where and under which environmental contexts they evolved. The first step is to establish if there is an association between morphological traits, susceptible of being preserved in the fossil record, and differences in the degree of sociality of present day carnivores. The aim of this research was to establish if there is an association between variation in shape and variables related to mechanical properties of the skulls, and differences in sociality level, diet and sex in modern canids. The sample included 972 specimens of 33 canid species. We analyzed the shape of the lateral side of the cranium, zygomatic arch, dentary bone and mandibular corpus, as well as 20 variables related to mechanical properties of the skull. Results suggest that hypercarnivorous social canids have shapes and mechanical properties that are different from other modern canids. We found that morphological variation is not affected by sex. Results may be used to identify extinct caninae species that were social and hypercarnivorous. Results also suggest that the evolution of sociality is dependent on phylogenetic relationships and ecological context, particularly the abundance of large prey and the presence of sympatric carnivores.
Seroprevalencia de leishmaniosis visceral canina en la comuna 8 de Neiva y en cuatro municipios de Huila, Colombia

Directory of Open Access Journals (Sweden)

José Fernández

2006-10-01

Full Text Available Introducción. La leishmaniosis visceral canina en áreas endémicas de Colombia se constituye en un factor de riesgo para la salud pública, dado el carácter zoonótico de la enfermedad. Durante el año 2004 se registraron 96 casos de leishmaniosis visceral humana en el país, de los cuales cinco correspondieron al departamento del Huila, zona de influencia del vector Lutzomyia longipalpis. Objetivo. Determinar la prevalencia de anticuerpos IgG contra Leishmania chagasi en sueros de caninos recolectados en los municipios de Rivera, Palermo, Villavieja, Algeciras y la comuna 8 de la ciudad de Neiva, Huila, Colombia. Materiales y métodos. Se realizó una encuesta epidemiológica a los propietarios de 610 caninos y previo consentimiento se llevó a cabo examen clínico general y recolección de muestra de sangre de cada una de las mascotas. Los sueros fueron analizados mediante el test de ELISA empleando como antígeno promastigotes de Leishmania chagasi, de la cepa MHOM/CO/84/CL044B. El análisis de datos empleó estadística descriptiva. Resultados. En la población canina 85% fueron mestizos, la edad promedio fue 2,5 años y 67,3% de los animales fueron machos. Al examen clínico las manifestaciones más frecuentes fueron: onicogrifosis 24,3%, linfadenitis 10% y lesiones cutáneas 5%. La frecuencia de anticuerpos IgG contra Leishmania chagasi en la comuna 8 de la ciudad de Neiva fue 28,1%, en Villavieja 28%, en Rivera 14,9%, en Palermo 10% y en Algeciras 5,1%. Adicionalmente, se observó un promedio de cinco personas convivientes por canino seropositivo. Conclusiones. Estos datos demuestran la exposición de los caninos que habitan los ambientes rurales y urbanos de las zonas en estudio a Leishmania chagasi y deben tenerse en cuenta para el fortalecimiento de los programas de control y prevención de esta zoonosis en el Sistema General de Seguridad Social en Salud.
Search behavior in various breeds of adult dogs (Canis familiaris): object permanence and olfactory cues.

Science.gov (United States)

Gagnon, S; Doré, F Y

1992-03-01

Human analog tests of object permanence were administered to various breeds of adult dogs (Canis familiaris). Experiment 1 showed that the performance of terriers, sporting, and working dogs did not differ. Dogs succeeded in solving invisible displacement problems, but performance was lower than in visible displacement tests. Familiarity with the task had some influence because invisible displacement tests were more successful if they were preceded by visible displacement tests. In Experiment 2, odor cues from the target object and the hiding screens were available or were masked. Results confirmed that success was lower in invisible than in visible displacement tests and that these problems were solved on the basis of representation of visual information rather than on the basis of olfactory cues or of local rule learning. Dogs are compared with other species that display Stage 6 object permanence.

Automatic internal crack detection from a sequence of infrared images with a triple-threshold Canny edge detector

Science.gov (United States)

Wang, Gaochao; Tse, Peter W.; Yuan, Maodan

2018-02-01

Visual inspection and assessment of the condition of metal structures are essential for safety. Pulse thermography produces visible infrared images, which have been widely applied to detect and characterize defects in structures and materials. When active thermography, a non-destructive testing tool, is applied, the necessity of considerable manual checking can be avoided. However, detecting an internal crack with active thermography remains difficult, since it is usually invisible in the collected sequence of infrared images, which makes the automatic detection of internal cracks even harder. In addition, the detection of an internal crack can be hindered by a complicated inspection environment. With the purpose of putting forward a robust and automatic visual inspection method, a computer vision-based thresholding method is proposed. In this paper, the image signals are a sequence of infrared images collected from the experimental setup with a thermal camera and two flash lamps as stimulus. The contrast of pixels in each frame is enhanced by the Canny operator and then reconstructed by a triple-threshold system. Two features, mean value in the time domain and maximal amplitude in the frequency domain, are extracted from the reconstructed signal to help distinguish the crack pixels from others. Finally, a binary image indicating the location of the internal crack is generated by a K-means clustering method. The proposed procedure has been applied to an iron pipe, which contains two internal cracks and surface abrasion. Some improvements have been made for the computer vision-based automatic crack detection methods. In the future, the proposed method can be applied to realize the automatic detection of internal cracks from many infrared images for the industry.
Association, inhibition, and object permanence in dogs' (Canis familiaris) spatial search.

Science.gov (United States)

Ashton, Rebecca L; De Lillo, Carlo

2011-05-01

The relative role of associative processes and the use of explicit cues about object location in search behavior in dogs (Canis familiaris) was assessed by using a spatial binary discrimination reversal paradigm in which reversal conditions featured: (1) a previously rewarded location and a novel location, (2) a previously nonrewarded location and a novel location, or (3) a previously rewarded location and a previously nonrewarded location. Rule mediated learning predicts a similar performance in these different reversal conditions whereas associative learning predicts the worst performance in Condition 3. Evidence for an associative control of search emerged when no explicit cues about food location were provided (Experiment 1) but also when dogs witnessed the hiding of food in the reversal trials (Experiment 2) and when they did so in both the prereversal and the reversal trials (Experiment 3). Nevertheless, dogs performed better in the prereversal phase of Experiment 3 indicating that their search could be informed by the knowledge of the food location. Experiment 4 confirmed the results of Experiments 1 and 2, under a different arrangement of search locations. We conclude that knowledge about object location guides search behavior in dogs but it cannot override associative processes. 2011 APA, all rights reserved
Electrochemistry of Canis familiaris cytochrome P450 2D15 with gold nanoparticles: An alternative to animal testing in drug discovery.

Science.gov (United States)

Rua, Francesco; Sadeghi, Sheila J; Castrignanò, Silvia; Valetti, Francesca; Gilardi, Gianfranco

2015-10-01

This work reports for the first time the direct electron transfer of the Canis familiaris cytochrome P450 2D15 on glassy carbon electrodes to provide an analytical tool as an alternative to P450 animal testing in the drug discovery process. Cytochrome P450 2D15, that corresponds to the human homologue P450 2D6, was recombinantly expressed in Escherichia coli and entrapped on glassy carbon electrodes (GC) either with the cationic polymer polydiallyldimethylammonium chloride (PDDA) or in the presence of gold nanoparticles (AuNPs). Reversible electrochemical signals of P450 2D15 were observed with calculated midpoint potentials (E1/2) of −191 ± 5 and −233 ± 4 mV vs. Ag/AgCl for GC/PDDA/2D15 and GC/AuNPs/2D15, respectively. These experiments were then followed by the electro-catalytic activity of the immobilized enzyme in the presence of metoprolol. The latter drug is a beta-blocker used for the treatment of hypertension and is a specific marker of the human P450 2D6 activity. Electrocatalysis data showed that only in the presence of AuNps the expected α-hydroxy-metoprolol product was present as shown by HPLC. The successful immobilization of the electroactive C. familiaris cytochrome P450 2D15 on electrode surfaces addresses the ever increasing demand of developing alternative in vitromethods for amore detailed study of animal P450 enzymes' metabolism, reducing the number of animals sacrificed in preclinical tests.
Length of time domestic dogs (Canis familiaris) spend smelling urine of gonadectomised and intact conspecifics.

Science.gov (United States)

Riach, Anna C; Asquith, Rachel; Fallon, Melissa L D

2017-09-01

Domestic dogs (Canis familiaris) use urine to communicate among themselves, however, it is unknown whether the gonadectomy (neutering or spaying) of a dog affects this communication in anyway. Urine samples from 10 intact and 10 gonadectomised, unfamiliar dogs were presented to 12 tester dogs to sniff under controlled conditions in a pilot study. The amount of time the tester dogs spent sniffing each sample was recorded. Overall, tester dogs were recorded smelling the urine of gonadectomised individuals for a longer time. In addition to the type of urine sample, the result is likely to have been influenced by the sex and status (gonadectomised or intact) of the tester dogs. The observed increase in the length of time spent sniffing urine from gonadectomised individuals could be explained by the tester dogs experiencing more difficulty in gaining information from the urine or facing more confusion while analysing the urine compared to the intact urine they have evolved to smell. Copyright © 2017 Elsevier B.V. All rights reserved.
Canine hypertrophic osteopathy associated with extra-thoracic lesions Osteopatia hipertrófica canina associada com lesões extratorácicas

Directory of Open Access Journals (Sweden)

Selwyn Arlington Headley

2005-08-01

Full Text Available Canine hypertrophic osteopathy is described in a dog that presented extra-thoracic lesions, mainly in the liver. Hepatic lesions were characterized by necrosis, hemorrhage, severe hydropic degeneration of centrolobular hepatocytes, proliferation of epithelial cells of bile ducts, and mild biliary stasis. The disease syndrome was diagnosed based on clinical signs, radiological evaluation, and inspection of macerated bones.Osteopatia hipertrófica canina é descrita em um cão que apresentou lesões extratorácicas, principalmente no fígado. As alterações hepáticas foram caracterizadas por necrose, hemorragia, degeneração hepatocelular severa, proliferação das células epiteliais dos ductos biliares e estase biliar. O diagnóstico desta síndrome foi baseado nos sinais clínicos, a avaliação radiológica e a inspeção dos ossos macerados.
Infectividad del perro (Canis familiaris para Lutzomyia youngi en Trujillo, Venezuela

Directory of Open Access Journals (Sweden)

Dalila Hernández

2006-10-01

Full Text Available Introducción. En Trujillo, Venezuela, la prevalencia de leishmaniasis tegumentaria americana (LTA es de 38 por 100.000 habitantes. Objetivo. En una localidad periurbana, rural, de la ciudad capital, estudiamos a los perros caseros (Canis familiaris para investigar mediante la técnica de xenodiagnóstico la eventual capacidad para infectar a Lutzomyia youngi, especie flebotomina con actividad vectorial intradomiciliaria comprobada y abundante en el área de estudio. Materiales y métodos. Los perros con lesiones sugestivas de LTA, parasitológicamente diagnosticados, fueron seleccionados para el xenodiagnóstico permitiendo a flebótomos silvestres de una zona libre de LTA alimentarse ad libitum sobre toda la superficie corporal de cada animal, y evidenciar, en disecciones efectuadas a los 5 días post-ingesta, la posible presencia de flagelados en sus tractos digestivos, en cuyo caso, fueron evaluados por la técnica PCR-Multiplex para determinar la identidad del parásito. Resultados. Un total de 455 flebótomos se ingurgitaron sobre dos perros en tres evaluaciones distintas; en una única ocasión, se observaron promastigotes en 4 (0,88% insectos, cuya identificación molecular reveló pertenecían al subgénero Viannia. Conclusión. El perro casero constituye un potencial factor de riesgo intradomiciliario en el ciclo de la LTA.
Aspectos moleculares del virus de la parvovirosis canina y sus implicaciones en la enfermedad

Directory of Open Access Journals (Sweden)

César A. Díaz R.

2008-06-01

Full Text Available El parvovirus canino tipo 2 (CPV-2 es el agente causal de una enfermedad infecto-contagiosa que produce una gastroenteritis aguda hemorrágica que afecta a caninos jóvenes. El CPV-2 se adaptó a la especie canina por mutación del virus de la Panleucopenia felina (FPV luego de su paso por animales silvestres como el hurón y los zorros. La alta variabilidad de la proteína viral 2 (VP2 es la causa principal del amplio rango de hospedadores y de las reacciones cruzadas entre las variantes. En la actualidad, la secuenciación de esta proteína ha permitido identificar tres variantes del virus conocidas como 2a, 2b y 2c que conviven en el mundo con diferencias en tropismo celular, infecciocidad y patogenicidad. El virus ssADN ha presentado una gran variación génica en cortos períodos de tiempo lo que indica un alto grado de selección por evolución sólo comparable con virus RN, esta alta variabilidad no se ha aclarado totalmente. El empleo de las técnicas moleculares permitirá diferenciar entre cepas vacunales y de campo, tanto como contar con técnicas diagnósticas confiables y específicas.
Matrix metalloproteinases 2 and 9 expression in canine normal prostate and with proliferative disorders Expressão de metaloproteinases de matriz 2 e 9 na próstata canina normal e com lesões proliferativas

Directory of Open Access Journals (Sweden)

Mariana Batista Rodrigues Faleiro

2013-06-01

Full Text Available In this study the expression of metalloproteinases 2 (MMP-2 and 9 (MMP-9 in canine normal prostates and with proliferative disorders was evaluated to verify the role of these enzymes in extracellular matrix remodeling (ECM and in the tissue invasion process. A total of 355 prostatic samples were obtained, from which 36 (10.1% were normal prostates, 46 (13.0% with benign prostatic hyperplasia (BPH, 128 (36.1% with proliferative inflammatory atrophy (PIA, 74 (20.8% with prostatic intraepithelial neoplasia (PIN, and 71 (20.0% with prostatic carcinoma (PC. Difference in cytoplasmic immunohistochemical staining of MMP-2 and MMP-9 between acinar epithelium and periacinar stroma was found regarding the different diagnosis. The correlation between MMP-2 and MMP-9 expression in relation to the number of labeled cells in acinar epithelium and periacinar stroma, as well as to the staining intensity in the periacinar stromal cells was evidenced in canine prostates with PIA. In conclusion, MMP-2 and MMP-9 expression has a variation in canine prostate according to the lesion, with lower expression in normal tissue and with BPH, and higher expression in those with PIA, PIN and PC. Moreover, the inflammatory microenvironment of the PIA has influence in the activity of both enzymes.Este estudo teve como objetivo avaliar a expressão das metaloproteinases 2 (MMP-2 e 9 (MMP-9 em próstatas caninas normais e com desordens proliferativas, verificando o papel dessas enzimas na remodelação da matriz extracelular (MEC e no processo de invasão tecidual. Um total de 355 amostras prostáticas foram obtidas, sendo 36 (10,1% normais, 46 (13,0% com hiperplasia prostática benigna (HPB, 128 (36,1% com atrofia inflamatória proliferativa (PIA, 74 (20,8% com neoplasia intraepitelial prostática (PIN e 71 (20,0% com carcinoma prostático (CP. Houve diferença de imunomarcação citoplasmática para MMP-2 e MMP-9 entre o epitélio acinar e o estroma periacinar, quanto aos
Criptococose canina: relato de caso Canine ocular cryptococcosis: a case report

Directory of Open Access Journals (Sweden)

C.E. Larsson

2003-10-01

Full Text Available Descreve-se, pela primeira vez no Brasil, um caso de criptococose canina com acometimento oftalmo e dermatopático, com diagnóstico intra-vitam, em animal da raça Pastor Alemão, fêmea, com 24 meses de vida, criado em São Paulo, em contacto com outros cinco cães assintomáticos, que havia se infectado pelo contato com dejetos de pombos (Columba livia. Evoluia há 90 dias, com quadro tegumentar e ósseo, sintomas e lesões características, sendo, ainda, detectada forma assintomática de coriorretinite, de início unilateral. O diagnóstico foi estabelecido pelos dados da anamnese, dos exames físico, dermatológico e complementares (radiográfico, cultivo micológico, histopatologia de pele tendo-se evidenciado e isolado cepa de Criptococcus neoformans var. neoformans. Após nove meses de terapia com itraconazol (9mg/kg/SID/VO houve involução total do quadro, sem qualquer efeito adverso à droga.A case of cryptococcosis with ocular and cutaneous involvement is reported by the first time in Brazil in a dog. A two-year-old female German Shepherd living in a hold house with other five healthy dogs was infected through the contact with pigeon (Columba livia feces. The illness started 90 days previously with cutaneous and bone involvement resulting in characteristic clinical signs and lesions, in addition to a initially unilateral asymptomatic chorioretinitis. The diagnosis was established based on anamnesis, physical and dermatologic examinations and complementary exams (radiographs, skin biopsy and histopathology and the isolation of a Cryptococcus neoformans var. neoformans strain was accomplished. There was a complete resolution of the disease after nine months of therapy using itraconazole (9mg/kg, q24h, PO and no side effect was observed.
Identificação das bactérias envolvidas na sepse grave de fêmeas caninas com piometra submetidas a ovário-histerectomia terapêutica

Directory of Open Access Journals (Sweden)

Tabatha do Amaral Kalenski

2012-04-01

Full Text Available A piometra é uma afecção reprodutiva comum que acomete fêmeas caninas, podendo se agravar e progredir para o quadro de sepse grave e choque séptico. A precocidade da instituição da antibioticoterapia é determinante para um melhor prognóstico. O objetivo deste estudo foi avaliar os principais microrganismos envolvidos nos casos de sepse grave em cadelas acometidas por piometra e submetidas à ovário-histerectomia terapêutica, por meio de realização de hemocultura e cultura da secreção uterina e antibiograma. Foram avaliadas 33 fêmeas caninas e o principal agente envolvido com a sepse grave secundária à piometra foi a Escherichia coli, identificada em 57,57% dos casos. Também foram identificados Staphylococcus sp., com incidência de 9,09%, Citrobacter koseri, Enterobacter cloacae, Enterobacter faecalis, Eduardsiella sp., Klebsiella pneumoniae e Streptococcus sp., com 3,03% de frequência cada. Após a realização do antibiograma pelo método de difusão, os antimicrobianos que apresentaram maior eficácia contra as cepas de Escherichia coli foram a gentamicina, a enrofloxacina, a cefalexina e a associação de amoxicilina com ácido clavulânico, nesta ordem. A cultura da secreção uterina foi mais sensível que a hemocultura para identificação do agente microbiano (p<0,0001. A identificação bacteriana é útil para direcionar a antibioticoterapia empírica mais específica, de acordo com o perfil de sensibilidade, minimizando assim o desenvolvimento de resistência, o custo do tratamento e o risco de reações adversas aos antimicrobianos utilizados.
Diphyllobothrium sp. in Canis familiaris from the subtropical area of Argentina (Puerto Iguazú, Misiones).

Science.gov (United States)

Rivero, María R; Motta, Carlos E; Salas, Martín M; Chiaretta, Alicia; Salomón, Oscar D

2015-01-01

This paper reports the first finding of Diphyllobothrium sp. eggs in Canis familiaris (domestic dog) from Puerto Iguazú, a subtropical city of Misiones province, Argentina. In 2013, two positive cases of Diphyllobothrium sp. eggs were detected during an annual parasitological survey of dogs. Dog feces were collected in vials containing 10% formalin and processed using Telemann's sedimentation and Sheather's flotation techniques. The two cases were detected in rural areas of the municipality. Since Misiones is not a part of the endemic area of diphyllobothriasis and given the fact that it is located in the three-border area of Argentina, Brazil and Paraguay, we consider this finding of great importance to public health. We stress the need for updating the current knowledge about the life cycle of these parasites considering the range of intermediate and definitive hosts, their zoonotic potential, and the epidemiological situation in non-endemic areas. Copyright © 2015 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Estimativa de populações canina e felina domiciliadas em zona urbana do Estado de São Paulo Estimate of the owned canine and feline populations in urban area in Brazil

Directory of Open Access Journals (Sweden)

Ricardo Augusto Dias

2004-08-01

Full Text Available OBJETIVO: Dada a importância do conhecimento acerca da população de cães e gatos domiciliados para o adequado planejamento e avaliação das ações de controle da raiva em áreas urbanas, propõe-se a utilização de um valor preciso de estimativa dessas populações com base em indicadores populacionais humanos. MÉTODOS: Foi calculada a razão entre as populações humana e animal (canina e felina por meio de inspeções domiciliares, no Município de Taboão da Serra, SP. O município foi dividido em duas áreas homogêneas distintas socioeconomicamente, de acordo com o algoritmo da média k, de modo a permitir a comparação das razões homem:animal (cão e gato das áreas homogêneas. RESULTADOS: A razão entre a população humana e a população canina foi 5,14 e a entre a humana e a felina foi 30,57. Não foi observada diferença significativa ao comparar-se as razões entre as populações humana e animal das áreas homogêneas. CONCLUSÕES: A adoção de uma metodologia de estimativa populacional canina e felina domiciliada, baseada em indicadores populacionais humanos, é a mais indicada e facilmente exeqüível quando comparada ao censo canino.OBJECTIVE: Given the importance of assessing owned dog and cat populations to adequate planning and evaluation of rabies control measures in urban areas, it is proposed the use of an estimate of these populations based on human population parameters. METHODS: The ratio between human population and owned animal (dogs and cats population was calculated in the municipality of Taboão da Serra, state of São Paulo, Brazil. This municipality was divided into two distinct social and economic homogeneous areas through k-mean algorithm, allowing for comparison between the ratios of the two homogeneous areas. RESULTS: A 5.14 ratio was calculated for human and dog populations and a 30.57ratio for human and feline populations. A significant difference was not observed when comparing the ratios for
SEROPREVALENCIA DE LA LEPTOSPIROSIS CANINA DE TRES MUNICIPIOS DEL DEPARTAMENTO DEL TOLIMA-COLOMBIA

Directory of Open Access Journals (Sweden)

Marlyn Romero P

2009-08-01

Full Text Available Objetivo. Determinar la seroprevalencia de Leptospira spp. y los serovares dominantes, en caninos de tres municipios del departamento del Tolima, Colombia. Materiales y métodos. Se realizó un estudio epidemiológico trasversal con 900 caninos localizados en 62 barrios de los tres municipios, de los cuales se obtuvieron muestras de sangre durante los meses de junio, julio y agosto de 2007, que fueron procesadas utilizando la prueba de microaglutinación (MAT. En la prueba se incluyeron 5 serovares: hardjo, pomona, grippotyphosa, canicola, icterohaemorrhagiae y bratislava. La prueba se interpretó como positiva por la presencia de una aglutinación ³50 % de las leptospiras con uno o más serovares, en una dilución del suero ³100. Resultados. La seroprevalencia de leptospirosis en la población canina fue del 20.2%. La mayor dominancia fue para los serovares grippotyphosa (82.4% y pomona (8.2%, observándose una baja reactividad ante canicola e icterohaemorrhagiae, 0.5 y 2.2% respectivamente. Se presentaron coaglutinaciones en el 4.3% de los sueros. La seropositividad presentó diferencias estadísticamente significativas cuando se compararon los resultados por sexo y edad (p=0.038. Conclusiones. Los resultados sugieren que los caninos pueden ser posibles reservorios de la leptospirosis en los tres municipios evaluados, siendo necesario realizar estudios que permitan el aislamiento y tipificación de los serovares prevalentes en las zonas endémicas para orientar las medidas de prevención que eviten el riesgo de transmisión de la enfermedad a la población humana.
Efecto del sacrificio de perros vagabundos en el control de la rabia canina

Directory of Open Access Journals (Sweden)

Ricardo Castillo-Neyra

Full Text Available En la ciudad de Arequipa, Perú, se han detectado perros con rabia desde marzo de 2015, señal de la reintroducción del virus de la rabia (VR en esta zona previamente declarada libre de esta enfermedad. La alta densidad de perros vagabundos ha sido considerada una de las causas de la continua transmisión del VR en el brote de la ciudad de Arequipa, alentando el sacrificio de perros como medida de salud pública. Sin embargo, la efectividad de esta medida de control no ha sido evaluada. El objetivo de esta revisión fue determinar la efectividad del sacrificio de perros vagabundos como medida de control de la rabia urbana. Se realizó la búsqueda de artículos sobre control de rabia canina o urbana en las bases de datos de Medline, Scopus y LILACS. Se incluyeron estudios originales y revisiones que hayan evaluado algún efecto del sacrificio de perros en la transmisión del VR. Veinte de 21 artículos concluyen que el sacrificio de perros vagabundos es inefectivo en reducir la trasmisión del VR e, incluso, puede tener consecuencias imprevistas que empeoren el problema. En conclusión, la evidencia disponible indica que sacrificar perros vagabundos no es efectivo para controlar la rabia urbana. Además, las diversas consecuencias negativas del sacrificio de los perros vagabundos reportadas en otras partes del mundo sugieren que el sistema de rabia urbana es altamente complejo y todos sus componentes deben ser tomados en cuenta durante la implementación de actividades de control.
Effect of DNA extraction in the Rosa canina L. identification under different processing temperature

Directory of Open Access Journals (Sweden)

Jana Žiarovská

2017-01-01

Full Text Available Rosa canina, L. is widely used for medicinal purposes as well as in food industry where it is a valuable source, bioactive compounds and natural colorants. Actually, no specific method is recommended as suitable one for DNA extraction from rose hips. The aim of the study was to compare three commercial and three non-commercial methods to extract total genomic DNA from rose hips hyphanthium. Four methods are based on the precipitation in principle and two methods are based on resin-binding. Extracted DNA was proved for the effectivity in following PCR. In total, six different DNA isolations was performed for differently heat processes rose hips - fresh hyphanthium, 2-weeks frozen hyphanthium, dried hyphanthium (50 °C and boiled hyphanthium (100 °C. The amplification parameters of 500 bp chloroplast gene amplicon were evaluated. Obtained amounts of extracted DNA was very variable not only for every individual method used but for individual treatment of samples, too. In general, non-commercial method provided higher amount of extracted DNA, but the A260/280 ratio was lower. When regarding the processing treatment of the samples, high differences were found among the samples untreated by heat and those that were dried or boiled for three of the used extraction methods. All the samples were positive for amplification, but different amounts of amplified product were obtained. The comparison of data for concentrations of extracted DNA and concentrations of amplified product showed large differences when regarding the achieved purity of DNA in extraction.
Patologias genitais associadas à leishmaniose visceral canina Genital pathologies associated with canine visceral leishmaniasis

Directory of Open Access Journals (Sweden)

Vinícius Vasconcelos Gomes de Oliveira

2012-09-01

Full Text Available A leishmaniose visceral canina (LVC é uma doença parasitária crônica causada por protozoários pertencentes ao gênero Leishmania. No Brasil, a transmissão se dá, principalmente, pela ação hematófaga de insetos vetores pertencentes à subfamília Phlebotominae, particularmente, a espécie Lutzomyia longipalpis. Todavia, a trasmissão vertical e venérea da LVC está presente. Os principais sinais clínicos observados nos animais acometidos pela LVC são linfoadenomegalia, dermatopatias, hepatoesplenomegalia, onicogrifose e oftalmopatias, contudo quadros atípicos podem ser observados, inclusive com o envolvimento do sistema genital. Dessa forma, o objetivo deste artigo é realizar revisão sobre as principais patologias genitais em cães machos e fêmeas com leishmaniose visceral (LV.The canine visceral leishmaniasis (CanL is a chronic parasitic disease caused by protozoa belonging to the genus Leishmania. In Brazil, the transmission occurs mainly by the action of blood-sucking insects belonging to the subfamily Phlebotominae, particularly the Lutzomyia longipalpis species. However, the venereal and vertical transmission of the CanL is present. The main clinical signs observed in animals affected by the CanL are lymphadenopathy, skin diseases, hepatosplenomegaly, onychogryphosis and ophthalmopathy, however atypical manifestations can be observed, including the involvement of the genital system. Thus, the aim of this paper is to review on the major pathologies in genital male and female dogs with visceral leishmaniasis (VL.
ESTUDIO SEROLÓGICO DE BRUCELOSIS CANINA EN DOS ALBERGUES DEL MUNICIPIO DE ENVIGADO, COLOMBIA (2011

Directory of Open Access Journals (Sweden)

P. Agudelo

2014-01-01

Full Text Available El objetivo de este estudio fue buscar la presencia de anticuerpos de brucelosis en la población de dos albergues caninos del municipio de Envigado (Antioquia, Colombia y a tal fin se seleccionaron 54 perros. Se tomaron muestras sanguíneas en 10 machos y 44 hembras que fueron procesadas bajo la técnica de inmunocromatografía para Brucella canis. No hubo diferencia estadística entre albergues en los parámetros ‘sexo’ y ‘raza’ de cada grupo de estudio y tampoco se encontró evidencia serológica de la presencia de brucelosis canina en el grupo de animales muestreados. Los resultados indican que, aunque los animales permanecieron en calidad de abandono durante un período de su vida, su condición feral no era permanente debido a que en el momento del estudio se encontraban en albergues. Las políticas intensivas de recolección se orientan más a la atención de mascotas abandonadas que a aquellos animales ferales (los cuales, con mayor frecuencia, pueden ser portadores de la enfermedad. El tipo de población in - cluida en el estudio, sumado a la práctica estricta de esterilización inmediata dentro del albergue —que a su vez impide los apareamientos entre individuos—, pueden incidir en la reducción la propagación de la enfermedad en el municipio.
XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris).

Science.gov (United States)

Meyers-Wallen, Vicki N; Boyko, Adam R; Danko, Charles G; Grenier, Jennifer K; Mezey, Jason G; Hayward, Jessica J; Shannon, Laura M; Gao, Chuan; Shafquat, Afrah; Rice, Edward J; Pujar, Shashikant; Eggers, Stefanie; Ohnesorg, Thomas; Sinclair, Andrew H

2017-01-01

Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD) remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens) and dogs (C. familiaris). Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1) a variant associated with XX DSD in the canine model and 2) gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS) and whole genome sequencing (WGS), we identified a variant on C. familiaris autosome 9 (CFA9) that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq) in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.
XX Disorder of Sex Development is associated with an insertion on chromosome 9 and downregulation of RSPO1 in dogs (Canis lupus familiaris.

Directory of Open Access Journals (Sweden)

Vicki N Meyers-Wallen

Full Text Available Remarkable progress has been achieved in understanding the mechanisms controlling sex determination, yet the cause for many Disorders of Sex Development (DSD remains unknown. Of particular interest is a rare XX DSD subtype in which individuals are negative for SRY, the testis determining factor on the Y chromosome, yet develop testes or ovotestes, and both of these phenotypes occur in the same family. This is a naturally occurring disorder in humans (Homo sapiens and dogs (C. familiaris. Phenotypes in the canine XX DSD model are strikingly similar to those of the human XX DSD subtype. The purposes of this study were to identify 1 a variant associated with XX DSD in the canine model and 2 gene expression alterations in canine embryonic gonads that could be informative to causation. Using a genome wide association study (GWAS and whole genome sequencing (WGS, we identified a variant on C. familiaris autosome 9 (CFA9 that is associated with XX DSD in the canine model and in affected purebred dogs. This is the first marker identified for inherited canine XX DSD. It lies upstream of SOX9 within the canine ortholog for the human disorder, which resides on 17q24. Inheritance of this variant indicates that XX DSD is a complex trait in which breed genetic background affects penetrance. Furthermore, the homozygous variant genotype is associated with embryonic lethality in at least one breed. Our analysis of gene expression studies (RNA-seq and PRO-seq in embryonic gonads at risk of XX DSD from the canine model identified significant RSPO1 downregulation in comparison to XX controls, without significant upregulation of SOX9 or other known testis pathway genes. Based on these data, a novel mechanism is proposed in which molecular lesions acting upstream of RSPO1 induce epigenomic gonadal mosaicism.
Organohalogens in A Whale-Blubber-Supplemented Diet Affects Hepatic Retinol and Renal Tocopherol Concentrations in Greenland Sled Dogs (Canis familiaris)

DEFF Research Database (Denmark)

Kirkegaard, M.; Sonne, C.; Jakobsen, Jette

2010-01-01

The aim of this study was to examine the plasma, liver, and kidney status of vitamin A (retinol) and vitamin E (-tocopherol) in two groups of Greenland sled dogs (Canis familiaris), with a total number of 16 bitches and 8 pups. The dogs were fed either minke whale (Balaenoptera acuterostrata...... polychlorinated biphenyls [PCB]). Retinol was approximately 18% and -tocopherol 22% higher in the diet of the exposed dogs compared to controls. In adipose tissue, mean of sigma OHC was 92 ng/g lipid weight (lw) and 5005 ng/g lw for all control (n = 12) and exposed dogs (n = 10), respectively. Hepatic retinol...... correlated negatively with sigma-dichlorodiphenyldichloroethane (sigma DDT) and and sigma-polybrominated diphenyl ethers (sigma PBDE) for all exposed animals. A negative correlation between kidney -tocopherol and sigma PCB concentrations was observed, whereas two positive significant correlations were...

Biogas production from spent rose hips (Rosa canina L.): fraction separation, organic loading and co-digestion with N-rich microbial biomass.

Science.gov (United States)

Osojnik Črnivec, Ilja Gasan; Muri, Petra; Djinović, Petar; Pintar, Albin

2014-11-01

Complex waste streams originating from extraction processes containing residual organic solvents and increased C/N ratios have not yet been considered as feedstock for biogas production to a great extent. In this study, spent rosehip (Rosa canina L.) solid residue (64%VS, 22 MJ/kg HHV, 30C/1N) was obtained from an industrial ethanol aided extraction process, and extensively examined in an automated batch bioreactor system for biogas production. Fraction separation of the compact lignocellulosic seeds increased the available sugar and ethanol content, resulting in high biogas potential of the sieved residue (516 NL/kg VS'). In co-digestion of spent rosehip substrate with non-deactivated nitrogen rich microbial co-substrates, methanogenesis was favored (Y(m) > 68%(CH4)). In individual digestion of microbial co-substrates, this was not the case, as biogas with 28 vol.% N2 was produced from activated sludge supplement. Therefore, effective inhibition of exogenous microbiota was achieved in the presence of carbonaceous spent rose hip. Copyright © 2014 Elsevier Ltd. All rights reserved.
Leishmaniose Canina em Brasília, DF: Uma Revisão da Literatura.

Directory of Open Access Journals (Sweden)

Tatyere Constâncio de SOUSA

2015-09-01

Full Text Available A leishmaniose é uma doença infecto-parasitária que acomete seres humanos e animais, causada por protozoários do gênero Leishmania. As leishmanioses são importante problema de saúde pública em vários países e estão incluídas entre as seis endemias de maior relevância mundial. São classificadas em tegumentar (LT cutânea e mucocutânea - e visceral (LV. A transmissão ocorre através de picada de insetos flebotomíneos pertencentes aos gêneros Lutzomyia (Novo Mundo e Phlebotomus(Velho Mundo. A Leishmaniose Tegumentar Americana (LTA é uma zoonose distribuída no território brasileiro. Possui evolução crônica e acomete a pele e mucosas, isoladamente ou em associação, de seres humanos, cães, gatos e eqüinos. Nos cães, se caracteriza pela presença de lesões cutâneas ulceradas, recobertas por crostas, localizadas nas orelhas, bolsa escrotal, focinho e membros. A Leishmaniose visceral é uma zoonose que ocorre nas regiões subtropicais e tropicais, causada pela Leishmania (Leishmania chagasi, no Novo e no Velho Mundo. No Brasil, a Leishmaniose Visceral Canina (LVC coexiste com a doença humana e os cães são seu reservatório doméstico. A eutanásia do cão é criticada por isso enfrenta limitações. Apesar das ações de vigilância e controle de LV adotadas no DF, a doença permanece em áreas urbanas e rurais.
Distribuição espacial e temporal da raiva canina e felina em Minas Gerais, 2000 a 2006 Spatial and temporal distribution of canine and feline rabies in Minas Gerais, Brazil, from 2000 to 2006

Directory of Open Access Journals (Sweden)

A.D. Barbosa

2008-08-01

Full Text Available Estudou-se a epidemiologia da raiva em cães e gatos, em Minas Gerais, e realizou-se um estudo descritivo de seu comportamento, de 2000 a 2006. Utilizaram-se, como fonte de dados, os relatórios mensais dos laboratórios do Centro de Controle de Zoonoses de Belo Horizonte e do Instituto Mineiro de Agropecuária. Os resultados demonstraram positividade de 1,5% para raiva canina e 0,7% para raiva felina. Houve tendência ao decréscimo do número de casos positivos de raiva canina (y = -3,2143x + 19,714 e também para a raiva felina, com apenas dois casos, ambos em 2000. As regiões com diagnóstico positivo coincidiram com as de menor desenvolvimento sócioeconômico.In order to know the epidemiology of rabies in dogs and cats, in Minas Gerais State, a descriptive study of its behavior was carried out from 2000 to 2006. Data of monthly reports colleted at the laboratories of "Centro de Controle de Zoonoses (CCZ" from Belo Horizonte" and "Instituto Mineiro de Agropecuária (IMA" were used. Positivity of 1.50% for canine rabies and 0.70% for feline rabies were observed. A tendency to the decrease of canine rabies positive cases was found (y= -3.2143x + 19.714 and the same was observed for cats, since only two cases occurred, both in 2000. The regions that present positive diagnostics also showed the lowest social economic development.
The effect of oxytocin on biological motion perception in dogs (Canis familiaris).

Science.gov (United States)

Kovács, Krisztina; Kis, Anna; Kanizsár, Orsolya; Hernádi, Anna; Gácsi, Márta; Topál, József

2016-05-01

Recent studies have shown that the neuropeptide oxytocin is involved in the regulation of several complex human social behaviours. There is, however, little research on the effect of oxytocin on basic mechanisms underlying human sociality, such as the perception of biological motion. In the present study, we investigated the effect of oxytocin on biological motion perception in dogs (Canis familiaris), a species adapted to the human social environment and thus widely used to model many aspects of human social behaviour. In a within-subjects design, dogs (N = 39), after having received either oxytocin or placebo treatment, were presented with 2D projection of a moving point-light human figure and the inverted and scrambled version of the same movie. Heart rate (HR) and heart rate variability (HRV) were measured as physiological responses, and behavioural response was evaluated by observing dogs' looking time. Subjects were also rated on the personality traits of Neuroticism and Agreeableness by their owners. As expected, placebo-pretreated (control) dogs showed a spontaneous preference for the biological motion pattern; however, there was no such preference after oxytocin pretreatment. Furthermore, following the oxytocin pretreatment female subjects looked more at the moving point-light figure than males. The individual variations along the dimensions of Agreeableness and Neuroticism also modulated dogs' behaviour. Furthermore, HR and HRV measures were affected by oxytocin treatment and in turn played a role in subjects' looking behaviour. We discuss how these findings contribute to our understanding of the neurohormonal regulatory mechanisms of human (and non-human) social skills.
Taxonomy Icon Data: dog [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available dog Canis lupus familiaris Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Canis_lupus..._familiaris_L.png Canis_lupus_familiaris_NL.png Canis_lupus_familiaris_S.png Canis_lupus_familiari...s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=L http://biosciencedbc.jp.../taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NL http://biosciencedbc.jp/tax...onomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Canis+lupus+familiaris&t=NS ...
Aspectos clínicos, morfológicos e imuno-histoquímicos da pitiose gastrintestinal canina

Directory of Open Access Journals (Sweden)

Maria E. Trost

2009-08-01

Full Text Available Através de um estudo retrospectivo dos casos de biópsias e necropsias de cães recebidos no Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria, constatou-se a ocorrência de dois casos confirmados e de quatro casos suspeitos de pitiose gastrintestinal canina. Os dois casos diagnosticados e publicados tiveram a etiologia confirmada através da cultura e indução de zoosporogênese ou por nested-PCR. Neste estudo utilizou-se a técnica de imuno-histoquímica com anticorpo policlonal anti-Pythium insidiosum para confirmação da etiologia dos quatro casos suspeitos. A epidemiologia, sinais clínicos, lesões macroscópicas e microscópicas, características histoquímicas e imuno-histoquímicas e diagnósticos diferenciais são relatados e discutidos.Four suspect and two confirmed cases of gastrointestinal pythiosis were found in a retrospective study of biopsy and necropsy cases of dogs received in the Laboratório de Patologia Veterinária at the Universidade Federal de Santa Maria. The two diagnosed and published cases have had the etiology confirmed by culture and zoosporogenesis induction or by nested-PCR. On this study, the etiologic diagnosis of four suspect cases was confirmed by immunohistochemistry using anti-Pythium insidiosum policlonal antibody. Epidemiology, clinical signs, gross and microscopic lesions, histochemistry, immunohistochemistry, and differential diagnoses are reported and discussed.
Outbreak of autochthonous canine visceral leishmaniasis in Santa Catarina, Brazil Surto autóctone de leishmaniose visceral canina no Estado de Santa Catarina

Directory of Open Access Journals (Sweden)

Mário Steindel

2013-04-01

Full Text Available The present study reports the first outbreak of autochthonous canine visceral leishmaniasis in Florianópolis, Santa Catarina, southern Brazil. Following the report of two cases of CVL, the Control Center of Zoonotic Diseases conducted a serological survey by ELISA and IFAT assays in seven districts of the Santa Catarina Island. Eleven seropositive dogs of autochthonous transmission were used in the present study. Infection by Leishmania sp. was confirmed by parasitological examination of bone marrow, liver, spleen and lymph nodes, culture in Schneider's medium and PCR. Leishmania sp. isolates were characterized by PCR-RFLP and hybridization with specific probes, allowing for the identification of Leishmania infantum. Autochthonous transmission of this disease in an area with high tourist traffic presents a major public health concern and signifies the emergence of an important zoonosis in southern Brazil. Therefore, the implementation of surveillance and control measures is imperative to prevent the spread of the disease among the canine population as well as transmission to the human population.O presente estudo relata o primeiro surto autóctone de leishmaniose visceral canina (LCV em Florianópolis, Santa Catarina, Brasil. Durante levantamento soro-epidemiológico realizado pelo Centro de Controle de Doenças Zoonóticas (CCZ envolvendo 2.124 cães, 29 (1,37% foram soropositivos para VL (ELISA + RIFI. Onze cães positivos por transmissão autóctone foram utilizados no presente estudo. A confirmação da infecção por Leishmania sp. foi realizada pelo exame parasitológico da medula óssea, fígado, baço e linfonodos, cultura em meio Schneider e PCR. Os isolados de Leishmania sp. foram caracterizados por PCR-RFLP e hibridação com sondas específicas, permitindo a identificação de Leishmania infantum. A transmissão autóctone da LCV em uma área com grande fluxo turístico como Florianópolis representa um preocupante risco à saúde p
Effects of Fruit of Rosa Canina L.Extract on the Level of Plasma Glucose in Male Diabet-Induced Rats

Directory of Open Access Journals (Sweden)

A Mohammad Eini

2016-03-01

Full Text Available Introduction: Diabetes mellitus is one of the most prevalent chronic and complex metabolic diseases of human , which hyperglycemia can be mentioned as its prominent characteristic. Therefore, this study aimed to evaluate the hypoglycemic effects of fruit of Rosa canina (R.c. extract in healthy and diabetic rats. Method: A total of 72 Wistar male rats were divided into six group: control, STZ (diabetic control, R.c. control (50 mg/kg, R.c. control (100 mg/kg and two experimental groups with 50, and 100 mg/kg of extract dose. Diabetes was induced using streptozotocine (60 mg/kg; IP, and blood collection was carried out on 0, 2 and 4 hours after the oral administration of the extracts. Results: The levels of plasma glucose were determined by spectrophotometric method. In order to statistically analyze the study data, ANOVA test was performed. There was a significant difference between groups concerning the plasma glucose concentration (P<0.0001, which the lowest concentration between diabetes groups was observed in the two experimental groups. Moreover, R.c. had a marked hypoglycemic effect on diabetes mellitus. Conclusion: R.c. extract in hyperglycemic status demands to be further studied in order to control and prevent its complications.
Risk evaluation of the Arctic environmental POP exposure based on critical body residue and critical daily dose using captive Greenland sledge dogs (Canis familiaris) as surrogate species

DEFF Research Database (Denmark)

Sonne, Christian; Gustavson, Kim; Eulaers, Igor

2016-01-01

The risk from POP (persistent organic pollutant) exposure and subsequent reproductive, immunotoxic and liver histopathological effects was evaluated in a classical parallel trial on Greenland sledge dogs (Canis familiaris) fed contaminated minke whale (Balaenoptera acutorostrata) blubber. First...... quotients (RQDD: DD/CDD; RQBR: BR/CBR; ≥1 indicates risk). The results showed that risk quotients for reproductive, immunotoxic and liver histopathological effects were significantly lowest in the control group (p... on body residues (RQBR) (all preproductive and immunotoxic effects while those for liver histopathological effects ranged from 0.7-3.0. PCBs (polychlorinated biphenyls) and chlordanes were the dominant driver behind high immune and reproductive RQs...
Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006

Directory of Open Access Journals (Sweden)

Diana Rubel

2010-08-01

Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.
Genome-wide identification and analysis of basic helix-loop-helix domains in dog, Canis lupus familiaris.

Science.gov (United States)

Wang, Xu-Hua; Wang, Yong; Liu, A-Ke; Liu, Xiao-Ting; Zhou, Yang; Yao, Qin; Chen, Ke-Ping

2015-04-01

The basic helix-loop-helix (bHLH) domain is a highly conserved amino acid motif that defines a group of DNA-binding transcription factors. bHLH proteins play essential regulatory roles in a variety of biological processes in animal, plant, and fungus. The domestic dog, Canis lupus familiaris, is a good model organism for genetic, physiological, and behavioral studies. In this study, we identified 115 putative bHLH genes in the dog genome. Based on a phylogenetic analysis, 51, 26, 14, 4, 12, and 4 dog bHLH genes were assigned to six separate groups (A-F); four bHLH genes were categorized as ''orphans''. Within-group evolutionary relationships inferred from the phylogenetic analysis were consistent with positional conservation, other conserved domains flanking the bHLH motif, and highly conserved intron/exon patterns in other vertebrates. Our analytical results confirmed the GenBank annotations of 89 dog bHLH proteins and provided information that could be used to update the annotations of the remaining 26 dog bHLH proteins. These data will provide good references for further studies on the structures and regulatory functions of bHLH proteins in the growth and development of dogs, which may help in understanding the mechanisms that underlie the physical and behavioral differences between dogs and wolves.
Accidentes por mordedura canina, casos registrados en un hospital de niños de Lima, Perú 1995 - 2009 Dog bite accidents in a children hospital at Lima, Peru. Retrospective study from 1995 - 2009

Directory of Open Access Journals (Sweden)

Carmen Morales

2011-12-01

Full Text Available Entre 1995 a 2009 se registraron 206 hospitalizaciones en el Instituto Nacional de Salud del Niño debido a accidentes por mordedura canina. La mediana de edad de los pacientes fue cuatro años y para los días de hospitalización tres. El 61,7 % fueron varones. Los accidentes ocurrieron en el domicilio de una tercera persona (39,3 %, en vía pública (33,5 % y en el domicilio del agredido (27,2 %. El 66,5 % de los episodios fueron precedidos por un estímulo del niño y el 88,8 % causado por animales reconocidos por los lesionados. El 34,0 % reconoció la raza del animal (52,9 % animales cruzados. El 79,1 % fueron lesiones múltiples y la región anatómica más afectada fueron la cabeza y cuello (79,1 %. Se registraron complicaciones en un 20,4 % y secuelas estéticas en el 94,7 %. Las mordeduras caninas afectan la salud física de los niños.From 1995 to 2009, 206 cases of dog bites were recorded among hospitalized patients at the Children National Health of, Lima-Peru. The median of age was 4 years, and for hospitalization time was 3 days. Most patients were males (61.7 %. The bites occurred in the house of a third person (39.3 %, on the street (33.5 %, or in the victim’s house (27.2 %. A 66.5 % of the bites were provoked and 88.8 % were from animals known to the victim. The dog breed was recognized in 34 % (52.9 % were mongrel dogs. Multiple lesions were identified in 79.1 %, and the most frequently bitten areas were head and neck (79.1 %. Complications were reported in 20.4 % and aesthetic sequelae in 94.7 %.
Phytochemical composition and in vitro pharmacological activity of two rose hip (Rosa canina L.) preparations.

Science.gov (United States)

Wenzig, E M; Widowitz, U; Kunert, O; Chrubasik, S; Bucar, F; Knauder, E; Bauer, R

2008-10-01

The aim of the present study was to compare powdered rose hip with and without fruits (Rosae pseudofructus cum/sine fructibus, Rosa canina L., Rosaceae) with regard to their phytochemical profile and their in vitro anti-inflammatory and radical-scavenging properties. The two powders were subsequently extracted with solvents of increasing polarity and tested for inhibition of cyclooxygenase (COX-1, COX-2) and of 5-LOX-mediated leukotriene B(4) (LTB(4)) formation as well as for DPPH-radical-scavenging capacity. While the water and methanol extracts were inactive in the COX-1, COX-2 and LTB(4) inhibition assays, the n-hexane and the dichloromethane extracts inhibited all three enzymes. In the active extracts, the triterpenoic acids ursolic acid, oleanolic acid and betulinic acid were identified, although only in minute amounts. Furthermore, oleic, linoleic and alpha-linolenic acid were identified apart from several saturated fatty acids. Even though unsaturated fatty acids are known to be good inhibitors of COX-1, COX-2 and LT formation, no clear correlation between their concentration in the extracts and their activity was found. We suggest that other, yet unidentified, lipophilic constituents might play a more important role for the observed in vitro inhibitory activity on arachidonic acid metabolism. Some of the extracts also showed considerable DPPH radical scavenging activity, the methanolic extracts being most potent. The radical scavenging activity of the extracts correlated very well with their total phenolic content, while ascorbic acid contributes only little to the radical-scavenging activity due to its low concentration present in the extracts. In summary, extracts derived from powdered rose hip without fruits were more effective in all assays carried out compared with extracts derived from powdered rose hip with fruits.
Soroepidemiologia da leptospirose canina na região metropolitana de Natal, estado do Rio Grande do Norte

Directory of Open Access Journals (Sweden)

Annielle Regina da Fonseca Fernandes

2013-06-01

Full Text Available Objetivou-se com este estudo determinar a frequência de cães soropositivos para anticorpos anti-Leptospira spp. no município de Natal e região metropolitana, estado do Rio Grande do Norte, e identificar fatores de risco associados à infecção. Foram examinadas 365 amostras de soro sanguíneo de cães atendidos na rotina de diversas clínicas veterinárias durante o período de março a novembro de 2011. O diagnóstico sorológico da leptospirose foi realizado pela técnica de soroaglutinação microscópica (SAM, utilizando-se 24 sorovares de Leptospira spp. como antígenos. Dos 365 cães, 25 foram soropositivos para pelo menos um dos sorovares de Leptospira spp., com frequência de 6,8%. Os sorovares com reações sorológicas mais frequentes foram Shermani (40%, Sentot (36% e Copenhageni (20%. O perfil epidemiológico da leptospirose canina na região metropolitana de Natal, estado do Rio Grande do Norte, indica que a infecção ocorre com frequência baixa em comparação com outras regiões, provavelmente devido ao grande percentual de animais vacinados, bem como, sugere-se distribuição homogênea de animais soropositivos na região. Por outro lado, a presença de roedores pode ser um importante fator de risco, uma vez que sorovares mantidos por estes animais foram identificados entre os mais frequentes.
Dogs' (Canis familiaris) attention to human perception: Influence of breed groups and life experiences.

Science.gov (United States)

Heberlein, Marianne T E; Turner, Dennis C; Manser, Marta B

2017-02-01

Attending to the perception of others may help individuals gaining information from conspecifics, or help in competitive situations. Dogs (Canis familiaris) are attentive to humans' signals and their attentional state. We investigated whether dogs of different breed groups differ in their ability to pay attention to human's perception, first according to the genetic relatedness between dog breeds, and second according to working style differences. Once dogs had learned to leave forbidden food on the floor, they were confronted with 2 food items to which only they had unrestricted visual access. The owners saw either none or 1 food item through a transparent barrier. Our results showed that dogs pay attention to the perception of humans, whereby differences between breed groups became obvious. Within different genetic groups, ancient and hunting type dogs performed similarly, they were more attentive to their owners' perception than shepherd and the mastiff type dogs. When comparing dogs classified according to their working style, independent workers and family dogs were attentive to the owner's perception, while cooperative workers seemed not. The dogs' choice could not be explained by a general or training induced preference for eating behind an opaque screen, or by an influence of the owner's possible intention to prevent the dog from taking the food item he could see. Our study confirms that dogs are attentive/sensitive to human's perception, but genetic and working style differences among the breeds, as well as dog sport experiences explain part of the variation seen in their performance. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Associação de variáveis ambientais à ocorrência de leptospirose canina e humana na cidade de São Paulo

Directory of Open Access Journals (Sweden)

R.I. Cipullo

2012-04-01

Full Text Available Foi realizada uma análise espacial da ocorrência de leptospirose humana e canina na Supervisão de Vigilância em Saúde do Butantã, situada no município de São Paulo, no ano de 2007, associada a variáveis ambientais de risco, tais como: focos de enchente e áreas de desratização. Foram encontrados aglomerados espaciais de pontos de alagamentos em 12 setores censitários e de casos de leptospirose humana em quatro setores censitários, sem correlação entre ambos. Não foram encontrados agrupamentos de casos em cães, possivelmente devido à subnotificação. As proporções casos humanos de leptospirose : população humana dentro e fora da área de desratização foram 7:199.600 e 9:257.980, respectivamente. Conclui-se que medidas de controle de roedores como a desratização foram responsáveis pela minimização dos efeitos dos fatores de risco para a transmissão de leptospirose para humanos.
Who are the real bird brains? Qualitative differences in behavioral flexibility between dogs (Canis familiaris) and pigeons (Columba livia).

Science.gov (United States)

Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R

2016-01-01

Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.
Frost decreases content of sugars, ascorbic acid and some quercetin glycosides but stimulates selected carotenes in Rosa canina hips.

Science.gov (United States)

Cunja, Vlasta; Mikulic-Petkovsek, Maja; Zupan, Anka; Stampar, Franci; Schmitzer, Valentina

2015-04-15

Primary and secondary metabolites of Rosa canina hips were determined by HPLC/MS during ripening and after frost damage. Rose hips were harvested six times from the beginning of September until the beginning of December. Color parameters a*, b* and L* decreased during maturation. Glucose and fructose were the predominant sugars representing up to 92% total sugars, and citric acid was the major organic acid detected in rose hips (constituting up to 58% total organic acids). Total sugar and ascorbic acid content significantly decreased after frost damage; from 42.2 to 25.9 g 100 g(-1) DW for sugars and from 716.8 to 176.0 mg 100 g(-1) DW for ascorbic acid. Conversely, β-carotene and lycopene levels increased in frostbitten rose hips to 22.1 and 113.2 mg 100 g(-1) DW, respectively. In addition to cyanidin-3-glucoside (highest level in hips was 125.7 μg 100 g (-1) DW), 45 different phenolic compounds have been identified. The most abundant were proanthocyanidins (their levels amounted up to 90% of total flavanol content) and their content showed no significant differences during maturation. The levels of catechin, phloridzin, flavanones and several quercetin glycosides were highest on the first three sampling dates and decreased after frost. Antioxidant capacity similarly decreased in frostbitten rose hips. Total phenolic content increased until the third sampling and decreased on later samplings. Copyright © 2015 Elsevier GmbH. All rights reserved.
GC×GC-TOF/MS Chromatographic Analysis, Antioxidant Capacity and Phenolic Content of Rosa Canina L. at Different Maturities

Directory of Open Access Journals (Sweden)

Dilek Ozyurt

2016-01-01

Full Text Available The relationship between food and health has become increasingly significant as consumers now demand healthy, tasty and natural foods which perform a useful function in the body. In Turkey, rose hip (Rosa canina L. is in popular use in foodstuffs such as marmalade, pestil (a traditional Turkish sweet and syrup or in traditional medicine, mainly as herbal tea. The composition, total antioxidant capacity (TAC and total phenolic content (TPC of volatiles of rose hip samples were compared in relation to their stage of maturity and collection location. Rose hip fruit and seed were analyzed using a direct thermal desorption technique coupled with comprehensive two-dimensional gas chromatography time-of-flight mass spectrometry (GCxGC-TOF/MS. The major components found in the volatile fraction released on extraction were free fatty acids. The various stages of maturity of rose hips (green, light yellow, yellow, orange and red coloured and the place of collection (Istanbul, Mersin, York resulted in some changes in volatile compound speciation, in TAC and TPC levels. Various extraction methods were compared; methanol extraction, traditional hot water infusion and boiling in water. Boiling in water for ten minutes was the method which demonstrated the highest extraction efficiency. TAC and TPC were determined using different electron transfer−based assays; the Cerium (IV ions reducing antioxidant capacity, Cupric Reducing Antioxidant Capacity and Folin-Ciocalteu methods. The highest TAC and TPC were found in the red coloured (fully ripe rose hip fruit, suggesting that colour is a suitable indicator for optimal harvesting time.
Domestic dogs' (Canis familiaris) choices in reference to information provided by human and artificial hands.

Science.gov (United States)

Kundey, Shannon M A; Delise, Justin; De Los Reyes, Andres; Ford, Kathy; Starnes, Blair; Dennen, Weston

2014-03-01

Even young humans show sensitivity to the accuracy and reliability of informants' reports. Children are selective in soliciting information and in accepting claims. Recent research has also investigated domestic dogs' (Canis familiaris) sensitivity to agreement among human informants. Such research utilizing a common human pointing gesture to which dogs are sensitive in a food retrieval paradigm suggests that dogs might choose among informants according to the number of points exhibited, rather than the number of individuals indicating a particular location. Here, we further investigated dogs' use of information from human informants using a stationary pointing gesture, as well as the conditions under which dogs would utilize a stationary point. First, we explored whether the number of points or the number of individuals more strongly influenced dogs' choices. To this end, dogs encountered a choice situation in which the number of points exhibited toward a particular location and the number of individuals exhibiting those points conflicted. Results indicated that dogs chose in accordance with the number of points exhibited toward a particular location. In a second experiment, we explored the possibility that previously learned associations drove dogs' responses to the stationary pointing gesture. In this experiment, dogs encountered a choice situation in which artificial hands exhibited a stationary pointing gesture toward or away from choice locations in the absence of humans. Dogs chose the location to which the artificial hand pointed. These results are consistent with the notion that dogs may respond to a human pointing gesture due to their past-learning history.

THE INFLUENCE OF TEMPERATURE AND TIME ON THE ANTIOXIDANT ACTIVITY AND COLOR PARAMETERS OF DOG-ROSE (ROSA CANINA ETHANOLIC EXTRACT

Directory of Open Access Journals (Sweden)

ELENA CRISTEA

2016-07-01

Full Text Available This paper presents the study of the stability of antioxidant activity and color of the 50 % ethanolic extract of dog-rose (Rosa canina from the Republic of Moldova with the main objective to test a food dye of natural origin. The extract was submitted to: -2 °C for 12 hours; 4 °C for 12 hours; 40 °C for 15 minutes, 60 °C for 15 minutes, 80 °C for 15 minutes and 100 °C for 2 minutes, after which the antioxidant activity and the color (CIELab parameters were measured. Three sets of extracts were kept for 2 weeks at -2 °C; 4 °C and 25 - 30 °C and afterwards the parameters mentioned above were measured once again. Moreover, the total content of polyphenols was determined by Folin-Ciocalteu method. The results were expressed in mg gallic acid equivalents per liter. The antioxidant activity was determined using the method based on the interaction with the ABTS radical, the results being expressed in mmol trolox equivalent per liter. Thermal treatments have not influenced antioxidant activity, but have significantly affected the extract by increasing its luminosity and changing the red/green parameter towards more red tones, while storage at -2 °C caused the decrease of yellowness. Storage at 4 °C was found to be optimal for the preservation of the antioxidant activity.
Neuropatologia da cinomose canina: 70 casos (2005-2008

Directory of Open Access Journals (Sweden)

Marcia C. Silva

2009-08-01

Full Text Available Este estudo teve como objetivo realizar uma investigação anátomo-patológica detalhada das lesões e sua distribuição no sistema nervoso central (SNC de cães com cinomose. Foram avaliadas secções padronizadas do encéfalo e da medula espinhal de 70 cães. Os casos foram agrupados de acordo com a idade dos cães e classificados conforme a evolução das lesões. Os resultados permitem concluir que: (1 encefalomielite induzida pelo vírus da cinomose canina é mais prevalente em filhotes e adultos; (2 lesões macroscópicas no SNC ocorrem com baixa freqüência; (3 o encéfalo é mais acometido do que a medula espinhal; (4 as cinco regiões anatômicas mais afetadas do encéfalo são, em ordem decrescente de freqüência, o cerebelo, o diencéfalo, o lobo frontal, a ponte e o mesencéfalo; (5 a região anatômica mais afetada da medula espinhal é o segmento cervical cranial (C1-C5; (6 lesões subagudas e crônicas são mais comuns do que lesões agudas; (7 desmielinização é a lesão mais prevalente e ocorre principalmente no cerebelo, na ponte e no diencéfalo, quase sempre acompanhada de astrogliose e inflamação não-supurativa; (8 na maior parte dos casos em que há astrogliose, observam-se astrócitos gemistocíticos, freqüentemente com formação de sincícios; (9 leptomeningite não-supurativa, malacia e necrose cortical laminar são lesões relativamente freqüentes no encéfalo, mas não na medula espinhal; (10 corpúsculos de inclusão no encéfalo são muito comuns, ocorrem principalmente em astrócitos e com freqüência menor em neurônios; no entanto, independentemente da célula afetada, são vistos predominantemente no núcleo; (11 uma classificação da encefalite na cinomose com base em síndromes clínicas relacionadas com a idade do cão é imprecisa.The current study was performed to determine the pathology and distribution of lesions in the central nervous system (CNS of 70 dogs naturally affected by canine
Avaliação da resposta imunológica de cães vacinados com a vacina FML (Leishmune®) e cães naturalmente infectados com leishmaniose visceral canina por meio de dois métodos sorológicos : ELISA e RIFI

OpenAIRE

Fabiana Farinello Grecco Barichello

2010-01-01

Resumo: A Leishmaniose Visceral Canina, doença grave e fatal, tem o cão como o principal reservatório do seu agente etiológico no meio urbano. Devido ao alto parasitismo cutâneo nestes animais, da quantidade de cães infectados, e do próximo convívio com o homem, as ações desenvolvidas pelo Programa Brasileiro de Controle da Leishmaniose Visceral são centradas no reservatório canino, através da identificação e eutanásia dos animais soropositivos. Sendo assim, a adoção de ações profiláticas, co...
La preparación al matrimonio según la Exhortación Apostólica Familiaris Consortio . Una reflexión sobre el documento en el 30 aniversario de su elaboración

Directory of Open Access Journals (Sweden)

Robert Kantor

2011-09-01

Full Text Available Marriage is an important event in the life of engaged couple as well as the whole community of believers. The preparation for marriage requires that the couple should be introduced into the Catholic ecclesial teaching about the rights and duties which result from contracted marriage. The article presents the issue of preparation for marriage; the stages according to the Apostolic Exhortation Familiaris Consortio . The study includes the following issues: the preparation stage; the need of preparation to marriage; stages and content of the preparation; people responsible for the preparation; permission to celebrate marriage of baptized individuals who are not suf fi ciently prepared.
Life cycle of Hepatozoon canis (Apicomplexa: Adeleorina: Hepatozoidae) in the tick Rhipicephalus sanguineus and domestic dog (Canis familiaris).

Science.gov (United States)

Baneth, Gad; Samish, Michael; Shkap, Varda

2007-04-01

The life cycle of the apicomplexan protozoon Hepatozoon canis in its natural hosts Rhipicephalus sanguineus (tick) and Canis familiaris (domestic dog) was studied in an experimental infection. Tick nymphs were fed on a naturally infected dog, or they were infected by percutaneous injection of blood. Dogs were inoculated by ingestion of adult ticks containing mature oocysts. Gamonts were in syzygy 24 hr after percutaneous injection of ticks. Early oocysts were detected 96 hr after nymph repletion, and mature oocysts in adult ticks were infective to dogs 40 days postmolt. Merogony was detected in dog bone marrow from 13 days postinoculation (PI) and included meronts containing 20-30 micromerozoites, and a second type with 2-4 macromerozoites. Monozoic cysts were observed in the spleen in conjunction with merogony. Gamontogony with infection of leukocytes by micromerozoites occurred from 26 days PI, and gamont parasitemia, which completed the life cycle, was detected 28 days PI. The length of the life cycle from nymphal attachment to parasitemia in dogs was 81 days. Increased body temperatures were evident from 16 to 27 days PI and paralleled the time of intensive bone marrow merogony. Skeletal pain and recumbency were manifested in 2 dogs. This study further elucidates the life cycle of H. canis and provides a sequential morphologic description of H. canis merogony, gamontogony, and sporogony.
Molecular structure, bioinformatics analysis, expression and bioactivity of BAFF (TNF13B) in dog (Canis familiaris).

Science.gov (United States)

Shen, Yuefen; Wang, Shule; Ai, Hongxin; Min, Cui; Chen, Yuqing; Zhang, Shuangquan

2011-07-15

B cell activating factor (BAFF), belonging to the tumor necrosis factor (TNF) family, plays an important role in B cell survival, proliferation and differentiation. In the present study, we amplified the cDNA of dog (Canis familiaris) BAFF (designated doBAFF) from spleen by reverse transcription-PCR (RT-PCR) and rapid amplification of cDNA ends (RACE) strategies. The open reading frame (ORF) of doBAFF covers 879 bp encoding 292 amino acids, with a 152-aa mature peptide. The soluble mature part of doBAFF (dosBAFF) shares 91.5%, 72.1%, 96.7%, 94.0% and 91.5% identity with the human, mouse, cattle, pig and rabbit counterparts, respectively. The predicted three-dimensional (3D) structural analysis of dosBAFF analyzed by "comparative protein modeling" revealed that it was very similar to its human counterpart. Real-time quantitative PCR analysis revealed that doBAFF was mainly expressed in spleen. Two fusion proteins SUMO-dosBAFF and GFP/dosBAFF were efficiently expressed in Escherichia coli BL21 (DE3) and purified using metal chelate affinity chromatography (Ni-NTA). Laser scanning confocal microscopy analysis showed that GFP/dosBAFF could bind to the mouse splenic B-cell. In vitro, SUMO-dosBAFF and GFP/dosBAFF were able to promote the survival/proliferation of dog lymphocytes or mouse splenic B cells with/without anti-IgM. Therefore, BAFF may be a potential immunologic factor for enhancing immunological efficacy in dog. Copyright © 2011 Elsevier B.V. All rights reserved.
Importancia y propiedades físico química de la Rosa mosqueta (R. canina, R. rubiginosa: una revisión

Directory of Open Access Journals (Sweden)

T. Espinoza

2016-01-01

Full Text Available Los consumidores cada día exigen productos en sus dietas que no solo aporten los nutrientes requeridos para una vida sana, sino que además son de preferencia aquellos que puedan complementar con propiedades benéficas para la salud. En las últimas décadas se ha reconocido a la Rosa mosqueta, la Rosa canina y a la Rosa rubiginosa, como frutos que contienen muchas propiedades nutracéuticas. El presente trabajo hace una revisión de los artículos de investigación realizados a la Rosa mosqueta desde un punto de vista de su importancia de su consumo y sus beneficios para la salud; describiendo las características químicas, físicas y bioquímicas tales como el contenido de componentes fenólicos, ácidos grasos, ácido linoleico, minerales; y de otros compuestos importantes también desde el punto de vista industrial, tales como el contenido de antioxidantes, pigmentos, entre otros. De acuerdo a los antecedentes recopilados, la Rosa mosqueta es una fuente de micronutrientes incluyendo la vitamina c y el licopeno, entregando además un buen aporte nutricional; por lo anterior debe ser considerado como un alimento funcional. Aun siendo una especie que crece en estado salvaje, sobre suelos forestales; siendo un frutal menor y una planta medicinal su importancia en el consumo masivo debe ser considerada.
[Genetic analysis and estimation of genetic diversity in east-European breeds of swift hounds (Canis familiaris L.) based on the data of genomic studies using RAPD markers].

Science.gov (United States)

Semenova, S K; Illarionova, N A; Vasil'ev, V A; Shubkina, A V; Ryskov, A P

2002-06-01

The method of polymerase chain reaction with a set of arbitrary primers (RAPD-PCR) was used to describe genetic variation and to estimate genetic diversity in East-European swift hounds, Russian Psovyi and Hortyi Borzois. For comparison, swift hounds of two West-European breeds (Whippet and Greyhound) and single dogs of other breed groups (shepherd, terriers, mastiffs, and bird dogs) were examined. For all dog groups, their closest related species, the wolf Canis lupus, was used as an outgroup. Variation of RAPD markers was studied at several hierarchic levels: intra- and interfamily (for individual families of Russian Psovyi and Hortyi Borzois), intra- and interbreed (for ten dog breeds), and interspecific (C. familiaris-C. lupus). In total, 57 dogs and 4 wolfs were studied. Using RAPD-PCR with three primers, 93 DNA fragments with a length of 150-1500 bp were detected in several Borzoi families with known filiation. These fragments were found to be inherited as dominant markers and to be applicable for estimation of genetic differences between parents and their offspring and for comparison of individuals and families with different level of inbreeding. A high level of intra- and interbreed variation was found in Russian Psovyi and Hortyi Borzois. In these dog groups, genetic similarity indices varied in a range of 72.2 to 93.4% (parents-offspring) and 68.0 to 94.5 (sibs). Based on the patterns of RAPD markers obtained using six primers, a dendrogram of genetic similarity between the wolf and different dog breeds was constructed, and indices of intragroup diversity were calculated. All studied breeds were found to fall into two clusters, swift hounds (Borzoi-like dogs) and other dogs. Russian Borzois represent a very heterogeneous group, in which the Russian Psovyi Borzoi is closer to Greyhound than the Russian Hortyi Borzoi. All studied wolfs constituted a separate cluster. Significant differences were found between the wolf and dogs by the number of RAPD markers
Leptospira interrogans en una población canina del Gran Buenos Aires: variables asociadas con la seropositividad Leptospira interrogans in a canine population of Greater Buenos Aires: variables associated with seropositivity

Directory of Open Access Journals (Sweden)

Diana Rubel

1997-08-01

Full Text Available Se determinó la seroprevalencia de leptospirosis en una población canina suburbana con el objeto de analizar la asociación entre distintas variables individuales y ambientales y la seropositividad a leptospirosis. El estudio, de diseño transversal, se llevó a cabo durante julio de 1992 en un barrio del Gran Buenos Aires en el que viven unos 9 500 habitantes y una población canina de unos 2 000 animales. Se estudió una muestra aleatoria de 223 perros, de cada uno de los cuales se obtuvo una muestra de sangre. La ficha epidemiológica del animal se obtuvo por encuesta al ama de casa. Las determinaciones serológicas se realizaron por microaglutinación frente a 10 serotipos de Leptospira interrogans. Se halló seropositividad en 57% de los 223 perros examinados; 82% de los sueros positivos coaglutinaron con dos o más serotipos. Los serotipos detectados con mayor frecuencia fueron canicola y pyrogenes. La seroprevalencia en hembras fue menor que en machos (P We determined the seroprevalence of leptospirosis in a suburban canine population for the purpose of analyzing the association between different individual and environmental variables and seropositivity for leptospirosis. The study, which was cross-sectional, was performed in July 1992 in a neighborhood of Greater Buenos Aires with approximately 9 500 inhabitants and a canine population of around 2 000 animals. We studied a random sample of 223 dogs and obtained a blood sample from each. Each animals epidemiologic history was obtained by interviewing the housewife. Serologic measurements were performed by the microagglutination technique with the use of 10 different serotypes of Leptospira interrogans. Of the 223 dogs that were tested, 57% showed seropositivity; 82% of the positive sera coagglutinated with two or more serotypes. The most frequently detected serotypes were canicola and pyrogenes. Seroprevalence in females was less common than in males (P <0,05 and in puppies less than
NCBI nr-aa BLAST: CBRC-CFAM-20-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-20-0004 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1757 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1757 ref|NP_001003095.1| bradykinin receptor B2 [Canis lupus familiari...s] gb|AAK21217.1|AF334948_1 B2 bradykinin receptor [Canis lupus familiaris] NP_001003095.1 0.0 80% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0072 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0072 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 1e-91 91% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-0084 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0084 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 3e-64 95% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
Practice makes perfect: familiarity of task determines success in solvable tasks for free-ranging dogs (Canis lupus familiaris).

Science.gov (United States)

Bhattacharjee, Debottam; Dasgupta, Sandipan; Biswas, Arpita; Deheria, Jayshree; Gupta, Shreya; Nikhil Dev, N; Udell, Monique; Bhadra, Anindita

2017-07-01

Domestic dogs' (Canis lupus familiaris) socio-cognitive faculties have made them highly sensitive to human social cues. While dogs often excel at understanding human communicative gestures, they perform comparatively poorly in problem-solving and physical reasoning tasks. This difference in their behaviour could be due to the lifestyle and intense socialization, where problem solving and physical cognition are less important than social cognition. Free-ranging dogs live in human-dominated environments, not under human supervision and are less socialized. Being scavengers, they often encounter challenges where problem solving is required in order to get access to food. We tested Indian street dogs in familiar and unfamiliar independent solvable tasks and quantified their persistence and dependence on a novel human experimenter, in addition to their success in solving a task. Our results indicate that free-ranging dogs succeeded and persisted more in the familiar task as compared to the unfamiliar one. They showed negligible amount of human dependence in the familiar task, but showed prolonged gazing and considerable begging behaviour to the human experimenter in the context of the unfamiliar task. Cognitive abilities of free-ranging dogs thus play a pivotal role in determining task-associated behaviours based on familiarity. In addition to that, these dogs inherently tend to socialize with and depend on humans, even if they are strangers. Our results also illustrate free-ranging dogs' low competence at physical cognitive tasks.
Can Sleep and Resting Behaviours Be Used as Indicators of Welfare in Shelter Dogs (Canis lupus familiaris?

Directory of Open Access Journals (Sweden)

Sara C Owczarczak-Garstecka

Full Text Available Previous research on humans and animals suggests that the analysis of sleep patterns may reliably inform us about welfare status, but little research of this kind has been carried out for non-human animals in an applied context. This study explored the use of sleep and resting behaviour as indicators of welfare by describing the activity patterns of dogs (Canis lupus familiaris housed in rescue shelters, and comparing their sleep patterns to other behavioural and cognitive measures of welfare. Sleep and activity patterns were observed over five non-consecutive days in a population of 15 dogs. Subsequently, the characteristics of sleep and resting behaviour were described and the impact of activity on patterns of sleep and resting behaviour analysed. Shelter dogs slept for 2.8% of the day, 14.3% less than previously reported and experienced less sleep fragmentation at night (32 sleep bouts. There were no statistically significant relationships between behaviours exhibited during the day and sleep behaviour. A higher proportion of daytime resting behaviour was significantly associated with a positive judgement bias, less repetitive behaviour and increased time spent coded as 'relaxed' across days by shelter staff. These results suggest that, in the context of a busy shelter environment, the ability to rest more during the day could be a sign of improved welfare. Considering the non-linear relationship between sleep and welfare in humans, the relationship between sleep and behavioural indicators of welfare, including judgement bias, in shelter dogs may be more complex than this study could detect.
NCBI nr-aa BLAST: CBRC-STRI-01-2759 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2759 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 96% ...
NCBI nr-aa BLAST: CBRC-MDOM-04-0139 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0139 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 87% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2654 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2654 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 79% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1025 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 95% ...

NCBI nr-aa BLAST: CBRC-PCAP-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1484 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-0795 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-0795 ref|NP_001003110.1| dopamine receptor D2 [Canis lupus familiaris]...| dopamine D2 receptor [Canis lupus familiaris] gb|AAG34496.1| dopamine D2 receptor [Canis lupus familiaris] NP_001003110.1 1e-123 81% ...
Estudo descritivo da estrutura populacional canina da área urbana de Araçatuba, São Paulo, Brasil, no período de 1994 a 2004 A descriptive profile of the canine population in Araçatuba, São Paulo State, Brazil, from 1994 to 2004

Directory of Open Access Journals (Sweden)

Andréa Maria Andrade

2008-04-01

Full Text Available No período de 1994 a 2004, a população canina de Araçatuba, São Paulo, Brasil, registrou duas importantes zoonoses: a raiva e a leishmaniose visceral. Analisaram-se as mudanças ocorridas nessa população durante esse período, utilizando resultados de censos caninos e de coletas censitárias de sangue realizados em 1994, 1999 e 2004. A relação cão/10 habitantes variou significativamente, passando de 1,7 em 1994 para 2,0 em 1999 e para 1,8 em 2004. A porcentagem de cães com até um ano de idade passou de 20% para 32,5% e o número de eutanásias realizadas também aumentou após 1999, com a introdução da leishmaniose visceral. O número de cães e a estrutura etária variaram nos diversos setores do município e aqueles com maior porcentagem de animais com até dois anos de idade apresentaram maior ocorrência de casos de leishmaniose visceral humana e canina. Tais resultados decorrem de ações de controle adotadas nos setores com casos humanos de leishmaniose visceral, porém, o aumento da população canina mais jovem pode resultar em aumento da susceptibilidade destes cães à doença, favorecendo a manutenção da mesma na área.From 1994 to 2004, the canine population in Araçatuba, São Paulo State, Brazil, suffered two major canine zoonoses: rabies and visceral leishmaniasis. Changes in the dog population during this period were evaluated using canine census data from 1994 and 2004 and the results of blood samples for diagnosis of canine visceral leishmaniasis in 1999. The ratio of dogs per 10 inhabitants varied from 1.7 in 1994 to 2.0 in 1999 and 1.8 in 2004. The percentage of puppies less than 1 year of age increased from 20% to 32.5%, and the number of euthanized dogs also increased after 1999, when visceral leishmaniasis began to appear. The number of dogs and percentage of puppies varied between different areas of the city, and neighborhoods with a higher percentage of young animals showed more cases of both human and
Epidemiological aspects of human and canine visceral leishmaniasis in Venezuela Aspectos epidemiológicos de la leishmaniasis visceral humana y canina en Venezuela

Directory of Open Access Journals (Sweden)

Olga Zerpa

2003-04-01

Full Text Available OBJECTIVE: To report recent data on the distribution of human and canine visceral leishmaniasis (VL in Venezuela, and to highlight problems associated with effective control measures. METHODS: We report the number of cases, incidence rate, age and sex distribution, and mortality rates for human VL (HVL for the period of 1995 through 2000, based on National Registry of Leishmaniasis data. We carried out serological studies on a total of 3 025 domestic dogs from the 12 states in Venezuela reporting cases of human VL in this 1995-2000 period and also from the state of Yaracuy, where cases were reported earlier during the decade of the 1990s. RESULTS: From 1995 through 2000, 242 cases of HVL were reported from 12 states, in various sections of Venezuela. There was a relatively stable national incidence rate of 0.2 cases per 100 000 persons per year. Of the 242 cases, 26.0% were from Margarita Island, one of the three islands that make up the state of Nueva Esparta (Margarita Island was the only one of the Nueva Esparta islands that had HVL cases. Over the 1995-2000 period, the annual incidence rates for Nueva Esparta ranged from 1.7 to 3.8 cases per 100000 population. Males in Venezuela were more frequently affected (59.5% than were females (40.5%. In terms of age, 67.7% of the VL patients were OBJETIVOS: Dar a conocer datos recientes acerca de la distribución de la leishmaniasis visceral (LV humana y canina en Venezuela y resaltar los problemas que se asocian con la aplicación de buenas medidas de control. MÉTODOS: Damos a conocer el número de casos, la tasa de incidencia, la distribución por edad y sexo y las tasas de mortalidad de la LV humana (LVH durante el período de 1995 a 2000, según datos obtenidos del Registro Nacional de Leishmaniasis. Llevamos a cabo pruebas serológicas en un total de 3 025 perros domésticos de los 12 estados de Venezuela que notificaron casos de LV en este período, y también de Yaracuy, donde se notificaron
Diagnóstico histopatológico de arterioesclerosis en perros (Canis lupus familiaris

Directory of Open Access Journals (Sweden)

Héctor Rubén Ávila Adarme

2016-06-01

Full Text Available La arterioesclerosis es el endurecimiento de las arterias debido a cambios en las estructuras histológicas de la pared vascular, como hipertrofia muscular, tejido conectivo, depósito de calcio, lípidos, etc. La ateroesclerosis se caracteriza por la formación de placas fibrosas en la íntima, que a menudo tiene un núcleo central rico en lípidos; esta patología es el tipo más común de arterioesclerosis en la especie humana y, por lo tanto, de gran importancia para su estudio. Algunos autores reportan que la arterioesclerosis es común, pero de poca importancia en animales domésticos; además encasillan al perro (Canis lupus familiaris como aterorresistente. Sin embargo, en la actualidad son varios los reportes de lesiones vasculares similares a las observadas en humanos, que están relacionadas con la estrecha convivencia en su papel de mascota. Por tanto, la presente investigación se enfoca en la búsqueda y descripción de lesiones histopatológicas concernientes a arterioesclerosis en perros, mediante un estudio retrospectivo de la casuística del Laboratorio de Patología Veterinaria de la Universidad Nacional de Colombia. Después de revisar los informes de necropsia e histopatología, se seleccionaron 52 casos de perros que reportaban uno o varios factores predisponentes para el desarrollo de arterioesclerosis; las láminas histopatológicas fueron inicialmente evaluadas con la tinción de hematoxilina y eosina y se capturaron fotomicrografías de utilidad para futuras investigaciones. En 23 de los 52 casos seleccionados se observaron diferentes características de lesiones relacionadas con esta entidad, como vacuolas translúcidas, paredes de aspecto hialino, proliferación de tejido muscular o conectivo y deposiciones de mineral y pigmentos. Adicionalmente, en algunos casos se utilizó la coloración tricrómica de Masson para confirmar la presencia de tejido conectivo y muscular. Por último, se plantearon hipótesis sobre la
Epidemiological features and the neuropathological manifestations of canine distemper virus-induced infections in Brazil: a reviewAspectos epidemiológicos e as manifestações neuropatológicas associadas à infecção pelo vírus da cinomose canina no Brasil: uma revisão

Directory of Open Access Journals (Sweden)

Selwyn Arligton Headley

2012-10-01

Full Text Available This article provides a critical review of current epidemiological trends of canine distemper virus (CDV and syndromes related to canine distemper encephalitis (CDE with specific reference to the situation in Brazil. Epidemiological data relative to susceptible animal populations, prevalence, seasonal occurrence, and age-related patterns associated with CDV are discussed. The participation of mongrel dogs in maintaining CDV within rural and semi-urban canine populations and their importance in the epidemiology of canine distemper is highlighted. The economic impact of treating the clinical manifestations associated with CDV-induced infections in Brazil is estimated. Additionally, neurological and neuropathological manifestations of CDV in Brazil are discussed, and a novel manifestation of CDE is proposed. Esse manuscrito fornece uma revisão crítica das tendências epidemiológicas associadas ao vírus da cinomose canina (CDV e às síndromes relacionadas à encefalite por cinomose com referência específica à situação no Brasil. Os dados epidemiológicos relativos às populações de animais suscetíveis, prevalência, sazonalidade e os padrões relacionados à idade foram discutidos. Também é enfocada nessa revisão a participação de cães de rua na manutenção do CDV nas populações caninas nas áreas rurais e nas regiões semiurbanas e a sua importância na epidemiologia da cinomose. Foi ainda estimado o impacto econômico relacionado ao tratamento das manifestações clínicas associadas à cinomose no Brasil. Adicionalmente, as manifestações neurológicas e neuropatológicas da cinomose no Brasil são discutidas e uma manifestação neuropatológica inédita da infecção é sugerida.
Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda

Directory of Open Access Journals (Sweden)

EVORA Paulo Roberto B.

1999-01-01

Full Text Available Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers" e ensaios biológicos: 1 os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2 os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3 o A23187, vasodilatador independente de receptor, induziu relaxamentos dependentes do endotélio; 4 dopamina, dobutamina, papaverina e a poli-L-arginina induziram vasodilatações independentes do endotélio; 5 a NOR induziu intensa vasoconstrição comparável à causada pelo KCI e pela endotelina; 6 em 83% de 24 ensaios, a liberação basal de NO foi maior na AMI esquerda, em comparação com a AMI direita; 7 ensaios biológicos de AMIs demonstraram a importância da PGI2 nas condições de hipóxia, uma vez que a indometacina aboliu vasodilatação adicional em resposta à hipóxia em condições de vasodilatação induzida pela liberação basal de NO; 8 não ocorreram diferenças significantes de resposta, comparando-se estudos realizados em AMIs direita e esquerda.
Physiological, physical and behavioural changes in dogs (Canis familiaris) when kennelled: testing the validity of stress parameters.

Science.gov (United States)

Part, C E; Kiddie, J L; Hayes, W A; Mills, D S; Neville, R F; Morton, D B; Collins, L M

2014-06-22

Domestic dogs (Canis familiaris) housed in kennelling establishments are considered at risk of suffering poor welfare. Previous research supporting this hypothesis has typically used cortisol:creatinine ratios (C/Cr) to measure acute and chronic stress in kennelled dogs. However, the value of C/Cr as a welfare indicator has been questioned. This study aimed to test the validity of a range of physiological, physical and behavioural welfare indicators and to establish baseline values reflecting good dog welfare. Measurements were taken from 29 privately-owned dogs (14 males, 15 females), ranging in age and breed, in their own home and in a boarding kennel environment, following a within-subjects, counterbalanced design. Pairwise comparisons revealed that C/Cr and vanillylmandelic acid:creatinine ratios (VMA/Cr) were higher in the kennel than home environment (P=0.003; P=0.01, respectively) and were not associated with differences in movement/exercise between environments. Dogs' surface temperature was lower in kennels (P=0.001) and was not associated with ambient temperature. No association with age, or effects of kennel establishment, kennelling experience, sex or source were found. Dogs were generally more active in kennels, but showed considerable individual variability. C/Cr and 5-HIAA:creatinine ratios (5-HIAA/Cr) were negatively correlated with lip licking in kennels. Baseline values for each parameter are presented. The emotional valence of responses was ambiguous and no definitive evidence was found to suggest that dogs were negatively stressed by kennelling. It was concluded that C/Cr and, particularly, VMA/Cr and surface temperature provide robust indicators of psychological arousal in dogs, while spontaneous behaviour might be better used to facilitate interpretation of physiological and physical data on an individual level. Copyright © 2014 Elsevier Inc. All rights reserved.
Focos de dirofilariose canina na Ilha do Marajó: um fator de risco para a saúde humana Focus of canine heartworm disease in Marajó Island, North of Brazil: a risk factor for human health

Directory of Open Access Journals (Sweden)

Lourdes Maria Garcez

2006-08-01

Full Text Available A ocorrência de dirofilariose pulmonar humana relaciona-se com a prevalência de infecção por Dirofilaria immitis na população canina. Várias espécies de mosquitos são vetores desse nematóide. Analisaram-se amostras de sangue canino coletados nas vilas Pingo d'Água e União, município de Salvaterra (Ilha do Marajó, PA, em junho, 2004 (n=34 e abril, 2005 (N=90. Os diagnósticos parasitológico e imunológico (ELISA - kit SNAP® 3DX™, Biobrasil foram comparados (chi2, alfa=0,05 no exame de 34 amostras. A prevalência na população (N=90 foi avaliada pelo ELISA. O ELISA revelou mais positivos (25/34; 73,5% que a gota espessa (23/34, 67,6% e o Knott (21/34, 61,8%, mas a diferença não foi significativa (p>0,05. A freqüência de infecção por D. immitis na faixa de 0 a 2 anos foi 58%, enquanto em cães mais velhos foi 100%. A prevalência da dirofilariose canina em Pingo d'Água e Vila União foi alta (53,5%, indicando risco de transmissão do parasito às pessoas nessa área.The occurrence of human pulmonary dirofilariasis maintains a relation with the prevalence of Dirofilaria immitis infection in the canine population. Several mosquito species are vectors of this nematode. Canine blood samples collected in Pingo d'Água and União villages, Salvaterra municipality (Marajó Island, Pará, in June, 2004 (n=34 and April, 2005 (N=90 were analyzed. Parasitological and immunological (ELISA - kit SNAP® 3DX™, Biobrasil diagnoses were compared following the examination of 34 samples. The prevalence in the population (N=90 was evaluated by means of ELISA. ELISA revealed more positive samples (25/34; 73.5% than thick smears (23/34, 67.6% or Knott (21/34, 61.8%, but the differences were not significant (p>0.05. The frequency of D. immitis infection was 58% in dogs ranging from 0-2 years old, whereas in older dogs it was 100%. The prevalence of canine dirofilariasis was high in Pingo d'Água and Vila União (53.5%, indicating the risk of
Amiodarona causa vasodilatação dependente do endotélio em artérias coronárias caninas Amiodarone causes endothelium-dependent vasodilation in canine coronary arteries

Directory of Open Access Journals (Sweden)

Alfredo José Rodrigues

2005-03-01

Full Text Available OBJETIVO: Avaliar os efeitos vasodilatadores da amiodarona em artérias coronárias caninas empregando soluções de amiodarona dissolvida em polisorbato 80 ou em água. MÉTODOS: Anéis de artéria coronária, com e sem o endotélio íntegro, foram imersos em solução de krebs e conectadas a um transdutor para aferição de força isométrica promovida por contração vascular. As artérias foram expostas a concentrações crescentes de polisorbato 80, amiodarona dissolvida em água, amiodarona dissolvida em polisorbato 80 e uma apresentação comercial da amiodarona (Cordarone®. Os experimentos foram conduzidos na presença e na ausência dos seguintes bloqueadores enzimáticos: apenas indometacina, Nômega-nitro-L-arginina associada à indometacina e apenas Nômega-nitro-L-arginina. RESULTADOS: O polisorbato 80 causou pequeno relaxamento não dependente do endotélio. O Cordarone®, a amiodarona dissolvida em água e em polisorbato 80 promoveram relaxamento dependente do endotélio, que foi de maior magnitude para a amiodarona dissolvida em polisorbato e para o Cordarone®. Apenas a associação de indometacina com a Nômega-nitro-L-arginina foi capaz de abolir o relaxamento dependente do endotélio provocado pela amiodarona dissolvida em polisorbato 80. CONCLUSÃO: Os resultados obtidos indicam que a vasodilatação promovida pela amiodarona em artérias coronárias caninas é causada principalmente pela estimulação da liberação de óxido nítrico e fatores endoteliais relaxantes dependentes das ciclo-oxigenases.OBJECTIVE: To assess the vasodilating effects of amiodarone on canine coronary arteries by using solutions of amiodarone dissolved in polysorbate 80 or water. METHODS: Rings of coronary arteries, with or without intact endothelium, were immersed in Krebs solution and connected to a transducer for measuring the isometric force promoted by a vascular contraction. The arteries were exposed to increasing concentrations of
Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

Science.gov (United States)

Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

2017-04-01

Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Estudo histoquímico de proteínas fibrilares da matriz extracelular em neoplasias mamárias benignas e malignas na espécie canina

Directory of Open Access Journals (Sweden)

Ana Maria Cristina Rabello Pinto da Fonseca Martins

2002-01-01

Full Text Available A finalidade do presente trabalho foi estudar algumas das proteínas fibrilares da matriz extracelular de 54 neoplasias mamárias benignas e malignas na espécie canina, utilizando métodos histoquímicos: Picrosirius associado à polarização para fibras colágenas , método de Gordon - Sweats para fibras reticulares e método de Weigert com e sem oxidação para fibras elásticas. Evidenciou-se na matriz uma grande variabilidade na quantidade, distribuição e características dos componentes matriciais presentes nos diferentes tipos de neoplasias. Detectou-se, assim, colágeno I, III e elementos do sistema elástico, distribuídos diferentemente nas neoplasias benignas e malignas. O método Picrosirius simples e associado à polarização permitiu a visualização do colágeno sob a forma de fibras espessas distribuídas irregularmente no estroma dos carcinomas e de modo mais ordenado e regular nas neoplasias benignas e, fibras mais finas, em menor quantidade, irregularmente e aleatoriamente dispostas nos carcinomas e regularmente nas neoplasias benigna. Sob luz polarizada os feixes de fibras colágenas , apresentaram diferentes comprimentos, avermelhados ou amarelados e fortemente birrefringentes, sugerindo serem colágeno tipo I e, entremeando as fibras, algumas mais finas ,pálidas, esverdeadas e fracamente birrefringentes, presumivelmente colágeno tipo III. Em áreas condrometaplásicas, tanto nos carcinomas como nas neoplasias benignas notou-se que os feixes colágenos apresentavam-se com fibras finas, paralelas, limitando regiões estreitas onde os condrócitos se aninhavam, e, rodeando esta área, feixes de fibras espessas, anastomosadas, dispostas irregularmente nos carcinomas e ordenadamente e paralelas nas neoplasias benignas. Sob luz polarizada, essa população entre condrócitos era formada por fibras pálidas e amareladas, sugerindo padrão tipo II e na faixa circundante, feixes fortemente birrefringentes, sugerindo o padr
Point Topography and Within-Session Learning Are Important Predictors of Pet Dogs’ (Canis lupus familiaris Performance on Human Guided Tasks

Directory of Open Access Journals (Sweden)

Dorey, Nicole R.

2013-07-01

Full Text Available Pet domestic dogs (Canis lupus familiaris are generally considered successful on object choice tasks, reliably following human points to a target. However, defining the specific topography of the point types utilized and assessing the potential for dogs to generalize their responses across similar point types has received little attention. In Experiment 1, we assessed pet dogs’ performance on an object choice task utilizing nine different point types that varied across the dimensions of movement, duration, and distance. These dimensions reliably predicted the performance of pet dogs on this task. In Experiment 2, pet dogs presented with nine different point types in the order of increasing difficulty performed better on more difficult point types than both naive dogs and dogs experiencing the nine points in the order of decreasing difficulty. In Experiment 3, we manipulated the attentional state of the experimenter (as in perspective taking studies and found that human orientation was not a strong predictor of performance on pointing tasks. The results of this study indicate that dogs do not reliably follow all point types without additional training or experience. Furthermore, dogs appear to continuously learn about the dimensions of human points, adjusting their behavior accordingly, even over the course of experimental testing. These findings bring claims of pet dogs’ spontaneous success on pointing tasks into question. The ability to learn about, and respond flexibly to, human gestures may benefit pet dogs living in human homes more than a spontaneous responsiveness to specific gesture types.
NCBI nr-aa BLAST: CBRC-BTAU-01-1644 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1644 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-89 51% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0057 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 3e-50 57% ...
NCBI nr-aa BLAST: CBRC-GACU-23-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-23-0003 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 5e-27 29% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0195 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PMAR-01-0195 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-82 63% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1330 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1330 ref|NP_001093415.1| growth hormone secretagogue receptor [Canis lupus... familiaris] gb|ABQ01981.1| ghrelin receptor [Canis lupus familiaris] NP_001093415.1 1e-11 37% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0849 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0849 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1207 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1207 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-1593 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1593 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 0.0 86% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1304 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 0.0 91% ...
Edge detection techniques for iris recognition system

International Nuclear Information System (INIS)

Tania, U T; Motakabber, S M A; Ibrahimy, M I

2013-01-01

Nowadays security and authentication are the major parts of our daily life. Iris is one of the most reliable organ or part of human body which can be used for identification and authentication purpose. To develop an iris authentication algorithm for personal identification, this paper examines two edge detection techniques for iris recognition system. Between the Sobel and the Canny edge detection techniques, the experimental result shows that the Canny's technique has better ability to detect points in a digital image where image gray level changes even at slow rate
Epidemiología molecular de epizootias de rabia en Colombia, 1994-2002: evidencia de rabia humana y canina asociada a quirópteros.

Directory of Open Access Journals (Sweden)

Andrés Páez

2003-03-01

Full Text Available Tres brotes de rabia canina han sido informados en Colombia durante las pasadas dos décadas, uno de los cuales aún ocurre en la Región Caribe. Los otros dos ocurrieron en el departamento de Arauca y en la Región Central (departamentos de Boyacá y Cundinamarca hasta 1997. Con la finalidad de investigar las relaciones filogenéticas existentes entre los virus rábicos aislados en las regiones mencionadas, se empleó la técnica de RT-PCR para obtener fragmentos de ADN de 902 nucleótidos complementarios a una región del ARN rábico codificante para el endodominio de la proteína G, para una parte de la proteína L, fragmentos que, además, contienen la región intergénica no codificante G-L. Los amplificados fueron secuenciados y agrupados en árboles filogenéticos. Los resultados mostraron la existencia de tres grupos de virus. Los virus rábicos pertenecientes a la variante genética colombiana I fueron aislados exclusivamente en el departamento de Arauca y la Región Central colombiana hasta 1997 y, aparentemente, se encuentran extintos. Los virus rábicos pertenecientes a la variante genética colombiana II fueron aislados exclusivamente en la Región Caribe, en donde actualmente su tranmisión continúa. Un tercer grupo se compone de variantes rábicas originarias de quirópteros, que fueron aisladas de dos murciélagos insectívoros, tres perros y un humano. Con este trabajo se estableció una asociación entre los quirópteros y la rabia en perros y humanos en Colombia, lo cual los muestra como reservorios de importancia en salud pública.
NCBI nr-aa BLAST: CBRC-MEUG-01-2527 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2527 ref|NP_001013868.1| cholecystokinin B receptor [Canis lupus famil...iaris] gb|AAB87706.1| gastrin/CCK-B receptor [Canis lupus familiaris] NP_001013868.1 1e-165 73% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1250 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1250 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-119 80% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0329 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0329 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-160 73% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0637 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0637 ref|NP_001020791.1| somatostatin receptor 3 [Canis lupus familiar...is] gb|AAV49129.1| somatostatin receptor subtype 3 [Canis lupus familiaris] NP_001020791.1 1e-165 90% ...
Pathogenic strains of Yersinia enterocolitica isolated from domestic dogs (Canis familiaris) belonging to farmers are of the same subtype as pathogenic Y. enterocolitica strains isolated from humans and may be a source of human infection in Jiangsu Province, China.

Science.gov (United States)

Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

2010-05-01

We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections.
NCBI nr-aa BLAST: CBRC-MLUC-01-1145 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1145 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0341 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0341 ref|NP_001121658.1| zinc finger protein, multitype 2 [Canis lupus... familiaris] gb|ACD67898.1| zinc finger multitype protein 2 [Canis lupus familiaris] NP_001121658.1 1.8 24% ...
NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0484 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0484 ref|NP_001003250.1| fucosidase, alpha-L-1, tissue [Canis lupus fa...miliaris] gb|AAB17403.1| alpha-L-fucosidase [Canis lupus familiaris] NP_001003250.1 2e-52 67% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0152 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0152 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2639 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2639 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 2e-99 60% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1218 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1218 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 1e-126 70% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0428 ref|NP_001074192.1| taste receptor, type 2, member 41 [Canis lupus... familiaris] dbj|BAE80338.1| bitter taste receptor [Canis lupus familiaris] NP_001074192.1 4e-99 59% ...
A Rosa canina - Urtica dioica - Harpagophytum procumbens/zeyheri Combination Significantly Reduces Gonarthritis Symptoms in a Randomized, Placebo-Controlled Double-Blind Study.

Science.gov (United States)

Moré, Margret; Gruenwald, Joerg; Pohl, Ute; Uebelhack, Ralf

2017-12-01

The special formulation MA212 (Rosaxan) is composed of rosehip ( Rosa canina L.) puree/juice concentrate, nettle ( Urtica dioica L.) leaf extract, and devil's claw ( Harpagophytum procumbens DC. ex Meisn. or Harpagophytum zeyheri Decne.) root extract and also supplies vitamin D. It is a food for special medical purposes ([EU] No 609/2013) for the dietary management of pain in patients with gonarthritis.This 12-week randomized, placebo-controlled double-blind parallel-design study aimed to investigate the efficacy and safety of MA212 versus placebo in patients with gonarthritis.A 3D-HPLC-fingerprint (3-dimensional high pressure liquid chromatography fingerprint) of MA212 demonstrated the presence of its herbal ingredients. Ninety-two randomized patients consumed 40 mL of MA212 (n = 46) or placebo (n = 44) daily. The Western Ontario and McMaster Universities Arthritis Index (WOMAC), quality-of-life scores at 0, 6, and 12 weeks, and analgesic consumption were documented. Statistically, the initial WOMAC subscores/scores did not differ between groups. During the study, their means significantly improved in both groups. The mean pre-post change of the WOMAC pain score (primary endpoint) was 29.87 in the MA212 group and 10.23 in the placebo group. The group difference demonstrated a significant superiority in favor of MA212 (p U < 0.001; p t < 0.001). Group comparisons of all WOMAC subscores/scores at 6 and 12 weeks reached same significances. Compared to placebo, both physical and mental quality of life significantly improved with MA212. There was a trend towards reduced analgesics consumption with MA212, compared to placebo. In the final efficacy evaluation, physicians (p Chi < 0.001) and patients (p Chi < 0.001) rated MA212 superior to placebo. MA212 was well tolerated.This study demonstrates excellent efficacy for MA212 in gonarthritis patients. Georg Thieme Verlag KG Stuttgart · New York.
NCBI nr-aa BLAST: CBRC-PVAM-01-1620 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1620 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 0.0 82% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0643 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0643 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-131 95% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0019 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0019 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 1e-121 96% ...
NCBI nr-aa BLAST: CBRC-GACU-08-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-08-0023 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 7e-91 47% ...
Botanical Extracts from Rosehip (Rosa canina), Willow Bark (Salix alba), and Nettle Leaf (Urtica dioica) Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes

Science.gov (United States)

Shakibaei, Mehdi; Allaway, David; Nebrich, Simone; Mobasheri, Ali

2012-01-01

The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina), willow bark (Salix alba), and nettle leaf (Urtica dioica) in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG), β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was examined by western blotting. Results. The botanical extracts suppressed IL-1β-induced NF-κB activation by inhibition of IκBα phosphorylation, IκBα degradation, p65 phosphorylation, and p65 nuclear translocation. These events correlated with downregulation of NF-κB targets including COX-2 and MMPs. The extracts also reversed the IL-1β-induced downregulation of collagen type II, CSPG, β1-integrin, and cartilage-specific transcription factor SOX-9 protein expression. In high-density cultures botanical extracts stimulated new cartilage formation even in the presence of IL-1β. Conclusions. Botanical extracts exerted anti-inflammatory and anabolic effects on chondrocytes. The observed reduction of IL-1β-induced NF-κB activation suggests that further studies are warranted to demonstrate the effectiveness of plant extracts in the treatment of OA and other conditions in which NF-κB plays pathophysiological roles. PMID:22474508
Botanical Extracts from Rosehip (Rosa canina), Willow Bark (Salix alba), and Nettle Leaf (Urtica dioica) Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes.

Science.gov (United States)

Shakibaei, Mehdi; Allaway, David; Nebrich, Simone; Mobasheri, Ali

2012-01-01

The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina), willow bark (Salix alba), and nettle leaf (Urtica dioica) in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG), β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was examined by western blotting. Results. The botanical extracts suppressed IL-1β-induced NF-κB activation by inhibition of IκBα phosphorylation, IκBα degradation, p65 phosphorylation, and p65 nuclear translocation. These events correlated with downregulation of NF-κB targets including COX-2 and MMPs. The extracts also reversed the IL-1β-induced downregulation of collagen type II, CSPG, β1-integrin, and cartilage-specific transcription factor SOX-9 protein expression. In high-density cultures botanical extracts stimulated new cartilage formation even in the presence of IL-1β. Conclusions. Botanical extracts exerted anti-inflammatory and anabolic effects on chondrocytes. The observed reduction of IL-1β-induced NF-κB activation suggests that further studies are warranted to demonstrate the effectiveness of plant extracts in the treatment of OA and other conditions in which NF-κB plays pathophysiological roles.
Botanical Extracts from Rosehip (Rosa canina, Willow Bark (Salix alba, and Nettle Leaf (Urtica dioica Suppress IL-1β-Induced NF-κB Activation in Canine Articular Chondrocytes

Directory of Open Access Journals (Sweden)

Mehdi Shakibaei

2012-01-01

Full Text Available The aim of this study was to characterize the anti-inflammatory mode of action of botanical extracts from rosehip (Rosa canina, willow bark (Salix alba, and nettle leaf (Urtica dioica in an in vitro model of primary canine articular chondrocytes. Methods. The biological effects of the botanical extracts were studied in chondrocytes treated with IL-1β for up to 72 h. Expression of collagen type II, cartilage-specific proteoglycan (CSPG, β1-integrin, SOX-9, COX-2, and MMP-9 and MMP-13 was examined by western blotting. Results. The botanical extracts suppressed IL-1β-induced NF-κB activation by inhibition of IκBα phosphorylation, IκBα degradation, p65 phosphorylation, and p65 nuclear translocation. These events correlated with downregulation of NF-κB targets including COX-2 and MMPs. The extracts also reversed the IL-1β-induced downregulation of collagen type II, CSPG, β1-integrin, and cartilage-specific transcription factor SOX-9 protein expression. In high-density cultures botanical extracts stimulated new cartilage formation even in the presence of IL-1β. Conclusions. Botanical extracts exerted anti-inflammatory and anabolic effects on chondrocytes. The observed reduction of IL-1β-induced NF-κB activation suggests that further studies are warranted to demonstrate the effectiveness of plant extracts in the treatment of OA and other conditions in which NF-κB plays pathophysiological roles.
NCBI nr-aa BLAST: CBRC-MDOM-08-0147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0147 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0228 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0228 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 7e-79 54% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0391 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-79 50% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2734 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-164 80% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0046 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0046 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 5e-46 41% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1568 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-163 88% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1165 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1165 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-101 60% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0554 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-117 67% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0608 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0608 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 7e-64 52% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0278 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 8e-55 51% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0170 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0170 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 3e-78 54% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0987 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0987 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-104 88% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0328 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0328 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-129 75% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1055 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1055 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-133 74% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1382 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1382 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-137 80% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-0684 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0684 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-170 84% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0131 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 3e-69 47% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2581 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2581 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-156 78% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0130 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-66 45% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1474 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 0.0 96% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2573 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2573 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-116 76% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0718 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0718 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 3e-76 59% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1451 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1451 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-109 62% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1789 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1789 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-48 36% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0058 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0058 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-118 75% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0126 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0126 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-64 45% ...
NCBI nr-aa BLAST: CBRC-STRI-01-1421 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1421 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 6e-85 54% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0824 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0824 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 1e-128 75% ...
NCBI nr-aa BLAST: CBRC-MDOM-08-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0135 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 2e-80 52% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1389 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1389 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-125 71% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0578 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0578 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 4e-85 53% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0391 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0391 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-83 50% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0158 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0158 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 7e-69 61% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1534 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1534 ref|NP_001138972.1| bitter taste receptor Cafa-T2R38 [Canis lupus... familiaris] dbj|BAE80335.1| bitter taste receptor [Canis lupus familiaris] NP_001138972.1 1e-126 75% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0259 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 2e-53 47% ...

NCBI nr-aa BLAST: CBRC-MMUR-01-0278 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0278 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 2e-77 66% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0830 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0830 ref|NP_001139463.1| coagulation factor II (thrombin) receptor-like 1 [Canis lupus... familiaris] dbj|BAH28894.1| protease-activated receptor 2 [Canis lupus familiaris] NP_001139463.1 1e-105 76% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1154 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1154 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-151 85% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0152 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0152 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 4e-57 49% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2514 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2514 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 6e-61 42% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1005 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-104 64% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0468 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0468 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-51 49% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1057 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-158 84% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0025 ref|NP_001138975.1| bitter taste receptor Cafa-T2R67 [Canis lupus... familiaris] dbj|BAE80341.1| bitter taste receptor [Canis lupus familiaris] NP_001138975.1 3e-72 67% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-1005 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1005 ref|NP_001003037.1| melanin-concentrating hormone receptor 2 [Canis lupus... familiaris] gb|AAM51852.1| melanin-concentrating hormone receptor subtype 2 [Canis lupus familiaris] NP_001003037.1 1e-134 87% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0943 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0943 ref|NP_001138977.1| bitter taste receptor Cafa-T2R1 [Canis lupus ...familiaris] dbj|BAE80327.1| bitter taste receptor [Canis lupus familiaris] NP_001138977.1 2e-92 59% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1669 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1669 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-70 48% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0906 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0906 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 1e-122 76% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1197 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1197 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-48 50% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0048 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0048 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-136 85% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0756 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0756 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-171 86% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-1514 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1514 ref|NP_001138970.1| bitter taste receptor Cafa-T2R39 [Canis lupus... familiaris] dbj|BAE80336.1| bitter taste receptor [Canis lupus familiaris] NP_001138970.1 1e-141 78% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0075 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0075 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-64 83% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0507 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-02-0507 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 4e-71 45% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1398 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1398 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-139 81% ...

NCBI nr-aa BLAST: CBRC-MDOM-08-0125 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0125 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 2e-22 38% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1404 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1404 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-81 51% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1050 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 1e-97 56% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1147 ref|NP_001138973.1| bitter taste receptor Cafa-T2R12 [Canis lupus... familiaris] dbj|BAE80334.1| bitter taste receptor [Canis lupus familiaris] NP_001138973.1 1e-37 35% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0260 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0260 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-146 75% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-2326 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2326 ref|NP_001138978.1| bitter taste receptor Cafa-T2R5 [Canis lupus ...familiaris] dbj|BAE80331.1| bitter taste receptor [Canis lupus familiaris] NP_001138978.1 3e-36 56% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0447 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0447 ref|NP_001138979.1| bitter taste receptor Cafa-T2R43 [Canis lupus... familiaris] dbj|BAE80339.1| bitter taste receptor [Canis lupus familiaris] NP_001138979.1 5e-63 48% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1469 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1469 ref|NP_001138974.1| bitter taste receptor Cafa-T2R7 [Canis lupus ...familiaris] dbj|BAE80332.1| bitter taste receptor [Canis lupus familiaris] NP_001138974.1 1e-122 83% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1162 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1162 ref|NP_001138971.1| bitter taste receptor Cafa-T2R3 [Canis lupus ...familiaris] dbj|BAE80329.1| bitter taste receptor [Canis lupus familiaris] NP_001138971.1 1e-70 47% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0321 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0321 ref|NP_001138969.1| bitter taste receptor Cafa-T2R10 [Canis lupus... familiaris] dbj|BAE80333.1| bitter taste receptor [Canis lupus familiaris] NP_001138969.1 1e-121 75% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-0602 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-0602 ref|NP_001138976.1| bitter taste receptor Cafa-T2R2 [Canis lupus ...familiaris] dbj|BAE80328.1| bitter taste receptor [Canis lupus familiaris] NP_001138976.1 6e-42 44% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0442 ref|NP_001138968.1| bitter taste receptor Cafa-T2R55 [Canis lupus... familiaris] dbj|BAE80340.1| bitter taste receptor [Canis lupus familiaris] NP_001138968.1 5e-84 52% ...
Pathogenic Strains of Yersinia enterocolitica Isolated from Domestic Dogs (Canis familiaris) Belonging to Farmers Are of the Same Subtype as Pathogenic Y. enterocolitica Strains Isolated from Humans and May Be a Source of Human Infection in Jiangsu Province, China ▿ ‡

Science.gov (United States)

Wang, Xin; Cui, Zhigang; Wang, Hua; Tang, Liuying; Yang, Jinchuan; Gu, Ling; Jin, Dong; Luo, Longze; Qiu, Haiyan; Xiao, Yuchun; Xiong, Haiping; Kan, Biao; Xu, Jianguo; Jing, Huaiqi

2010-01-01

We isolated 326 Yersinia enterocolitica strains from 5,919 specimens from patients with diarrhea at outpatient clinics, livestock, poultry, wild animals, insect vectors, food, and the environment in the cities of Nantong and Xuzhou in Jiangsu Province, China, from 2004 to 2008. The results showed that the 12 pathogenic strains were of the O:3 serotype. Six strains were isolated from domestic dogs (Canis familiaris) belonging to farmers and were found to be the primary carriers of pathogenic Y. enterocolitica strains, especially in Xuzhou. Pulsed-field gel electrophoresis analysis of the pathogenic strains from dogs belonging to farmers showed that they shared the same patterns as strains from diarrhea patients isolated in 1994. This indicates that the strains from domestic dogs have a close correlation with the strains causing human infections. PMID:20181899
Epidemiological assessment of canine brucellosis

Directory of Open Access Journals (Sweden)

Megid J.

1999-01-01

Full Text Available Observou-se brucelose canina em quatro canis diferentes. Os canis apresentaram animais com história de aborto, mortalidade em neonatos e nascimentos prematuros. A porcentagem de animais soropositivos para brucelose canina, pela prova de imunodifusão em ágar gel, variou de 4,6 a 57,1%. Observou-se correlação positiva entre porcentagem de animais positivos e aspectos reprodutivos e condições de aglomeração.
Inquérito epidemiológico sobre características da população canina e felina de um bairro próximo à zona rural em Cuiabá-MT, visando o controle da raiva animal Epidemiologic investigation into characteristics of canine and feline population in a district close to a rural area in Cuiabá-MT, with a view to control of animal rabies

OpenAIRE

João Garcia Caramori Junior; Marco Antônio da Silva Lubas; Make Silva Kawatake; Katia Gouvea Sales; Julio Capilé Guedes; Aline Conceição Schmitt

2003-01-01

Foram avaliados os questionários respondidos por 476 alunos, com idade entre 15 e 20 anos, de uma escola do bairro Pedra 90 em Cuiabá-MT, objetivando conhecer as características da população canina e felina daquele local. Dos 476 domicílios, em 371 (78%), foram registrados 513 cães e 307 gatos. Dos 513 cães, 289 (56,3%) eram machos e 224 (43,7%) fêmeas. Dos 307 gatos, 182 (59,3%) eram machos e 125 (40,7%) fêmeas. Os proprietários de 474 (92,4%) cães e 267 (86,9%) gatos afirmaram ter vacinado ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0806 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0806 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-175 99% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1301 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1301 ref|NP_001003038.1| G protein-coupled receptor 24 [Canis lupus fa...miliaris] gb|AAM51851.1| melanin-concentrating hormone receptor subtype 1 [Canis lupus familiaris] NP_001003038.1 1e-180 92% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0405 [SEVENS

Lifescience Database Archive (English)

Full Text Available ters), member 2 [Canis lupus familiaris] gb|ABV32554.1| solute carrier family 23 member 2 [Canis lupus familiaris] NP_001103426.1 1e-177 91% ... ...CBRC-ETEL-01-0405 ref|NP_001103426.1| solute carrier family 23 (nucleobase transpor
TEHNOLOGIJA UZGOJA PRESADNICA Rosa canina L. I Pelargonium zonale L. U KULTURI TKIVA I NJIHOVA ADAPTACIJA U RAZLIČITIM SUPSTRATIMA

Directory of Open Access Journals (Sweden)

Monika Tkalec

2017-01-01

Full Text Available Cilj rada bio je utvrditi mogućnost dobivanja sadnoga materijala Rosa canina L. i Pelargonium zonale L. u kulturi tkiva te pogodnost alternativnih komponenti i njihovih mješavina kao supstrata za adaptaciju proizvedenih in vitro presadnica navedenih cvjetnih vrsta. U istraživanju analizirano je četiri alternativne komponente (ljuske od kakaovca (A, vrbina kora (B, supstrat nastao nakon proizvodnje šampinjona (C, piljevina (D te šest njihovih mješavina za uzgoj cvjetnih presadnica. Kao kontrolni supstrat analizirani su Klasman Potgrond P (za divlju ružu (E i Balkon – blumenerde (za pelargoniju (F. Statističkom obradom podataka, utvrđene su značajne razlike između svih tretmana (supstrata i njihovih analiziranih svojstava. Prosječan postotak adaptiranih presadnica u svim istraživanim supstratima iznosio je 54,68% za divlju ružu te 99,68% za pelargoniju. Najveće vrijednosti morfoloških pokazatelja divlje ruže utvrđene su na mješavini supstrata M2 (30% A + 20% B + 40% C + 10% D, gdje je zabilježen najveći broj izboja, broj listova, svježa nadzemna masa, ukupna svježa masa presadnice te odnos mase nadzemnoga dijela i korijena u svježem i suhome stanju. Kemijski sastav presadnica divlje ruže varirao je među tretmanima, no najviši sadržaj većine makro i mikroelemenata utvrđen je na presadnicama uzgajanim na supstratu od piljevine (D te kontrolnome supstratu (E. Kod pelargonije, najveće vrijednosti gotovo svih morfoloških pokazatelja zabilježene su, također, na mješavinama supstrata M4 (18% A + 22% B + 40% C + 20% D i M6 (18% A + 42% B + 20% C + 20% D. Nadalje, dok su najveće vrijednosti morfoloških pokazatelja utvrđene na presadnicama pelargonija uzgajanim na mješavinama, najviši sadržaj mikro i makroelemenata utvrđen je u presadnicama uzgajanim na alternativnim komponentama.
Biofabrication of zinc oxide nanoparticles using fruit extract of Rosa canina and their toxic potential against bacteria: A mechanistic approach

Energy Technology Data Exchange (ETDEWEB)

Jafarirad, Saeed; Mehrabi, Meysam [Research Institute for Fundamental Sciences (RIFS), University of Tabriz, Tabriz (Iran, Islamic Republic of); Divband, Baharak [Research Center for Pharmaceutical Nanotechnology, Tabriz University of Medical Sciences, Tabriz (Iran, Islamic Republic of); Inorganic Chemistry Department, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Kosari-Nasab, Morteza [Drug Applied Research Center, Tabriz University of Medical Sciences, Tabriz (Iran, Islamic Republic of)

2016-02-01

The use of plant extract in the biosynthesis of nanoparticles (NPs) can be an eco-friendly approach and have been suggested as a possible alternative to classic methods namely physical and chemical procedures. In this study, the biosynthesis of zinc oxide (ZnO) NPs by both “conventional heating” (CH) and “microwave irradiation” (MI) methods has been reported. Stable and spherical ZnONPs were produced using zinc nitrate and flesh extract of Rosa canina fruit (rosehip) which was used as a precursor. The flesh extract acts as a reducing and capping agent for generation of ZnONPs. The structural, morphological and colloidal properties of the as-synthesized NPs have been confirmed by X-ray Diffraction (XRD), Scanning Electron Microscopy (SEM), Energy Dispersive X-ray (EDX), Fourier transform Infrared (FT-IR) and Dynamic Light Scattering (DLS). In comparison with the CH method, the MI method has some advantages such as significantly short reaction time (within 8 min) owing to the high heating rate and thus the accelerated reaction rate. Both methods led to the synthesis of nearly identical NPs with respect to shape and size according to the results of DLS, XRD and SEM techniques. The possible mechanism for synthesis pathway has been proposed based on FT IR results, XRD patterns, potentiometric data and antioxidant activity. In addition, the antibacterial activity of as-prepared ZnONPs was investigated against several bacteria such as Listeria monocytogenes, Escherichia coli, Salmonella typhimurium. Moreover, the efficacy of ZnONPs to treat cancer cell lines were measured by means of cell viability test via MTT assay in which concentrations of 0.05 and 0.1 mg/mL of ZnONPs induced a very low toxicity. Thus, the present investigation reveals that ZnONPs have the potential for various medical and industrial applications. - Highlights: • We report a green producing route from biomaterials to potentially biomedical applications. • We comprise two methods in respect

Biofabrication of zinc oxide nanoparticles using fruit extract of Rosa canina and their toxic potential against bacteria: A mechanistic approach

International Nuclear Information System (INIS)

Jafarirad, Saeed; Mehrabi, Meysam; Divband, Baharak; Kosari-Nasab, Morteza

2016-01-01

The use of plant extract in the biosynthesis of nanoparticles (NPs) can be an eco-friendly approach and have been suggested as a possible alternative to classic methods namely physical and chemical procedures. In this study, the biosynthesis of zinc oxide (ZnO) NPs by both “conventional heating” (CH) and “microwave irradiation” (MI) methods has been reported. Stable and spherical ZnONPs were produced using zinc nitrate and flesh extract of Rosa canina fruit (rosehip) which was used as a precursor. The flesh extract acts as a reducing and capping agent for generation of ZnONPs. The structural, morphological and colloidal properties of the as-synthesized NPs have been confirmed by X-ray Diffraction (XRD), Scanning Electron Microscopy (SEM), Energy Dispersive X-ray (EDX), Fourier transform Infrared (FT-IR) and Dynamic Light Scattering (DLS). In comparison with the CH method, the MI method has some advantages such as significantly short reaction time (within 8 min) owing to the high heating rate and thus the accelerated reaction rate. Both methods led to the synthesis of nearly identical NPs with respect to shape and size according to the results of DLS, XRD and SEM techniques. The possible mechanism for synthesis pathway has been proposed based on FT IR results, XRD patterns, potentiometric data and antioxidant activity. In addition, the antibacterial activity of as-prepared ZnONPs was investigated against several bacteria such as Listeria monocytogenes, Escherichia coli, Salmonella typhimurium. Moreover, the efficacy of ZnONPs to treat cancer cell lines were measured by means of cell viability test via MTT assay in which concentrations of 0.05 and 0.1 mg/mL of ZnONPs induced a very low toxicity. Thus, the present investigation reveals that ZnONPs have the potential for various medical and industrial applications. - Highlights: • We report a green producing route from biomaterials to potentially biomedical applications. • We comprise two methods in respect
SEROLOGICAL EVIDENCE OF THE PRESENCE OF CANINE HERPES VIRUS TYPE 1 IN LIMA PROVINCE

OpenAIRE

Góngora A., Vladimir; Sandoval Ch., Nieves; Manchego S., Alberto

2012-01-01

El Virus Herpes Canino tipo 1 (VHC-1) es responsable de la enfermedad hemorrágica canina en cachorros menores de cuatro semanas de vida y de algunos problemas reproductivos en perras adultas. En el Perú, la enfermedad no ha sido reportada, aunque existen hallazgos que sugieren su presencia. El objetivo del presente estudio fue demostrar la presencia de anticuerpos contra el VHC-1 entre la población canina con antecedentes asociados a problemas reproductivos. Se recolectaron muestras de sangre...
NCBI nr-aa BLAST: CBRC-CFAM-21-0168 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0168 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1669 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-1669 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 82% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1462 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1462 ref|NP_001077101.1| cOR51P3 olfactory receptor family 51 subfamily P-like [Canis lupus... familiaris] gb|ABO36682.1| 52P3 olfactory receptor protein [Canis lupus familiaris] NP_001077101.1 1e-156 91% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-0139 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-0139 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...
NCBI nr-aa BLAST: CBRC-CFAM-21-0167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0167 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-153 81% ...
NCBI nr-aa BLAST: CBRC-TBEL-01-1358 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1358 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 4e-78 82% ...
NCBI nr-aa BLAST: CBRC-FCAT-01-0606 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0606 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-169 90% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
NCBI nr-aa BLAST: CBRC-PABE-12-0119 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-12-0119 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-151 81% ...
NCBI nr-aa BLAST: CBRC-MMUS-07-0511 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-07-0511 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 77% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-0982 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-159 86% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1299 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1299 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-108 63% ...
NCBI nr-aa BLAST: CBRC-OGAR-01-1197 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-1197 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-162 85% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1678 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1678 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-62 89% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-0947 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-0947 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-3219 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-3219 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0801 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0801 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-148 79% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0106 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-142 80% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-2138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2138 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-121 68% ...
NCBI nr-aa BLAST: CBRC-CFAM-21-0169 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0169 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-170 91% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-2143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-2143 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-128 71% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2061 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2061 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 3e-54 83% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-0308 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-0308 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-165 87% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-0988 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0988 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 6e-98 78% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0086 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-0086 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-29 72% ...
Investigação de áreas de risco como metodologia complementar ao controle da leishmaniose visceral canina Investigation of risk areas as complemental methodology for the control of canine visceral leishmaniasis

Directory of Open Access Journals (Sweden)

Fred S. Julião

2007-08-01

Full Text Available Foram investigadas áreas de risco de leishmaniose visceral canina no município de Camaçari, Bahia. Um total de 278 cães distribuídos em 141 residências, pertencentes a 20 áreas de risco investigadas, foi examinado sorologicamente (ELISA. A soroprevalência geral foi 21,7% (56/258 depois da exclusão dos 20 cães usados no início do estudo para delimitar a área. Os resultados respectivos das análises univariada e multivariada dos fatores relacionados à infecção do cão por Leishmania chagasi, a captura e distribuição do vetor na área e a metodologia usada para localizar os focos caninos são discutidos.Risk areas of canine visceral leishmaniasis in the city of Camaçari, Bahia, Brazil, were investigated. A total of 278 dogs from 141 homes pertaining to 20 investigated risk areas was serologically screened (ELISA. The general seroprevalence was 21.7% (56/258 after exclusion of 20 dogs used at the beginning of the survey to limit the study area. The respective results of the univariated and multivariated analysis of factors related to infection of dogs by Leishmania chagasi, to vector distribu-tion pattern in the area and to the methodology used to localize the canine focuses are discussed.
Hepatite infecciosa canina: 62 casos Infectious canine hepatitis: 62 cases

Directory of Open Access Journals (Sweden)

Maria A. Inkelmann

2007-08-01

Full Text Available Os protocolos de necropsias realizadas em 5.361 cães durante um período de 43 anos (1964-2006 foram revisados em busca de casos de hepatite infecciosa canina (HIC e sessenta e dois (1,2% casos foram encontrados. A maioria dos 62 cães afetados tinha dois anos de idade ou menos (91,9%. Os sinais clínicos foram anotados nos protocolos de necropsia de 45 cães afetados por HIC e incluíam anorexia (55,6%, apatia (35,6%, diarréia (35,6%, freqüentemente com sangue (43,8% dos casos de diarréia, distúrbios neurológicos (33,3%, vômito (26,7%, petéquias e equimoses nas membranas mucosas e/ou pele (24,4%, hipotermia (20,0%, dor abdominal (15,6%, icterícia (13,3%, aumento de volume e congestão das tonsilas (11,1%, febre (11,1% e ascite (6,7%. A duração do curso clínico variou de poucas horas a 15 dias. Os principais achados de necropsia incluíram alterações hepáticas (87,1%, linfonodos edematosos, congestos e hemorrágicos (51,6%, líquido sanguinolento, líquido claro ou sangue na cavidade abdominal (35,5%, víbices, sufusões e petéquias sobre a pleura visceral (27,4% e superfície serosa das vísceras gastrintestinais (24,2%. Em 12,9% dos casos a serosa do intestino tinha aspecto granular. Hemorragias cerebrais nas leptomeninges e na substância do encéfalo foram observadas em 9,7% dos casos. As alterações hepáticas macroscópicas incluíam fígados moderadamente aumentados de volume, mais friáveis, com acentuação do padrão lobular, congestos e com múltiplos focos de necrose pálidos ou hemorrágicos. Películas e filamentos de fibrina cobriam a superfície hepática em 20,4% dos casos e em 27,8% dos casos a parede da vesícula biliar estava espessada por edema. Necrose hepática zonal ou aleatória (93,5% dos casos associada a corpúsculos de inclusão intranucleares foi a lesão histológica mais regularmente encontrada. Os corpúsculos de inclusão intranucleares ocorreram no fígado em todos os casos e esse foi o crit
Detección de coproantígenos para el diagnóstico de echinococosis canina en la zona fronteriza de La Quiaca-Villazón

Directory of Open Access Journals (Sweden)

Natalia Casas

Full Text Available Las técnicas de inmunodiagnóstico basadas en la identificación de antígenos parasitarios en las heces secas de los perros han sido desarrolladas para la vigilancia de la echinococosis canina. En la región fronteriza de La Quiaca-Villazón, se encontraron las condiciones ambientales que favorecerían el ciclo del parásito, dada la presencia del hospedador definitivo (perro y de hospedadores intermediarios (ovejas y cabras. La actividad más importante de la Puna es la cría de ovinos y camélidos; la faena se realiza en el campo y a manos del dueño de los ovinos, y no se aplican medidas preventivas de sanidad. El objetivo de este trabajo fue estimar la presencia de caninos parasitados por Echinococcus granulosus en esta región. Durante el año 2006 se recolectaron 168 muestras de materia fecal. En La Quiaca se tomaron muestras de las siguientes localidades: Barrios (área semirrural, Santa Catalina, Yavi Chico, El Portillo, Pumahuasi y Cara Cara (zonas rurales y La Quiaca (área urbana. En Villazón se seleccionó el área urbana y el área semirrural de Ojo de Agua, Lampaya y Matancillas. Las muestras se analizaron por la prueba de copro-ELISA y copro-Western blot. Las localidades de San Francisco y Barrios tuvieron una prevalencia de 14,3 % y 6,7 %, respectivamente. En Villazón se encontró un 3,4 % de prevalencia en el área urbana. En Lampaya se encontró un 30 % de prevalencia. Estos resultados sugieren la necesidad de implementar estrategias para el control de la hidatidosis, tanto a nivel urbano como rural, para evitar el aumento y la dispersión de la echinococosis en la región.
Citometria de fluxo no diagnóstico da leishmaniose visceral canina Flow cytometry used in canine visceral leishmaniasis diagnosis

Directory of Open Access Journals (Sweden)

A.V. Carvalho Neta

2006-08-01

Full Text Available Descreve-se a padronização de nova metodologia para detecção de anticorpos antiformas promastigotas fixadas de L. (L. chagasi, por citometria de fluxo (AAPF-IgG, sua aplicabilidade e desempenho na identificação de casos de leishmaniose visceral canina (LVC. Foram avaliados dois grupos de cães classificados pela reação de imunofluorescência indireta (RIFI, como: não reatores (NR, n=10 e reatores (R, n=50 dos quais foram coletadas amostras de sangue (soro para realização dos testes laboratoriais. Os resultados relacionados ao estabelecimento, aplicabilidade e desempenho da metodologia AAPF-IgG demonstraram que essa metodologia possibilita a identificação de uma região de reatividade diferencial entre cães NR e R, no soro diluído a 1:2048 e o valor de 20% de parasitos fluorescentes positivos (PPFP como ponto de corte entre resultados positivos e negativos, mostrando que a AAPF-IgG aplica-se na identificação de casos de LVC, possibilitando distinguir 96% de cães R como positivos e 100% de cães NR como negativos. Esses resultados em conjunto sugerem que a utilização da AAPF-IgG pode ser um novo instrumento para ensaios clínicos de diagnóstico sorológico da LVC.The current study evaluated the standardization of a new methodology for detection of anti-fixed L. (L. chagasi promastigote antibodies by flow cytometry (AAPF-IgG, as well its applicability and performance in the identification of cases of Canine Visceral Leishmaniasis (CVL. Two groups of dogs were classified by RIFI (gold standard as no reactors (NR, n=10 and reactors (R, n=50. Blood samples were collected and used for the laboratorial tests (RIFI and AAPF-IgG. The results showed that the new AAPF-IgG assay makes possible the identification of an area of differential reactivity between dogs NR and R at the dilution of 1:2048 and 20% of percentage of positive fluorescent parasite as the cut point among positive and negative results. The AAPF-IgG assay was able to
Estudo morfofuncional das glândulas mamárias de Mão Pelada, Procyon cancrivorus Morphofunctional study of Crab-eating Raccoon (Procyon cancrivorus mammary gland

Directory of Open Access Journals (Sweden)

Tatiana Bellatine

2010-08-01

Full Text Available Para a descrição macro e microscópica das glândulas mamárias foram utilizadas três fêmeas de Mão Pelada (Procyon cancrivorus. As amostras das glândulas foram processadas conforme técnicas rotineiras para histologia. As fêmeas estudadas apresentaram 3 pares de glândulas mamárias, sendo um par de glândula mamária abdominal cranial, um par de abdominal caudal e um par de inguinal. As papilas mamárias apresentaram formato pendular, como os canídeos domésticos. Microscopicamente, a glândula mamária apresentou da porção externa para a interna: epiderme (epitélio estratificado pavimentoso queratinizado, derme (tecido conjuntivo frouxo e tecido conjuntivo denso não modelado, fibras musculares lisas e ductos papilíferos que abrem em vários ósteos papilares em formato de "chuveiro". A porção secretora glandular era caracteristicamente túbulo alveolar, com células cuboidais dispostas em camada simples. Os resultados indicam que o conjunto glandular estudado é semelhante ao da cadela (Cannis familiaris tanto em seu aspecto macroscópico quanto em seu aspecto microscópico, este fato sugere que podemos utilizar o Mão Pelada e o Cão como modelos similares de estudo, para identificação de patologias relacionadas a este sistema.Three Procyon cancrivorus females were studied with emphasis for gross and microscopical description of the mammary glands. Samples of the glands were processed with routine techniques for histology. The females studied presented three pairs of mammary glands: one pair of cranial abdominal mammary glands, a second pair of caudal abdominal and a third one, as inguinal mammary glands. Mammary papillae presented a pendulum shape, as in the domestic dogs. Microscopically, the mammary gland consisted from the external to the internal portion (1 of stratified squamous epithelium of the epidermis, (2 dense irregular connective tissue of the derma, and (3 smooth muscle fibers and papillary ducts that flowed
Image collection: 19 [Togo Picture Gallery[Archive

Lifescience Database Archive (English)

Full Text Available 19 Canis_lupus_familiaris_NL.png イエイヌ Domestic dogs Canis lupus familiaris 9615 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,ネコ目
Achados patológicos e imuno-histoquímicos em cães infectados naturalmente pelo vírus da cinomose canina Pathologic and immunohistochemistry findings in dogs naturally infected by canine distemper virus

Directory of Open Access Journals (Sweden)

Luciana Sonne

2009-02-01

Full Text Available A cinomose canina é uma doença viral e afeta principalmente os sistemas respiratório, gastrintestinal e nervoso. Neste trabalho foram analisados os achados patológicos e imuno-histoquímicos de 54 cães com cinomose de um total de 760 cães necropsiados no período de julho de 2006 a outubro de 2007. As lesões macroscópicas observadas foram caracterizadas por corrimento ocular e nasal mucopurulentas, hiperqueratose dos coxins digitais, pulmões avermelhados e não colapsados, atrofia do timo, conteúdo intestinal diarréico e placas de Peyer proeminentes. Os achados histológicos caracterizavam-se principalmente por pneumonia intersticial, rarefação linfóide, desmielinização da substância branca, manguitos perivasculares e corpúsculos de inclusão intranucleares e intracitoplasmáticos, que se localizam principalmente na mucosa do estômago, epitélios da bexiga, brônquios e bronquíolos, pelve renal, coxins digitais, pálpebra, orelha e tonsila no sistema nervoso central e em células mononucleares dos linfonodos, baço e tonsilas. Os tecidos foram marcados pela técnica imuno-histoquímica utilizando anticorpo monoclonal anti-cinomose canina. O coxim digital foi o tecido com maior número de casos marcados positivamente (67,4% dos casos, seguido pelo estômago com 62,7%. A imuno-histoquímica mostrou ser uma ferramenta importante para o estudo da distribuição do antígeno em cães infectados pela cinomose bem como indicou o melhor tecido para a confirmação do diagnóstico de casos suspeitos.Canine distemper is a viral disease that affects mainly respiratory, gastrointestinal and nervous system. The present study analyzes pathologic and immunohistochemical findings in 54 dogs with canine distemper of a total of 760 canine necropsies performed from July 2006 to October 2007. The gross lesions were characterized by mucopurulent oculonasal discharge, hyperkeratosis of footpads, red and not collapsed lungs, thymic atrophy, watery
NCBI nr-aa BLAST: CBRC-STRI-01-2590 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2590 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 3e-44 56% ...
NCBI nr-aa BLAST: CBRC-STRI-01-1844 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1844 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 1e-132 76% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0191 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0191 ref|NP_001013440.1| similar to CfOLF4 [Canis lupus familiaris] sp...|Q95157|OLF4_CANFA RecName: Full=Olfactory receptor-like protein OLF4 gb|AAB37242.1| CfOLF4 [Canis lupus familiaris] NP_001013440.1 2e-87 75% ...
Evaluación de la seroconversión como respuesta a la vacunación antirrábica en perros en el departamento del Valle del Cauca, Colombia, 2009

OpenAIRE

Andrés Páez; Constanza Hernández; Humberto Escobar; John Jairo Zapata; Jairo Méndez; Gloria Rey-Benito

2011-01-01

Introducción. El departamento del Valle del Cauca ha estado libre de rabia canina por más de 20 años, aunque persisten focos de rabia silvestre que amenazan a humanos y sus mascotas; por ello, como medida preventiva. se realizan anualmente campañas de vacunación antirrábica canina. Objetivos. Medir el impacto de la vacunación en términos de seroconversión de anticuerpos neutralizadores y de porcentaje de perros con respuesta inmunitaria humoral adecuada, relacionando variables ...
Evaluación de la seroconversión como respuesta a la vacunación antirrábica en perros en el departamento del Valle del Cauca, Colombia, 2009

OpenAIRE

Páez, Andrés; Hernández, Constanza; Escobar, Humberto; Zapata, John Jairo; Méndez, Jairo; Rey-Benito, Gloria

2011-01-01

Introducción. El departamento del Valle del Cauca ha estado libre de rabia canina por más de 20 años, aunque persisten focos de rabia silvestre que amenazan a humanos y sus mascotas; por ello, como medida preventiva. se realizan anualmente campañas de vacunación antirrábica canina. Objetivos. Medir el impacto de la vacunación en términos de seroconversión de anticuerpos neutralizadores y de porcentaje de perros con respuesta inmunitaria humoral adecuada, relacionando variables propias de esto...
Raiva humana transmitida por cães: áreas de risco em Minas Gerais, Brasil, 1991-1999 Human rabies transmitted by dogs: risk areas in Minas Gerais, Brazil, 1991-1999

OpenAIRE

Cristiana Ferreira Jardim de Miranda; José Ailton da Silva; Élvio Carlos Moreira

2003-01-01

Com o objetivo de identificar e caracterizar as diferentes áreas de risco para a raiva humana transmitida por cães em Minas Gerais, realizou-se um estudo observacional retrospectivo quali-quantitativo, no período de 1991 a 1999. Utilizou-se a divisão do estado em 25 Diretorias Regionais de Saúde (DRS), vinculadas à Secretaria de Estado da Saúde de Minas Gerais (SES-MG). Os indicadores estudados foram a estimativa de população canina, a ocorrência de raiva canina e felina confirmada por exames...

Raiva humana transmitida por cães: áreas de risco em Minas Gerais, Brasil, 1991-1999

OpenAIRE

Miranda, Cristiana Ferreira Jardim de; Silva, José Ailton da; Moreira, Élvio Carlos

2003-01-01

Com o objetivo de identificar e caracterizar as diferentes áreas de risco para a raiva humana transmitida por cães em Minas Gerais, realizou-se um estudo observacional retrospectivo quali-quantitativo, no período de 1991 a 1999. Utilizou-se a divisão do estado em 25 Diretorias Regionais de Saúde (DRS), vinculadas à Secretaria de Estado da Saúde de Minas Gerais (SES-MG). Os indicadores estudados foram a estimativa de população canina, a ocorrência de raiva canina e felina confirmada por exames...
NCBI nr-aa BLAST: CBRC-DNOV-01-2463 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2463 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-163 76% ...
NCBI nr-aa BLAST: CBRC-CFAM-32-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-32-0002 ref|NP_001003267.1| translocation associated membrane protein 1 [...Canis lupus familiaris] sp|Q01685|TRAM1_CANFA Translocation-associated membrane protein 1 emb|CAA45217.1| TR...AM-protein [Canis familiaris] prf||1809346A translocation protein TRAM NP_001003267.1 1e-129 69% ...
Edge detection of iris of the eye for human biometric identification system

Directory of Open Access Journals (Sweden)

Kateryna O. Tryfonova

2015-03-01

Full Text Available Method of human biometric identification by iris of the eye is considered as one of the most accurate and reliable methods of identification. Aim of the research is to solve the problem of edge detection of digital image of the human eye iris to be able to implement human biometric identification system by means of mobile device. To achieve this aim the algorithm of edge detection by Canny is considered in work. It consists of the following steps: smoothing, finding gradients, non-maximum suppression, double thresholding with hysteresis. The software implementation of the Canny algorithm is carried out for the Android mobile platform with the use of high level programming language Java.
The effects of rose hip (Rosa canina) on plasma antioxidative activity and C-reactive protein in patients with rheumatoid arthritis and normal controls: a prospective cohort study.

Science.gov (United States)

Kirkeskov, Bente; Christensen, Robin; Bügel, Susanne; Bliddal, Henning; Danneskiold-Samsøe, Bente; Christensen, Lars Porskjær; Andersen, Jens Rikardt

2011-08-15

Rose hip (Rosa canina) has been used as an herbal remedy against a wide range of ailments including inflammatory disorders. The anti-inflammatory and antioxidant properties of rose hips have been evaluated in vitro and active constituents have been isolated. Rose hip contains antioxidant nutrients and an anti-inflammatory galactolipid. Rheumatoid arthritis (RA) is an inflammatory disease where activated cells release reactive oxygen substances. Thus it could be relevant to investigate if rose hip had an anti-inflammatory and/or antioxidant effect in this situation. In this open case-control study 20 female patients with RA and 10 female controls were given 10.5 g rose hip powder daily (Litozin®) for 28 days. Blood samples were analysed at baseline and follow-up for the capacity of the antioxidant enzymes superoxide dismutase, glutathione peroxidase, glutathione reductase and catalase and the inflammatory marker C-reactive protein (CRP). The participants kept a food diary for the first 3 days and the last 3 days of the intervention period. The RA-patients completed The Stanford Health Assessment Questionnaire at baseline and follow-up. CRP-concentrations of both patients and healthy controls did not change. Nor was any effect found on the activity of antioxidant enzymes. There was no difference in food intake at baseline, but in the last week the RA-group reduced their energy intake. 10.5 g Litozin® in 28 days had neither effect on clinical symptoms or laboratory measurements in patients with RA or healthy controls. This is in contrast to previous intervention studies with rose hip powder that found a reduction in the concentration of CRP. The results of the present study indicate that a daily amount of approximately 10 g rose hip powder for one month has no anti-inflammatory and/or antioxidant effect. Copyright © 2011 Elsevier GmbH. All rights reserved.
The Edge Detectors Suitable for Retinal OCT Image Segmentation

Directory of Open Access Journals (Sweden)

Su Luo

2017-01-01

Full Text Available Retinal layer thickness measurement offers important information for reliable diagnosis of retinal diseases and for the evaluation of disease development and medical treatment responses. This task critically depends on the accurate edge detection of the retinal layers in OCT images. Here, we intended to search for the most suitable edge detectors for the retinal OCT image segmentation task. The three most promising edge detection algorithms were identified in the related literature: Canny edge detector, the two-pass method, and the EdgeFlow technique. The quantitative evaluation results show that the two-pass method outperforms consistently the Canny detector and the EdgeFlow technique in delineating the retinal layer boundaries in the OCT images. In addition, the mean localization deviation metrics show that the two-pass method caused the smallest edge shifting problem. These findings suggest that the two-pass method is the best among the three algorithms for detecting retinal layer boundaries. The overall better performance of Canny and two-pass methods over EdgeFlow technique implies that the OCT images contain more intensity gradient information than texture changes along the retinal layer boundaries. The results will guide our future efforts in the quantitative analysis of retinal OCT images for the effective use of OCT technologies in the field of ophthalmology.
Development of young toco toucas fed with dry dog food and toucan pellets Desenvolvimento de tucanos-toco jovens alimentados com ração canina e ração para tucanos

Directory of Open Access Journals (Sweden)

Heloísa Castro Pereira

2011-09-01

Full Text Available The proposal of this study was to compare the effects of two commercial diets, one consisting of dry dog food and another one of pelletized feed for toucans, in the growth of young toco toucans. The development of 14 specimens was observed, being four and five months of age, and divided randomly into two groups. Once a week, the fasted birds were weighted and evaluated in relation to the following biometrics parameters, with the help of a caliper: wings (right and left; head and beak (length, width and height, wingspan and total body length. To evaluate the presence of difference in body gain between the two groups, the U test of Mann-Whitney was used as statistical analysis, with significance level of 0.05 in a bilateral test. Birds of both groups showed no changes in behavior such as depression or aggression. The diets were well accepted, no waste was observed and all the animals remained healthy during the research. In respect to biometrics, toucans fed with dog food had a better development for the length of right and left wings, head width, height and length of the beak and weight gain, when compared with those treated with feed for toucans. This fact enables the use of dry dog food with 23% of crude protein and 71,15mg/Kg of iron for feeding of toco toucans in captivity.Propôs-se comparar os efeitos de duas dietas comerciais, uma composta por ração canina e outra por ração para tucanos no desenvolvimento de tucanos-toco jovens. Avaliou-se 14 espécimes, com idades entre quatro e cinco meses, distribuídas aleatoriamente em dois grupos. Uma vez por semana realizou-se a pesagem das aves em jejum e biometria individual dos parâmetros: asas esquerda e direita (comprimento; cabeça e bico (comprimento, largura e altura; envergadura e comprimento total do corpo, com o auxílio de um paquímetro. Para avaliar a existência ou não de diferenças estatisticamente significantes entre o peso e os dados biométricos obtidos nos dois grupos
Sarcocystis caninum and Sarcocystis svanai n. spp. (Apicomplexa: Sarcocystidae) Associated with Severe Myositis and Hepatitis in the Domestic Dog (Canis familiaris)

Science.gov (United States)

Dubey, J. P.; Sykes, J. E.; Shelton, G. D.; Sharp, N.; Verma, S. K.; Calero-Bernal, R.; Viviano, J.; Sundar, N.; Khan, A.; Grigg, M. E.

2014-01-01

There are several reports of Sarcocystis sarcocysts in muscles of dogs but these species have not been named. Additionally, there are 2 reports of Sarcocystis neurona in dogs. Here, we propose 2 new names, Sarcocystis caninum, and Sarcocystis svanai for sarcocysts associated with clinical muscular sarcocystosis in 4 domestic dogs (Canis familiaris), 1 each from Montana and Colorado in the USA, and 2 from British Columbia, Canada. Only the sarcocyst stage was identified. Most of the sarcocysts identified were S. caninum. Sarcocysts were studied using light microscopy, transmission electron microscopy, and PCR. Based on collective results 2 new species, Sarcocystis caninum and Sarcocystis svanai were designated. Sarcocystis caninum and Sarcocystis svanai were structurally distinct. Sarcocystis caninum sarcocysts were up to 1.2 mm long and up to 75 μm wide. By light microscopy, the sarcocyst wall was relatively thin and smooth. By transmission electron microscopy (TEM), the sarcocyst wall “type 9”, 1–2 μm thick, and contained villar protrusions that lacked microtubules. Bradyzoites in sections were 7–9 μm long. Sarcocysts of S. svanai were few and were identified by TEM. Sarcocystis svanai sarcocysts were “type 1”, thin walled (< 0.5 μm), and the wall lacked villar protrusions but had tiny blebs that did not invaginate. DNA was extracted either from infected frozen muscle biopsies or formalin-fixed paraffin-embedded sections. Dogs were either singly infected with S. caninum or multiply co-infected with S. caninum and S. svanai (the result of a mixed infection) based on multi-locus DNA sequencing and morphology. BLASTn analysis established that the sarcocysts identified in these dogs were similar to, but not identical to S. canis or S. arctosi, parasites found to infect polar bears (Ursus maritimus) or brown bears (Ursus arctosi), respectively. However, the S. caninum sequence showed 100% identify over the 18S rRNA region sequenced to that of S. arctica
TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758) SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758) SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758) sometidas a cesárea

OpenAIRE

Diogo José Cardilli; Patrícia Rotta Lopes; Gilson Hélio Toniollo; Valeska Rodrigues; João Ademir Oliveira

2009-01-01

Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias ap...
TEORES SÉRICOS DE CORTISOL DE FÊMEAS CANINAS (Canis familiaris – LINNAEUS, 1758 SUBMETIDAS À CESARIANA SERIC LEVELS OF CORTISOL IN BITCHES (Canis familiaris – LINNAEUS, 1758 SUBMITTED TO AESARIAN SECTION Niveles séricos del cortisol en perras (Canis familiaris – Linnaeus, 1758 sometidas a cesárea

Directory of Open Access Journals (Sweden)

Diogo José Cardilli

2009-12-01

Full Text Available
Cadelas submetidas à cesariana, por estarem em situação diferente da fisiológica, podem apresentar alterações séricas para se adaptarem a essa nova condição de estresse. Dentre as possíveis alterações, encontram-se as concentrações de cortisol durante o período periparto. Sendo assim, o objetivo deste estudo foi quantificar os teores séricos do cortisol de cadelas submetidas à cesariana na fase de parto e pós-parto (no dia do ato cirúrgico ou parto, 24 horas, 48 horas e dez dias após. O método de radioimunoensaio foi utilizado para a realização da dosagem do cortisol sérico (nos períodos já descritos. Realizou-se a análise estatística por meio dos testes t e Tukey. O teor de cortisol sérico apresentou diferença (p< 0,05 no dia da cesariana (6,83 µg/dL, porém não diferiu (p> 0,05 nos dias subsequentes (1,82 µg/dL, 24 horas após; 1,38 µg/dL, 48 horas após; 1,48 µg/dL dez dias após. Os valores médios do grupo controle foram 3,43, 2,01, 3,59 e 1,72 µg/dL, após o parto, 24, 48 horas e dez dias após, respectivamente. O estresse devido à distocia elevou a liberação desse hormônio, voltando à normalidade nos dias subsequentes, porém o estresse cirúrgico não promoveu aumento na liberação de cortisol em cadelas submetidas à cesariana. Os animais do grupo controle apresentaram teores séricos de cortisol, nos devidos períodos, compatíveis com os citados pela literatura.

PALAVRAS-CHAVES: Cadelas, cesariana, cortisol.

Bitches submitted to caesarian section, for being in a physiological different situation, can present alterations to adapt to this new stress condition. Into possible alterations are cortisol levels during per partum period. So, the objectives of this study was to quantify seric cortisol of bitches submitted to caesarian section in partum and postpartum period (in the day of the partum or surgery , 24, 48 hours and 10 days later. The reserved serum was used to realization of cortisol measure by radioimmunoassay (on already described periods. The statistics analyzes were made by t test and Tukey. The cortisol levels presented difference (p< 0.05 in the dog of caesarian section (6.83 µg/dL but this didn’t differ (p> 0.05 on subsequent days (1.82 µg/dL, 24 hours later; 1.38 µg/dL, 48 hour later; 1.48 µg/dL, 10 days later. The middle values of control group were 3.43, 2.01, 3.59 e 1.72 µg/dL, in partum day, 24 hours later, 48 hours later and 10 days later. The stress because partum dystocic induced to liberation of cortisol, normalizing in subsequent days, but don’t have variation after cesarian (surgical stress don’t induced bigger liberation of cortisol or partum natural, composed compatible with the one found in the literature.
KEY WORDS: Bitches, caesarian section, cortisol.
Perras sometidas a cesárea por estar en situación distinta de la fisiológica, pueden presentar alteraciones séricas para se adaptaren a esa nueva condición de estrés. Una de las posibles alteraciones, es la concentración de cortisol durante el período peri-parto. Siendo así, el objetivo de ese estudio fue cuantificar los niveles séricos del cortisol en perras sometidas a cesárea en la fase de parto y posparto en la fase de parto y posparto (en el día del acto quirúrgico o parto, 24h, 48h y 10 días después. El método de radioinmunoensayo fue utilizado para la realización del dosaje de cortisol sérico (en los períodos ya descritos. La evaluación estadística fue realizada por medio de los testes t y Tukey. El nivel de cortisol sérico presentó diferencia (p< 0,05 en el día de la cesárea (6,83 µg/dL, pero no hubo diferencia estadística (p> 0,05 en los días consecutivos (1,82 µg/dL, 24 horas después; 1,38 µg/dL, 48 horas después; 1,48 µg/dL 10 días después. Los niveles medios del grupo control fueron 3,43, 2,01, 3,59 y 1,72 µg/dL, después del parto, 24, 48 horas y 10 días después, respectivamente. El estrés debido a la distocia elevó la liberación de esa hormona, que volvió a la normalidad en los días siguientes, pero el estrés quirúrgico no promovió aumento en la liberación de cortisol en perras sometidas a cesárea, y los animales del grupo control presentaron niveles séricos de cortisol, en los debidos períodos, de acuerdo con los descritos por la literatura.
Parâmetros ecocardiográficos em modo unidimensional de cães da raça Poodle miniatura, clinicamente sadios Echocardiographic parameters in unidimensional mode from clinically normal miniature Poodle dogs

OpenAIRE

Ronaldo Jun Yamato; Maria Helena Matiko Akao Larsson; Regina Mieko Sakata Mirandola; Guilherme Gonçalves Pereira; Fernanda Lie Yamaki; Ana Carolina Brandão de Campos Fonseca Pinto; Elina Célia Nakandakari

2006-01-01

No Brasil, a população canina da raça Poodle, principalmente a variação miniatura, cresce em progressão geométrica, sendo esta raça freqüentemente acometida por cardiopatias congênitas e adquiridas. O escopo deste estudo foi padronizar e avaliar os parâmetros ecocardiográficos em modo unidimensional (M) de cães da raça Poodle miniatura, devido ao aumento populacional da mesma, a variação existente destes parâmetros entre as raças caninas e as diversas cardiopatias às quais os Poodles são pred...
Caracterização das propriedades funcionais e probióticas de bactérias láticas isoladas de cães para uso em vacinas orais contra leptospirose como adjuvante imune ou carreador antigênico

OpenAIRE

Lenice Roteia Cardoso Jung

2013-01-01

A leptospirose canina tem aumentado significativamente nos últimos anos. No Brasil alguns estudos têm demonstrado o caráter endêmico dessa zoonose em cães e que estes animais podem exibir o status de portadores renais crônicos da Leptospira. A exposição e o convívio do homem com os cães poderão torná-lo vulnerável à infecção por Leptospira. Na intenção de desenvolver uma vacia oral contra a leptospirose canina busca-se avaliar a possibilidade de usar lactobacilos autóctones como veículos ou a...
First molecular identification of Echinococcus vogeli and Echinococcus granulosus (sensu stricto) G1 revealed in feces of domestic dogs (Canis familiaris) from Acre, Brazil.

Science.gov (United States)

das Neves, Leandro Batista; Teixeira, Paulo Eduardo Ferlini; Silva, Sidnei; de Oliveira, Fernanda Bittencourt; Garcia, Daniel Daipert; de Almeida, Fernanda Barbosa; Rodrigues-Silva, Rosângela; Machado-Silva, José Roberto

2017-01-14

Echinococcus granulosus (sensu lato) (s.l.) and Echinococcus vogeli are causative agents of chronic zoonotic diseases such as cystic and polycystic echinococcosis, respectively. In Brazil, polycystic echinococcosis has a restricted geographical distribution in the North Region, while cystic echinococcosis is observed in the South Region. Domestic dogs (Canis familiaris) fed with raw viscera represent a risk factor for E. granulosus (s.l.) infection in the South Region. Although this practice is frequent, it remains unclear whether domestic dogs are infected with E. vogeli in the state of Acre, located in the Amazon basin in the North Region of Brazil. The aim of this study was to investigate this gap in the polycystic echinococcosis epidemiology. Sixty-five fecal samples were collected from the ground in five municipalities (Sena Madureira, n = 14; Rio Branco, n = 06; Bujari, n = 06; Xapuri, n = 30; and Epitaciolândia, n = 09) located in the state of Acre, northern Brazil. The samples were screened for parasites by copro-PCR using the cox1 gene associated with automated sequencing. Echinococcus vogeli was molecularly confirmed in a sample from Sena Madureira and E. granulosus (sensu stricto) (s.s.) (G1) in a sample from Rio Branco. These findings indicate that molecular assays are useful in typing Echinococcus taxa from fecal samples of dogs in northern Brazil. The present study is the first molecular record of E. vogeli in domestic dogs found in the state of Acre, reinforcing their role as a source of infection for humans. Because E. granulosus (s.s.) (G1) was detected for the first time in the North Region, from the epidemiological standpoint this finding is highly relevant, because it expands the known geographical distribution, which was previously restricted to the South Region of Brazil.
Evaluation of a rapid immunochromatographic dipstick test for detection of antibodies to Trypanosoma cruzi in dogs experimentally infected with isolates obtained from opossums (Didelphis virginiana), armadillos (Dasypus novemcinctus), and dogs (Canis familiaris) from the United States.

Science.gov (United States)

Rosypal, Alexa C; Hill, Roderick; Lewis, Samantha; Barr, Stephen C; Valadas, Samantha; Gennari, Solange Maria; Lindsay, David S

2011-02-01

Dogs are reservoir hosts for Trypanosoma cruzi , the causative agent of American trypanosomiasis. A rapid immunochromatographic dipstick test (ICT) is available commercially for canine serological testing. The ICT was developed with the use of sera from South American dogs, but it is not routinely used in the United States. We evaluated the utility of the ICT in detecting anti-T. cruzi antibodies in dogs from the United States. Dogs (N = 64) were experimentally infected with United States' isolates of T. cruzi from an opossum (Didelphis virginiana), an armadillo (Dasypus novemcinctus), and a domestic dog (Canis familiaris), and were tested after experimental infection. Sera from uninfected United States dogs (n = 79; hemaculture negative) were used as negative controls. In a blind study, sera were tested by the ICT and compared to the indirect immunofluorescent antibody test with the use of Brazil-strain epimastigotes as antigen. The sensitivity of the ICT was 91% and the specificity was 98% in dogs experimentally infected with United States isolates. Our study indicates that the ICT could be a useful screening tool for serological surveillance of canine T. cruzi exposure in the United States.
'Candidatus mycoplasma haemodidelphidis' sp. nov., 'Candidatus mycoplasma haemolamae' sp. nov. and Mycoplasma haemocanis comb. nov., haemotrophic parasites from a naturally infected opossum (Didelphis virginiana), alpaca (Lama pacos) and dog (Canis familiaris): phylogenetic and secondary structural relatedness of their 16S rRNA genes to other mycoplasmas.

Science.gov (United States)

Messick, Joanne B; Walker, Pamela G; Raphael, William; Berent, Linda; Shi, Xun

2002-05-01

The 16S rRNA sequence of newly characterized haemotrophic bacteria in an opossum (Didelphis virginiana) and alpaca (Lama pacos) was determined. In addition, the 16S rRNA sequence of a haemotrophic parasite in the dog (Canis familiaris) was determined. Sequence alignment and evolutionary analysis as well as secondary structural similarity and signature nucleotide sequence motifs of their 16S rRNA genes, positioned these organisms in the genus Mycoplasma. The highest scoring sequence similarities were 16S rRNA genes from haemotrophic mycoplasma species (Haemobartonella and Eperythrozoon spp.). However, the lack of several higher-order structural idiosyncrasies used to define the pneumoniae group, suggests that these organisms and related haemotrophic mycoplasmas represent a new group of mycoplasmas. It is recommended that the organisms be named 'Candidatus Mycoplasma haemodidelphidis', 'Candidatus Mycoplasma haemolamae' and Mycoplasma haemocanis comb. nov., to provide some indication of the target cell and host species of these parasites, and to reflect their phylogenetic affiliation.
Epitelização de enxertos cutâneos em feridas recentes de coelhos tratados com membrana amniótica canina e/ou laserterapia

Directory of Open Access Journals (Sweden)

N. Reis Filho

Full Text Available RESUMO A enxertia cutânea é uma técnica cirúrgica simples e bastante útil para o reparo de feridas, principalmente aquelas onde existe dificuldade da aplicação do fechamento primário ou de outras técnicas reconstrutivas. Entretanto, para a sobrevivência do enxerto, é necessário que o leito da ferida esteja saudável e com presença de tecido de granulação exuberante. O objetivo do presente trabalho foi avaliar a aplicação da membrana amniótica e da laserterapia como potenciais estimulantes da cicatrização em enxertos aplicados em feridas sem tecido de granulação. Foram utilizados 42 coelhos, divididos em quatro grupos: grupo controle (GC, grupo membrana (GM, grupo laser (GL e grupo membrana e laser (GML, submetidos a avaliações macro e microscópicas. Na avaliação macroscópica, foi possível notar que os pacientes dos grupos nos quais a membrana amniótica foi utilizada (GM e GML apresentaram evidências associadas à acentuada reação inflamatória, à falha de integração do enxerto e à consequente necrose dele. Já os pacientes do GL apresentaram melhor aspecto do enxerto no último dia de avaliação. Na análise microscópica, observou-se intensa integração do enxerto à derme, reepitelização acentuada e escassas células inflamatórias no local do enxerto no GL. O contrário foi observado nos pacientes do GM e GML, nos quais aparentemente houve rejeição da membrana. A formação de colágeno não se correlacionou com outros fatores, como inflamação e necrose, em nenhum dos grupos de tratamento. Dessa forma, é possível afirmar que a laserterapia mostrou ser efetiva, contribuindo para o processo cicatricial e a integração do enxerto. Já a membrana amniótica canina não deve ser utilizada para esse fim, pois provoca intensa reação inflamatória, além de impedir a nutrição do enxerto.
Virus isolation and molecular characterization of canine distemper virus by RT-PCR from a mature dog with multifocal encephalomyelit Isolamento e caracterização molecular do vírus da cinomose canina por RT-PCR a partir de um cão adulto com encefalomielite multifocal

Directory of Open Access Journals (Sweden)

Alexandre Mendes Amude

2007-06-01

Full Text Available A case of multifocal distemper encephalomyelitis in a mature dog is described. In the presented case the ante mortem clinical diagnosis of canine distemper virus (CDV infection could not be ideally performed due to the absence of typical signs of distemper, such as myoclonus and systemic signs accompanying the nervous signs. The definitive diagnosis of distemper encephalomyelitis was only carried out at post mortem through virus isolation in cell culture from fresh central nervous system (CNS fragments and CDV nucleoprotein gene detection in the CNS by RT-PCR.Descreve-se um caso de encefalomielite multifocal pela cinomose em um cão adulto. No caso apresentado o diagnóstico clínico da infecção pelo vírus da cinomose canina (CDV não pode ser adequadamente realizado devido à ausência de sinais típicos da enfermidade, tais como mioclonia e sinais sistêmicos. O diagnóstico definitivo somente foi possível post mortem pelo isolamento do CDV em cultivo celular a partir dos fragmentos frescos do sistema nervoso central (SNC e pela detecção do gene da nucleoproteína do CDV em fragmentos do SNC por meio da RT-PCR.
A New Parallel Approach for Accelerating the GPU-Based Execution of Edge Detection Algorithms.

Science.gov (United States)

Emrani, Zahra; Bateni, Soroosh; Rabbani, Hossein

2017-01-01

Real-time image processing is used in a wide variety of applications like those in medical care and industrial processes. This technique in medical care has the ability to display important patient information graphi graphically, which can supplement and help the treatment process. Medical decisions made based on real-time images are more accurate and reliable. According to the recent researches, graphic processing unit (GPU) programming is a useful method for improving the speed and quality of medical image processing and is one of the ways of real-time image processing. Edge detection is an early stage in most of the image processing methods for the extraction of features and object segments from a raw image. The Canny method, Sobel and Prewitt filters, and the Roberts' Cross technique are some examples of edge detection algorithms that are widely used in image processing and machine vision. In this work, these algorithms are implemented using the Compute Unified Device Architecture (CUDA), Open Source Computer Vision (OpenCV), and Matrix Laboratory (MATLAB) platforms. An existing parallel method for Canny approach has been modified further to run in a fully parallel manner. This has been achieved by replacing the breadth- first search procedure with a parallel method. These algorithms have been compared by testing them on a database of optical coherence tomography images. The comparison of results shows that the proposed implementation of the Canny method on GPU using the CUDA platform improves the speed of execution by 2-100× compared to the central processing unit-based implementation using the OpenCV and MATLAB platforms.
Canine visceral leishmaniasis epidemiological survey in three sanitary districts of Salvador, Bahia state, Brazil Inquérito epidemiológico da leishmaniose visceral canina em três distritos sanitários do Município de Salvador, Bahia, Brasil

Directory of Open Access Journals (Sweden)

Fred da Silva Julião

2009-06-01

Full Text Available The goal of the present work was to investigate the occurence of canine Visceral Leishmaniasis (VL in Itapuã, Cajazeiras and Pau da Lima sanitary districts (SD, all belonging to the city of Salvador. In order to achieve it, a canine epidemiological and entomological surveys were applied as an epidemiological questionnaire to the owners of the animals sampled and to the veterinary physicians of the city. The study detected six VL seropositive dogs among the eight hundred and eleven ones randomly sampled. It was not possible to determine the autoctonous condition for L. chagasi infection. One animal was positive by culture of splenic material and in the entomologic survey of the vector, Lutzomyia longipalpis, none was captured. Veterinary clinicians from 41.7% of the clinics evaluated reported the diagnostic of, at least, one VL case in Salvador domiciliated dogs. The SD of Itapuã, Cajazeiras and Pau da Lima presented VL transmission risk once there is Leishmania parasite occurrence in the municipality, verified in this study by splenic culturing of an animal aspirative puncture, previous record of vector (L. longipalpis presence in the Itapuã district by the Bahia State Health Agency (SESAB and canine VL diagnostics by veterinary doctors from clinics all around the city of Salvador. This work is the first epidemiological analysis of this zoonosis in these SD and they point out the need to perform sampled entomological and serological surveys in all areas of the city. The development of a VL surveillance system may contribute for monitoring the disease in Salvador.Objetivou-se com este estudo investigar a ocorrência da Leishmaniose Visceral (LV canina nos Distritos Sanitários (DS de Itapuã, Cajazeiras e Pau da Lima, pertencentes ao município de Salvador, por meio da realização de inquérito sorológico canino; inquérito entomológico, aplicação de questionário epidemiológico aos proprietários dos animais amostrados e a m
Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, em cães de Minas Gerais, Brasil Angiostrongylus vasorum (Baillet, 1866 Nematoda: Prostostrongylidae, in dogs of Minas Gerais, Brasil

Directory of Open Access Journals (Sweden)

Walter dos Santos Lima

1985-06-01

Full Text Available Foi identificado Angiostrongylus vasorum (Baillet, 1866 colhido da artéria pulmonar de dois cães (Canis familiaris procedentes do município de Caratinga, Estado de Minas Gerais, Brasil. É apresentada a descrição morfológicas do parasita. Esta é a primeira referência desse parasita no Estado de Minas Gerais.For the first time Angiostrongylus vasorum in Canis familiaris in Minas Gerais State, Brazil, is described. The description and measurements of three males and ten females are presented together with a diagram of the parasite.

Canine distemper virus infection in a lesser grison (Galictis cuja: first report and virus phylogeny Infecção pelo vírus da cinomose canina em um furão (Galictis cuja: primeiro relato e filogenia viral

Directory of Open Access Journals (Sweden)

Jane Megid

2013-02-01

Full Text Available Infectious diseases in wild animals have been increasing as a result of their habitat alterations and closer contact with domestic animals. Canine distemper virus (CDV has been reported in several species of wild carnivores, presenting a threat to wildlife conservation. We described the first case of canine distemper virus infection in lesser grison (Galictis cuja. A free-ranging individual, with no visible clinical sigs, presented sudden death after one day in captivity. Molecular diagnosis for CDV infection was performed using whole blood collected by postmortem intracardiac puncture, which resulted positive. The virus phylogeny indicated that domestic dogs were the probable source of infection.Doenças infecciosas em animais selvagens têm aumentado devido às alterações em seu habitat e ao maior contato com animais domésticos. A cinomose já foi descrita em diversas espécies de carnívoros selvagens, representando uma ameaça à conservação da vida selvagem. Nesse estudo é descrito o primeiro caso de infecção pelo vírus da cinomose em um furão (Galictis cuja. Um indivíduo de vida livre, sem sinais clínicos aparentes, apresentou morte súbita após um dia em cativeiro. Foi realizado o diagnóstico molecular para detecção do vírus da cinomose canina, sendo o resultado positivo. A filogenia do vírus indicou que cães domésticos foram a provável fonte de infecção.
Automatic comic page image understanding based on edge segment analysis

Science.gov (United States)

Liu, Dong; Wang, Yongtao; Tang, Zhi; Li, Luyuan; Gao, Liangcai

2013-12-01

Comic page image understanding aims to analyse the layout of the comic page images by detecting the storyboards and identifying the reading order automatically. It is the key technique to produce the digital comic documents suitable for reading on mobile devices. In this paper, we propose a novel comic page image understanding method based on edge segment analysis. First, we propose an efficient edge point chaining method to extract Canny edge segments (i.e., contiguous chains of Canny edge points) from the input comic page image; second, we propose a top-down scheme to detect line segments within each obtained edge segment; third, we develop a novel method to detect the storyboards by selecting the border lines and further identify the reading order of these storyboards. The proposed method is performed on a data set consisting of 2000 comic page images from ten printed comic series. The experimental results demonstrate that the proposed method achieves satisfactory results on different comics and outperforms the existing methods.
Comparison of edge detection techniques for M7 subtype Leukemic cell in terms of noise filters and threshold value

Directory of Open Access Journals (Sweden)

Abdul Salam Afifah Salmi

2017-01-01

Full Text Available This paper will focus on the study and identifying various threshold values for two commonly used edge detection techniques, which are Sobel and Canny Edge detection. The idea is to determine which values are apt in giving accurate results in identifying a particular leukemic cell. In addition, evaluating suitability of edge detectors are also essential as feature extraction of the cell depends greatly on image segmentation (edge detection. Firstly, an image of M7 subtype of Acute Myelocytic Leukemia (AML is chosen due to its diagnosing which were found lacking. Next, for an enhancement in image quality, noise filters are applied. Hence, by comparing images with no filter, median and average filter, useful information can be acquired. Each threshold value is fixed with value 0, 0.25 and 0.5. From the investigation found, without any filter, Canny with a threshold value of 0.5 yields the best result.
Fatores ambientais associados à ocorrência de leishmaniose visceral canina em uma área de recente introdução da doença no Estado do Rio de Janeiro, Brasil

Directory of Open Access Journals (Sweden)

Tuanne Rotti Abrantes

2018-02-01

Full Text Available Resumo: Foi avaliada a associação entre características ambientais obtidas por sensoriamento remoto e a prevalência da leishmaniose visceral canina (LVC no bairro do Jacaré, área de recente introdução da doença, no Município de Niterói, Estado do Rio de Janeiro, Brasil. Trata-se de um estudo seccional para avaliação da prevalência de LVC, definida por meio da positividade no teste imunocromatográfico rápido em dupla plataforma (dual path platform - DPP, confirmada com o ensaio imunoenzimático (EIE. Foram incluídos 97 cães com prevalência de LVC de 21,6%. Houve maior frequência de LVC em cães com a convivência com outro cão, gambá, mico e ouriço-terrestre, assim como com a história de remoção de outros cães com LVC do domicílio. Na análise multivariada, ajustada por sexo e idade do cão, cães residentes em áreas com maior cobertura de vegetação esparsa apresentaram prevalência da infecção por Leishmania infantum cinco vezes maior do que aqueles que residiam em áreas menos vegetadas (OR = 5,72; IC95%: 1,47-22,20. Por outro lado, áreas mais urbanizadas caracterizadas como comerciais ou residenciais carentes, identificadas pelo sensoriamento remoto como aquelas com alta densidade de estruturas cinza, estiveram associadas à menor ocorrência da LVC (OR = 0,09; IC95%: 0,01-0,92. A maior prevalência de infecção em cães convivendo com outros animais silvestres e em áreas com maior cobertura vegetal, associada com menor prevalência em áreas urbanizadas, indica um padrão rural de transmissão da LVC nessa área.
Situación actual y control de la rabia en el Perú

Directory of Open Access Journals (Sweden)

Ana Maria Navarro V

2007-01-01

Full Text Available La rabia es una enfermedad endémica del Perú, que se presenta en dos ciclos, uno urbano relacionado a la transmisión por canes, y otro silvestre causado principalmente por la mordedura de murciélagos hematófagos. La mayoría de casos humanos de las últimas décadas han sido por rabia urbana, sin embargo, las medidas de control empleadas (campañas de vacunación canina, producción de vacunas, identificación del can mordedor, atención oportuna de la víctima y sistemas de vigilancia y notificación han logrado reducir la incidencia de rabia canina y por ende de los casos en humanos. Actualmente, el mayor número de casos humanos que se notifican en el Perú son causados por Desmodus rotundus.
Etiology, antimicrobial susceptibility profile and epidemiological aspects in canine otitis: a retrospective study of 616 casesEtiologia, perfil de sensibilidade aos antimicrobianos e aspectos epidemiológicos na otite canina: estudo retrospectivo de 616 casos

Directory of Open Access Journals (Sweden)

Verônica Baldim de Oliveira

2012-12-01

Full Text Available A retrospective study of etiology, antimicrobial susceptibility profile and multiple drug resistance, and major epidemiological aspects were investigated in 616 cases of canine otitis. Staphylococcus ? hemolitic (26.27%, Malassezia pachydermatis (12.35%, and Pseudomonas aeruginosa (8.8% were the most common microorganisms identified. The isolates were susceptible mainly to norfloxacin (89.62%, gentamicin (83.25%, and ofloxacin (80.16%. High occurrence of resistance of isolates was observed to neomicin (30.84% and cephalexin (27.63%. Multiple drug resistance to three or more and five or more of antimicrobials tested was observed in 34.9% and 15.5% of isolates, respectively. The cases of canine otitis occurred predominantly in first years of age, in mixed breeds animals, at autumn season. The presence of itch, bad smell, and secretion in ear conduct were the major signs observed at clinical examination. Estudo retrospectivo da etiologia, perfil de sensibilidade microbiana, ocorrência de multirresistência dos isolados e os principais aspectos epidemiológicos foram investigados em 616 casos de otite canina. Staphylococcus ? hemolítico (26,27%, Malassezia pachydermatis (12,35% e Pseudomonas aeruginosa (8,8% foram os micro-organismos mais frequentes. Os isolados foram sensíveis “in vitro” principalmente a norfloxacina (89,62%, gentamicina (83,25% e ofloxacina (80,16%. Alta ocorrência de resistência das linhagens foi observada frente à neomicina (30,84% e cefalexina (27,63%. A ocorrência de resistência múltipla a três ou mais e cinco ou mais dos antimicrobianos foi observada em, respectivamente, 34,9% e 15,5% dos isolados. Os casos ocorreram predominantemente nos primeiros anos de idade, em animais sem raça definida, no período do outono. A presença de prurido, mau cheiro e secreção no conduto auditivo foram os principais sinais observados ao exame clínico.
Análise TG-ROC de testes de imunofluorescência no diagnóstico de leishmaniose visceral canina Análisis TG-ROC de pruebas de inmunofluorescencia en el diagnóstico de leishmaniasis visceral canina TG-ROC analysis of immunofluorescence assays in canine visceral leishmaniasis diagnosis

Directory of Open Access Journals (Sweden)

Rita Maria da Silva

2009-12-01

Full Text Available OBJETIVO: Analisar a acurácia do diagnóstico de dois protocolos de imunofluorescência indireta para leishmaniose visceral canina. MÉTODOS: Cães provenientes de inquérito soroepidemiológico realizado em área endêmica nos municípios de Araçatuba e de Andradina, na região noroeste do estado de São Paulo, em 2003, e área não endêmica da região metropolitana de São Paulo, foram utilizados para avaliar comparativamente dois protocolos da reação de imunofluorescência indireta (RIFI para leishmaniose: um utilizando antígeno heterólogo Leishmania major (RIFI-BM e outro utilizando antígeno homólogo Leishmania chagasi (RIFI-CH. Para estimar acurácia utilizou-se a análise two-graph receiver operating characteristic (TG-ROC. A análise TG-ROC comparou as leituras da diluição 1:20 do antígeno homólogo (RIFI-CH, consideradas como teste referência, com as diluições da RIFI-BM (antígeno heterólogo. RESULTADOS: A diluição 1:20 do teste RIFI-CH apresentou o melhor coeficiente de contingência (0,755 e a maior força de associação entre as duas variáveis estudadas (qui-quadrado=124,3, sendo considerada a diluição-referência do teste nas comparações com as diferentes diluições do teste RIFI-BM. Os melhores resultados do RIFI-BM foram obtidos na diluição 1:40, com melhor coeficiente de contingência (0,680 e maior força de associação (qui-quadrado=80,8. Com a mudança do ponto de corte sugerido nesta análise para a diluição 1:40 da RIFI-BM, o valor do parâmetro especificidade aumentou de 57,5% para 97,7%, embora a diluição 1:80 tivesse apresentado a melhor estimativa para sensibilidade (80,2% com o novo ponto de corte. CONCLUSÕES: A análise TG-ROC pode fornecer importantes informações sobre os testes de diagnósticos, além de apresentar sugestões sobre pontos de cortes que podem melhorar as estimativas de sensibilidade e especificidade do teste, e avaliá-los a luz do melhor custo
Genetic diversity and genetic similarities between Iranian rose species

NARCIS (Netherlands)

Samiei, L.; Naderi, R.; Khalighi, A.; Shahnejat-Bushehri, A.A.; Mozaffarian, V.; Esselink, G.D.; Kazempour Osaloo, S.; Smulders, M.J.M.

2010-01-01

Wild rose species were collected from different regions of Iran for a rose breeding programme. They included accessions from Rosa persica, R. foetida, R. pimpinellifolia, R. hemisphaerica, R. canina, R. iberica, R. damascena, R. beggeriana, and R. orientalis. Ten microsatellite (simple sequence
Brucelosis canina en perros de la ciudad de Buenos Aires Canine brucellosis in dogs in the city of Buenos Aires

Directory of Open Access Journals (Sweden)

Eduardo Boeri

2008-08-01

Full Text Available La brucelosis canina, causada por Brucella canis, provoca epididimitis, atrofia testicular y esterilidad en los perros, mientras que en las hembras el síntoma principal es el aborto. La transmisión al hombre puede ser por contacto con el semen, orina, y/o fetos abortados de animales infectados. El presente estudio de tipo observacional de corte transversal, se realizó en caninos de barrios y asentamientos con alto índice de necesidades básicas insatisfechas (NBI en 8 áreas de la ciudad de Buenos Aires. Se estudiaron 219 perros, 184 hembras y 35 machos, que fueron negativos a la prueba de aglutinación con antígeno tamponado (BPAT, que descartó la infección con especies lisas del género Brucella. Sedetectaron anticuerpos anti-B. canis en 16 perros (7.3%, 9 hembras y 7 machos, este último dato es relevante ya que la orina de los machos es considerada uno de los medios de diseminación de la infección. Aunque sólo se pudieron tomar hemocultivos a 175 animales, en 3 (2 hembras y un macho se aislaron B. canis. Sólo 3 de los dueños de los perros positivos accedieron al diagnóstico serológico y dos resultaron positivos. Destacamos que la prueba de inmunodifusión en gel de agar (IGDA ha demostrado ser poco sensible, detectó sólo uno de los 16 casos positivos y ninguno de los tres confirmados por aislamiento. Concluimos que en las áreas estudiadas el hallazgo de perros serológicamente positivos y el aislamiento de B. canis en 3 casos, son indicadores del riesgo en el que se encuentra la salud de la población expuesta.Canine brucellosis, caused by Brucella canis, provokes epidydimitis, testicular atrophy and sterility in male dogs, while in females the major symptom is miscarriage. Transmission to humans may be through contact with semen, urine and/or aborted fetuses of infected animals. Our study, observational and cross-sectional, focused on dogs in lower class neighborhoods and slums with a high rate of unmet basic needs (UBN in
Edge and line detection of complicated and blurred objects

OpenAIRE

Haugsdal, Kari

2010-01-01

This report deals with edge and line detection in pictures with complicated and/or blurred objects. It explores the alternatives available, in edge detection, edge linking and object recognition. Choice of methods are the Canny edge detection and Local edge search processing combined with regional edge search processing in the form of polygon approximation.
Ondas ultra-sônicas de alta freqüência causam disfunção endotelial em artérias coronárias caninas epicárdicas High-frequency ultrasonic waves cause endothelial dysfunction on canine epicardial coronary arteries

Directory of Open Access Journals (Sweden)

Berent Discigil

2008-06-01

Full Text Available OBJETIVO: Aplicação de energia por ultra-som pode facilitar a remoção da placa ateromatosa, mas o efeito desse procedimento em vasos próximos ainda é matéria de estudos experimentais. MÉTODOS: Para determinar se a energia ultra-sônica compromete a produção de óxido nítrico, segmentos de artérias coronárias caninas foram expostos a baixos (0-10 W e altos (25 W níveis de energia por 15 segundos, utilizando-se protótipo de aparelho para a realização de endarterectomia. Após exposição, segmentos das artérias coronarianas foram estudados em organ chambers. Para os ensaios farmacológicos foram utilizadas as seguintes drogas:difosfato de adenosina (ADP, acetilcolina (Ach e fluoreto de sódio (NaF para a avaliação do relaxamento dependente do endotélio. O nitroprussiato de sódio (NPS e o isoproterenol foram utilizados para a avaliação do relaxamento independente do endotélio. RESULTADOS: A aplicação de alta energia ultra-sônica comprometeu o relaxamento dependente do endotélio induzido por ADP (10-9 - 10-4 M, Ach (10-9 - 10-4 M e NaF (0,5 -9,5 mM em artérias coronarianas epicárdicas. Entretanto, baixos valores de energia ultra-sônica não alteraram o relaxamento dependente do endotélio (nem o relaxamento máximo e nem a EC50 induzido pelos mesmos agonistas. O relaxamento da musculatura lisa vascular induzido por isoproterenol (10-9 - 10-5 M ou NPS (10-9 - 10-6 M não foi comprometido, tanto por baixos, quanto por altos níveis de energia ultra-sônica. CONCLUSÃO: Os experimentos demonstram que altas energias ultra-sônicas alteram a função endotelial. Entretanto, o ultra-som não altera a habilidade de relaxamento da musculatura lisa vascular de artérias caninas epicárdicas.OBJECTIVE: Application of ultrasound energy by an endarterectomy probe can facilitate the removal of atheromatous plaque, but the effect of this procedure on surrounding vessel structure and function is still a matter of experimental
Retrospective study (1998-2001 on canine ehrlichiosis in Belo Horizonte, MG, Brazil Estudo retrospectivo (1998 a 2001 da erliquiose canina em Belo Horizonte

Directory of Open Access Journals (Sweden)

S.M. Moreira

2003-04-01

. O número de diagnósticos de erliquiose aumentou consideravelmente a partir de 2000, sendo que 24,4% dos casos ocorreram em animais entre 13 e 24 meses de idade na cidade de Belo Horizonte e áreas peri-urbanas, verificando-se maior risco de infecção em animais que residiam em casas. Os sintomas mais freqüentes foram febre, anorexia, apatia, dor abdominal, linfadenopatia e dispnéia. Quanto às alterações hematológicas, 70,3% apresentaram anemia, 50% trombocitopenia e 30% leucopenia e a maioria das infecções por E. canis foi visualizada em monócitos. Os resultados apontam para a necessidade de maior atenção por parte dos clínicos e técnicos para a erliquiose canina uma vez que 35,9% dos cães atendidos com suspeita de hemoparasitoses apresentavam infecções por E. canis ou E. platys.
Canine distemper virus and Toxoplasma gondii co-infection in dogs with neurological signs

Directory of Open Access Journals (Sweden)

D.M. Aguiar

2012-02-01

Full Text Available O presente estudo relata a ocorrência de co-infecção entre o vírus da cinomose canina (CDV e Toxoplama gondii em cães com sinais neurológicos. Amostras de soro e tecido nervoso (pos-mortem de 21 cães, suspeitos de cinomose canina foram analisadas pela Reação de Imunofluorecência indireta (RIFI para pesquisa de anticorpos contra T. gondii e N. caninum e por RT-PCR para CDV. Dezessete (80,9% cães foram positivos para o CDV pela RT-PCR e 8 (38,1% foram positivos para anticorpos contra T. gondii. Sete cães (41,1% apresentaram-se positivos para ambos agentes, caracterizando processo de co-infecção. Somente 1 (4,7% cão foi soropositivo para N. caninum (RIFI=100, entretanto este mesmo animal foi positivo para T. gondii (RIFI=4096 e para CDV (RT-PCR.
Carapidae larvae (Acanthomorpha, Paracanthopterygii, Ophidiiformes) from the oceanic region of the southwest Atlantic Ocean off Brazil (12 22°S)

Science.gov (United States)

Namiki, C.; Bonecker, A. C. T.; de Castro, M. S.

2007-02-01

We report the occurrence and distribution of Carapidae larvae in the southwest Atlantic Ocean, between Real River (12°S) and São Tomé Cape (22°S), off Brazil. Carapidae larvae were collected during three oceanographic cruises: spring 1998, winter 1999 and autumn 2000. The hauls were conducted obliquely from a maximum depth of 200 m, during day and night, with bongo nets 330- and 500-μm mesh size. Three species were recorded in this study: Carapus bermudensis, Echiodon dawsoni and Snyderidia canina. Only one C. bermudensis was collected during the winter cruise off the Salvador coast (13°S). Twenty-one larvae of E. dawsoni were collected during the three cruises between 14.5° and 22°S, including some at the banks of Vitória-Trindade Ridge. One S. canina larva occurred, during the spring in the north coast of Rio de Janeiro (22°S).
Triterpene Acids from Rose Hip Powder Inhibit Self-antigen- and LPS-induced Cytokine Production and CD4(+) T-cell Proliferation in Human Mononuclear Cell Cultures

DEFF Research Database (Denmark)

Saaby, Lasse; Nielsen, Claus Henrik

2012-01-01

A triterpene acid mixture consisting of oleanolic, ursolic and betulinic acid isolated from a standardized rose hip powder (Rosa canina L.) has been shown to inhibit interleukin (IL)-6 release from Mono Mac 6 cells. The present study examined the effects of the triterpene acid mixture on the cyto...
NUISIBILITE DE L'HERBE A OIGNON, Cyperus rotundus L ...

African Journals Online (AJOL)

AISA

difficulté de leur maîtrise. Dans ce cas, le recours au traitement chimique devient incontournable. Mais, les produits chimiques pour contrôler cette adventice en culture cannière font cruellement défaut dans le contexte ivoirien. Ainsi, par exemple, le glyphosate a été testé vainement sur elle mais avec succès sur Imperata ...
Spatial distribution of human and canine visceral leishmaniasis in Belo Horizonte, Minas Gerais State, Brasil, 1994-1997 Distribuição espacial da leishmaniose visceral humana e canina em Belo Horizonte, Minas Gerais, Brasil, 1994-1997

Directory of Open Access Journals (Sweden)

Cláudia Di Lorenzo Oliveira

2001-10-01

Full Text Available In this paper, we present spatial analysis of the association between all incidents cases of human Visceral Leishmaniasis and seropositive dogs, from 1994 to 1997 in Belo Horizonte, a large Brazilian city. We geocoded 158 human cases and 11,048 seropositive dogs and compared canine prevalence rates with Human Bayesian Incidence rates in the same areas. We also used Knox's test to evaluate the hypothesis of space-time clustering of human cases in the period. Additionally, we used Kernel's maps for seropositive dogs distribution and located the human cases in the resulting smooth maps. We concluded that human and dog rates are correlated. Also, the Visceral Leishmaniasis in Belo Horizonte spread quickly, but apart from the rates' magnitude, it has kept the same spatial pattern through time. We believe it is possible to use this technique to choose areas to implement control measures against Visceral Leishmaniasis in a more efficient way.Neste artigo, apresentamos uma análise espacial da associação entre todos os casos incidentes de leishmaniose visceral e em cães soropositivos ocorridos em Belo Horizonte no período de 1994 a 1997. Geocodificamos 158 casos humanos e 11.048 cães positivos, comparamos as taxas de prevalência canina por área e as taxas Bayesianas de incidência da doença humana nas mesmas áreas. Usamos o teste de Knox para testar a hipótese de cluster espaço temporal entre os casos humanos no período examinado. Adicionalmente, construímos Mapas de Kernel para cães soropositivos e sobrepusemos os casos humanos em quatro áreas. Os resultados apontam para correlação entre casos humanos e caninos. Além disso, a leishmaniose visceral espalhou-se rapidamente em Belo Horizonte, embora tenha mantido o mesmo padrão durante os anos analisados. Acreditamos ser possível o uso das técnicas empregadas para priorizar áreas onde as medidas de controle devem ser implementadas.
"Wolves (Canis lupus) and dogs (Canis familiaris) differ in following human gaze into distant space but respond similar to their packmates' gaze": Correction to Werhahn et al. (2016).

Science.gov (United States)

2017-02-01

Reports an error in "Wolves ( Canis lupus ) and dogs ( Canis familiaris ) differ in following human gaze into distant space but respond similar to their packmates' gaze" by Geraldine Werhahn, Zsófia Virányi, Gabriela Barrera, Andrea Sommese and Friederike Range ( Journal of Comparative Psychology , 2016[Aug], Vol 130[3], 288-298). In the article, the affiliations for the second and fifth authors should be Wolf Science Center, Ernstbrunn, Austria, and Comparative Cognition, Messerli Research Institute, University of Veterinary Medicine Vienna/ Medical University of Vienna/University of Vienna. The online version of this article has been corrected. (The following abstract of the original article appeared in record 2016-26311-001.) Gaze following into distant space is defined as visual co-orientation with another individual's head direction allowing the gaze follower to gain information on its environment. Human and nonhuman animals share this basic gaze following behavior, suggested to rely on a simple reflexive mechanism and believed to be an important prerequisite for complex forms of social cognition. Pet dogs differ from other species in that they follow only communicative human gaze clearly addressed to them. However, in an earlier experiment we showed that wolves follow human gaze into distant space. Here we set out to investigate whether domestication has affected gaze following in dogs by comparing pack-living dogs and wolves raised and kept under the same conditions. In Study 1 we found that in contrast to the wolves, these dogs did not follow minimally communicative human gaze into distant space in the same test paradigm. In the observational Study 2 we found that pack-living dogs and wolves, similarly vigilant to environmental stimuli, follow the spontaneous gaze of their conspecifics similarly often. Our findings suggest that domestication did not affect the gaze following ability of dogs itself. The results raise hypotheses about which other dog skills
Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

Index Scriptorium Estoniae

Häniläne,, pseud.

2008-01-01

Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)
Gene : CBRC-EEUR-01-0576 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID

MICROWAVE JOINING OF ALUMINA CERAMIC AND HYDROXYLAPATITE BIOCERAMIC

Institute of Scientific and Technical Information of China (English)

无

1999-01-01

Microwave joining is a rapid developmental new techniqu e in recent years.This paper introduces a new microwave joining equipment which was made by our lab,succeeds in alumina ceramic-hydroxylapatite bioceramic j o in in the equipment, and analyzes the join situation of join boundary by using s canni ng electron microscope(SEM),this paper analyzes the mechanism of microwave joini ng also.
Etoposide-induced apoptosis in murine neuroblastoma (N2A cells infected with Paramyxoviruses Apoptose induzida por etoposídeo em células de neuroblastoma murino (N2A infectadas por paramixovírus

Directory of Open Access Journals (Sweden)

L. Moro

2003-02-01

Full Text Available The present study aimed to determine whether measles virus can induce apoptosis in murine neuroblastoma cells and the behavior of these cells under acute infection with measles virus or persistent infection with canine distemper virus upon treatment with etoposide. Measles virus induced necrosis in murine neuroblastoma cells. Canine distemper virus-persistent infection did not alter murine neuroblastoma cells behavior when treated with etoposide.O presente trabalho foi realizado tendo como objetivo determinar se o vírus de sarampo induz apoptose em células de neuroblastoma murino e avaliar o comportamento de células de neuroblastoma murino agudamente infectadas com vírus do sarampo ou persistentemente infectadas com o vírus da cinomose canina quando tratadas com etoposídeo. A infecção pelo vírus de sarampo induziu principalmente necrose em células de neuroblastoma murino. A infecção persistente pelo vírus de cinomose canina não alterou o comportamento de células de neuroblastoma murino tratadas com etoposídeo.
NCBI nr-aa BLAST: CBRC-XTRO-01-3294 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3294 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-134 48% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0762 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 2e-98 40% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0695 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-107 43% ...
Canine distemper virus detection in asymptomatic and non vaccinated dogs

Directory of Open Access Journals (Sweden)

Helen L. Del Puerto

2010-02-01

Full Text Available A quantitative real time polymerase chain reaction (PCR revealed canine distemper virus presence in peripheral blood samples from asymptomatic and non vaccinated dogs. Samples from eleven domestic dogs with no signs of canine distemper and not vaccinated at the month of collection were used. Canine distemper virus vaccine samples in VERO cells were used as positive controls. RNA was isolated with Trizol®, and treated with a TURBO DNA-free kit. Primers were designed for canine distemper virus nucleocapsid protein coding region fragment amplification (84 bp. Canine b-actin (93 bp was utilized as the endogenous control for normalization. Quantitative results of real time PCR generated by ABI Prism 7000 SDS Software showed that 54.5% of dogs with asymptomatic canine distemper were positive for canine distemper virus. Dissociation curves confirmed the specificity of the real time PCR fragments. This technique could detect even a few copies of viral RNA and identificate subclinically infected dogs providing accurate diagnosis of this disease at an early stage.A reação em cadeia da polimerase (PCR em tempo real revelou a presença do vírus da cinomose canina em amostra de sangue de cães assintomáticos e não vacinados. Amostra de onze cães domésticos sem nenhum sinal clínico de cinomose e que não foram vacinados no mês da coleta de sangue foram utilizados para análise. Amostra vacinal do vírus da cinomose canina em células VERO foi utilizada como controle positivo. O RNA total foi isolado utilizando-se Trizol®, e tratadas com o Kit TURBO DNA-free. Os iniciadores foram desenhados para amplificar a região do nucleocapsídeo viral com 319pb e 84pb para a PCR convencional e PCR em tempo real, respectivamente. O fragmento alvo da b-actina canina com 93pb foi utilizado como controle endógeno e normalizador. Resultados quantitativos da PCR em tempo real gerados pelo programa ABI Prism 7000 SDS demonstraram que 54,5% dos cães assintom
Aspectos epidemiológicos da leishmaniose visceral canina na zona rural do semiárido paraibano e análise de técnicas de diagnóstico

Directory of Open Access Journals (Sweden)

Raizza B.S. Silva

Full Text Available Resumo: No Brasil, a leishmaniose visceral é causada pela Leishmania infantum. É uma zoonose crônica e, frequentemente, fatal, sendo considerada um grave problema de saúde pública no mundo e reconhecida pela Organização Mundial de Saúde como uma das dezessete "Doenças Tropicais Negligenciadas". O presente estudo foi realizado em 2012, na zona rural do município de Patos, semiárido paraibano, com o objetivo de estimar a prevalência, os fatores de risco da leishmaniose visceral canina (LVC na região e avaliar os testes de diagnóstico sorológico. Foram coletadas 362 amostras de sangue e a prevalência da infecção foi determinada através de três técnicas sorológicas (ELISA, RIFI e Teste Imunocromatográfico DPP - Dual Path Plataform, sendo consideradas positivas as amostras que apresentaram pelo menos dois testes reagentes. As amostras positivas na sorologia foram testadas na PCR e qPCR. Aplicou-se um questionário epidemiológico aos proprietários para identificação dos possíveis fatores de risco. A taxa de prevalência foi de 11,33% (41/362. Considerou-se o ELISA como padrão ouro, já que é o teste confirmatório para a LVC pelo Ministério da Saúde. O DPP (Dual Path Plataform apresentou sensibilidade de 58% (95% CI: 0,43-0,72 e especificidade de 96% (95% CI: 0,93-0,98, com índice Kappa de 0,57. A RIFI apresentou sensibilidade de 85% (95% CI: 0,72-0,94, especificidade de 99% (95% CI: 0,98-1 e valor Kappa de 0,88. O fator de risco identificado na análise multivariada por regressão logística múltipla foi o sexo (OR=2,15 [1,09-4,21] e os cães machos apresentaram 2,15 vezes mais chances de serem infectados, que pode ser justificado por serem mais utilizados para a caça e como cão de guarda, dois fatores que aumentam a exposição do animal ao flebótomo. Em função da taxa de prevalência encontrada, indica-se a aplicação de medidas de controle no município. Os resultados da comparação dos ensaios sorol
An analysis of osteological material from the late Funnel Beaker culture settlement in Brozany, northwestern Bohemia

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2013-01-01

Roč. 65, č. 3 (2013), s. 504-534 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : archaeozoology * Eneolithic * puppies (Canis familiaris) * human newborns * fox * bird * fish * Apodemus * Unio * bone artefacts Subject RIV: AC - Archeology, Anthropology, Ethnology
Long-distance translocations to create a second millerbird population and reduce extinction risk

Science.gov (United States)

Holly Freifeld,; Sheldon Plentovich,; Chris Farmer,; Charles Kohley,; Peter Luscomb,; Work, Thierry M.; Daniel Tsukayama,; George Wallace,; Mark MacDonald,; Sheila Conant,

2016-01-01

Translocation is a conservation tool used with increasing frequency to create additional populations of threatened species. In addition to following established general guidelines for translocations, detailed planning to account for unique circumstances and intensive post-release monitoring to document outcomes and guide management are essential components of these projects. Recent translocation of the critically endangered Nihoa millerbird (Acrocephalus familiaris kingi) provides an example of this planning and monitoring. The Nihoa millerbird is a passerine bird endemic to Nihoa Island in the remote Northwestern Hawaiian Islands. The closely related, ecologically similar Laysan millerbird (Acrocephalus familiaris familiaris) went extinct on Laysan Island in the early 20th century when the island was denuded by introduced rabbits. To reduce extinction risk, we translocated 50 adult Nihoa millerbirds more than 1000 km by sea to Laysan, which has recovered substantially in the past century and has ample habitat and a rich prey-base for millerbirds. Following five years of intensive background research and planning, including development of husbandry techniques, fundraising, and regulatory compliance, translocations occurred in 2011 and 2012. Of 11 females in each cohort, 8 (2011 cohort) and 11 (2012 cohort) produced at least one brood of fledglings during their first year on Laysan. At the conclusion of monitoring in September 2014, 37 of the translocated birds were known to survive, and the population was estimated at 164 birds. The reintroduction of millerbirds to Laysan represents a milestone in the island's ongoing restoration.
Leishmaniose visceral: estudo de flebotomíneos e infecção canina em Montes Claros, Minas Gerais Visceral leishmaniasis: a study on phlebotomine sand flies and canine infection in Montes Claros, State of Minas Gerais

Directory of Open Access Journals (Sweden)

Érika Michalsky Monteiro

2005-04-01

Full Text Available A leishmaniose visceral no Brasil estava inicialmente associada a áreas rurais, mas devido às diversas alterações no ambiente como, desmatamentos, urbanização e intenso processo migratório, ocorreu a expansão das áreas endêmicas, levando à urbanização da doença, principalmente nas regiões Sudeste e Centro Oeste do país. No município de Montes Claros, situado ao norte de Minas Gerais, foi feito um estudo para verificação da situação da LV. No ano de 2002 foi realizado inquérito sorológico canino e no período de setembro de 2002 a agosto de 2003 foi feito levantamento entomológico, utilizando armadilhas luminosas de CDC. A prevalência da LV canina apresentou taxa média de infecção em torno de 5%. A fauna de flebotomíneos estimada foi de 16 espécies, totalizando 1043 exemplares. Lutzomyia longipalpis foi a espécie predominante com 74%, o que sugere a sua participação na transmissão de LV em Montes Claros.Visceral leishmaniasis in Brazil was initially associated with rural areas. However, due to several environmental modifications such as deforestation, urbanization and intense migratory processes, there has been an expansion of endemic areas, leading to urbanization of the disease, mainly in the central and northeastern regions of Brazil. In the municipality of Montes Claros, located in the north of the state of Minas Gerais, an epidemiological survey on VL was carried out. A canine serological inquiry was carried out in 2002 and an entomological survey, using luminous CDC traps, was performed from September 2002 to August 2003. Canine VL prevalence showed an average infection rate of approximately 5%. An estimated 16 species comprised the phlebotomine sand fly fauna, based on a total of 1043 specimens. The predominant species was Lutzomyia longipalpis with a rate of 74%, suggesting its participation in the transmission of VL in the municipality of Montes Claros.
Fuzzy Logic Based Edge Detection in Smooth and Noisy Clinical Images.

Directory of Open Access Journals (Sweden)

Izhar Haq

Full Text Available Edge detection has beneficial applications in the fields such as machine vision, pattern recognition and biomedical imaging etc. Edge detection highlights high frequency components in the image. Edge detection is a challenging task. It becomes more arduous when it comes to noisy images. This study focuses on fuzzy logic based edge detection in smooth and noisy clinical images. The proposed method (in noisy images employs a 3 × 3 mask guided by fuzzy rule set. Moreover, in case of smooth clinical images, an extra mask of contrast adjustment is integrated with edge detection mask to intensify the smooth images. The developed method was tested on noise-free, smooth and noisy images. The results were compared with other established edge detection techniques like Sobel, Prewitt, Laplacian of Gaussian (LOG, Roberts and Canny. When the developed edge detection technique was applied to a smooth clinical image of size 270 × 290 pixels having 24 dB 'salt and pepper' noise, it detected very few (22 false edge pixels, compared to Sobel (1931, Prewitt (2741, LOG (3102, Roberts (1451 and Canny (1045 false edge pixels. Therefore it is evident that the developed method offers improved solution to the edge detection problem in smooth and noisy clinical images.
Automatic segmentation of mandible in panoramic x-ray

OpenAIRE

Abdi, Amir Hossein; Kasaei, Shohreh; Mehdizadeh, Mojdeh

2015-01-01

As the panoramic x-ray is the most common extraoral radiography in dentistry, segmentation of its anatomical structures facilitates diagnosis and registration of dental records. This study presents a fast and accurate method for automatic segmentation of mandible in panoramic x-rays. In the proposed four-step algorithm, a superior border is extracted through horizontal integral projections. A modified Canny edge detector accompanied by morphological operators extracts the inferior border of t...
Boko Haram’s Path to Victory

Science.gov (United States)

2012-11-02

by the use of violence, providing services, and further information operations. The failure of the Nigerian Government to uphold its social contract...canny salesmen capable of scamming Americans out of millions such as with the 419 scam .13 Boko Haram needs to use this energy. It will also have...could gain the strategic communications high ground. Boko Haram should create a political arm to manipulate the media , NGO’s, and existing democratic
NCBI nr-aa BLAST: CBRC-CINT-01-0147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0147 ref|XP_547405.2| PREDICTED: similar to Feline leukemia virus subg...roup C receptor-related protein 1 (Feline leukemia virus subgroup C receptor) (hFLVCR) [Canis familiaris] XP_547405.2 2e-76 47% ...
Spatially-explicit modelling model for assessing wild dog control strategies in Western Australia

Science.gov (United States)

Large predators can significantly impact livestock industries. In Australia, wild dogs (Canis lupus familiaris, Canis lupus dingo, and hybrids) cause economic losses of more than AUD $40M annually. Landscape-scale exclusion fencing coupled with lethal techniques is a widely pract...
Factores asociados con la seropositividad a Brucella canis en criaderos caninos de dos regiones de Antioquia, Colombia

Directory of Open Access Journals (Sweden)

Laura Castrillón-Salazar

2013-10-01

Full Text Available El objetivo fue determinar la seroprevalencia a Brucella canis en perros y humanos convivientes en criaderos caninos y explorar los factores de riesgo asociados a la seropositividad. Se tomaron 20 criaderos, en los cuales se realizó diagnóstico serológico por PARP-2ME de 428 caninos y 91 humanos. Se aplicó una encuesta para determinar los factores de riesgo y se analizaron los datos mediante regresión logística. Se determinó una seroprevalencia de 15% en caninos y 9% en humanos convivientes. Se determinaron como factores asociados a la seropositividad canina el historial de seropositividad canina, conservar los caninos seropositivos, historial de aborto, higiene y protección del operario deficientes durante el servicio reproductivo, y procedimiento inseguro durante la atención de abortos. Como factores protectores se establecieron la ubicación rural de los criaderos, facilidad de aseo de los caniles, PARP-2ME premonta, y procedimiento seguro durante la atención de partos. En humanos se determinaron factores asociados: criaderos ubicados en el Valle Aburrá y de tipo urbano.
Dog handlers' and dogs' emotional and cortisol secretion responses associated with animal-assisted therapy sessions

NARCIS (Netherlands)

Haubenhofer, D.K.; Kirchengast, S.

2007-01-01

The study investigated 13 dog handlers and 18 companion dogs (Canis familiaris) working as teams in nonhuman animal-assisted service. The handlers described in questionnaires what emotions they chose to associate with their daily life and therapeutic work. They described their emotional condition
Inquérito epidemiológico sobre características da população canina e felina de um bairro próximo à zona rural em Cuiabá-MT, visando o controle da raiva animal Epidemiologic investigation into characteristics of canine and feline population in a district close to a rural area in Cuiabá-MT, with a view to control of animal rabies

Directory of Open Access Journals (Sweden)

João Garcia Caramori Junior

2003-06-01

Full Text Available Foram avaliados os questionários respondidos por 476 alunos, com idade entre 15 e 20 anos, de uma escola do bairro Pedra 90 em Cuiabá-MT, objetivando conhecer as características da população canina e felina daquele local. Dos 476 domicílios, em 371 (78%, foram registrados 513 cães e 307 gatos. Dos 513 cães, 289 (56,3% eram machos e 224 (43,7% fêmeas. Dos 307 gatos, 182 (59,3% eram machos e 125 (40,7% fêmeas. Os proprietários de 474 (92,4% cães e 267 (86,9% gatos afirmaram ter vacinado seus animais contra raiva.Questionnaires answered by 476 students (age 15-20 yrs attending a local school in the neighborhood of Pedra 90 in Cuiabá-MT were analyzed in order to study the characteristics of feline and canine populations in the region. The results showed that 371 (78% of the 476 families kept 513 dogs and 307 cats. Of 573 dogs, 289 (56.3% were male and 224 (43.7% were female. Of 307 cats, 182 (59.28% were male and 125 (40.72% were female. The owners of 474 (92.4% dogs and 267 (86.9% cats reported that their pets had been vaccinated against rabies.
Got Vision? Unity of Vision in Policy and Strategy: What it is, and Why we need it

Science.gov (United States)

2010-07-01

fail instead”—from Paul Carroll’s review of Alice Schroeder’s biogra- phy of Warren Buffet (Paul Carroll, “Why Panic Passes Him By,” The Wall Street...opponents”—this implies that the mindset, the calculations, and the capabilities of the enemy have to be taken into account , which is precisely where...27 In this regard, he bears an un- canny resemblance to Edward Lansdale.28 According to his own and others’ accounts , Lansdale applied considerable
Dicty_cDB: CHK317 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

50 CFR 14.4 - What terms do I have to understand?

Science.gov (United States)

2010-10-01

... under contract to and accredited by an accredited scientific institution for the purpose of conducting... an exhibit for the purpose of soliciting sales, without regard to quantity or weight. There is a... domesticus; Cattle—Bos taurus; Dog (domestic)—Canis familiaris; European rabbit—Ortyctolagus cuniculus...
The retinal fascin gene 2 (FSCN2) - partial structural analysis and polymorphisms detection in dogs with progressive retinal atrophy (PRA)

Czech Academy of Sciences Publication Activity Database

Horák, Pavel; Knoll, Aleš; Dvořák, J.

2006-01-01

Roč. 47, č. 4 (2006), s. 361-364 ISSN 1234-1983 R&D Projects: GA AV ČR 1QS500450578 Institutional research plan: CEZ:AV0Z50450515 Keywords : canis familiaris * FSCN2 gene * PCR-RFLP Subject RIV: EB - Genetics ; Molecular Biology
Can f 1 levels in hair and homes of different dog breeds: Lack of evidence to describe any dog breed as hypoallergenic

NARCIS (Netherlands)

Vredegoor, D.W.; Willemse, T.; Chapman, M.D.; Heederik, D.J.J.; Krop, E.J.M.

2012-01-01

BACKGROUND Certain dog breeds are described and marketed as being "hypoallergenic" on the basis of anecdotal reports that these dogs are better tolerated by patients allergic to dogs. OBJECTIVE These observations were investigated by comparing Can f 1 (major dog [Canis familiaris] allergen) levels
Preparation of Nanosilver and Nanogold Based on Dog Rose Aqueous Extract

OpenAIRE

Pulit, Jolanta; Banach, Marcin

2014-01-01

This paper describes a process of obtaining nanosilver and nanogold based on chemical reduction using substances contained in the aqueous extract of dog rose (Rosa canina). The resulting products were subjected to spectrophotometric analysis (UV-Vis), and testing of the nanoparticles’ size and suspension stability was carried out by measuring the electrokinetic potential, ζ, via dynamic light scattering (DLS). Solid samples were imaged by scanning electron microscopy (SEM). The obtained data ...
Aglutininas anti-leptospira em hemosoro de animais domésticos de diferentes espécies, no Estado da Bahia, 1997/1999

OpenAIRE

Viegas, S. A. R. A.; Caldas, E. M.; Oliveira, E. M. de D.

2001-01-01

p. 1-6 Dando continuidade a trabalhos anteriores, foram investigados hemosoros de animais domésticos das espécies bovina, equina, canina, felina, ovina e caprina, no total de 836, no período de 03 de janeiro de 1997 à 30 de junho de 1999, identificando-se os sorotipos mais freqüentes nas espécies estudadas. Os títulos variaram de 1: 100 a 1: 3200.
Quantification of gene expression in agrostis species subjected to zinc deficiency /

OpenAIRE

Canlı, Özge; Canli, Ozge

2007-01-01

Zinc is an essential micronutrient involved in many cellular mechanisms in biologycal systems and its deficiency causes severe reductions in crop yield and human health.In this study, our goal is to identify and characterize the genes expressed in three Agrostis species; Creeping (Agrostis stolonifera), Colonial (Agrostis capillaris) and Velvet (Agrostis canina) bentgrass upon exposure to zinc deficiency using mRNA differential display method. Differentially expressed fragments were sequenced...
Selenium status in adult cats and dogs fed high levels of dietary inorganic and organic selenium

NARCIS (Netherlands)

Todd, S.E.; Ugarte, S.E.; Thomas, D.G.; Bosch, Guido; Hendriks, W.H.

2012-01-01

Cats (Felis catus) maintain greater blood Se concentrations compared with dogs (Canis familiaris) and, unlike dogs, show no signs of chronic Se toxicity (selenosis) when fed dietary organic Se (selenomethionine) concentrations of 10 μg/g DM. This study investigated the response of cats and dogs to
Enfermedad valvular degenerativa canina: reporte de caso

Directory of Open Access Journals (Sweden)

Carmenza Janneth Benavides Melo

2014-07-01

Full Text Available En caninos, la enfermedad valvular degenerativa o endocardiosis es la patología cardiovascular con mayor prevalencia. Se caracteriza por regurgitación de la sangre hacia las aurículas, con disminución del gasto cardiaco, lo que lleva a sobrecarga de volumen con hipertrofia excéntrica e insuficiencia cardiaca congestiva. Este reporte tiene como objetivo describir los hallazgos clínicos y de necropsia de un canino, sugestivos de una endocardiosis valvular. El paciente ingresó por consulta externa a la Clínica Veterinaria Carlos Martínez Hoyos, de la Universidad de Nariño (Pasto, Colombia. Su propietario lo reportó enfermo desde hacía dos meses, con signos de enfermedad respiratoria, pérdida de peso y decaimiento. En el examen clínico se encontraron membranas mucosas muy pálidas, disnea inspiratoria, estertores, desdoblamiento de S2, soplo de regurgitación mesosistólico grado 4 y dilatación abdominal con signo de choque de onda positivo. En la necropsia se evidenció abundante cantidad de material de aspecto acuoso traslúcido en cavidad abdominal, torácica y pericárdica, corazón severamente aumentado de tamaño, redondeado, con engrosamiento de válvulas atrioventriculares, hígado con moderada disminución de tamaño y evidencia de lobulillación, riñones severamente disminuidos de tamaño y pálidos de superficie irregular con presencia de múltiples áreas quísticas en región corticomedular. Se tomaron muestras de estos tejidos y se fijaron en formol bufferado al 10 %, para después ser procesadas para análisis histopatólogico en el Laboratorio de Patología de la Universidad de Nariño, mediante la técnica de hematoxilina y eosina de rutina. De esta manera se diagnostica como enfermedad valvular degenerativa.
Paw Preference Correlates to Task Performance in Dogs

NARCIS (Netherlands)

Alphen, A. van; Bosse, T.; Frank, I.; Jonker, C.M.; Koeman, F.; Bara, B.G.; Barsalou, L.; Bucciarelli, M.

2005-01-01

A study involving 36 domestic dogs (Canis familiaris) in a simple search task provides evidence of a correlation between paw use and performance. The study was carried out to determine whether or not paw use is related to task performance. Different aspects of task performance were taken into
A village dog is not a stray : human-dog interactions in coastal Mexico

NARCIS (Netherlands)

Ruiz Izaguirre, E.

2013-01-01

Dogs (Canis familiaris) are considered one of the most numerous carnivores worldwide. Although in the Global North dogs are popular companions, that live inside homes, about 80% of the dogs in the world are village dogs. Village dogs are typically free-roaming, scavenge refuse around
Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

NARCIS (Netherlands)

Hassan, M.M.; Osman, O.F.; El-Raba'a, F.M.A.; Schallig, H.D.F.H.; Elnaiem, D.E.A.

2009-01-01

Background: The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a
Role of the domestic dog as a reservoir host of Leishmania donovani in eastern Sudan

NARCIS (Netherlands)

Hassan, Mo'awia M.; Osman, Omran F.; El-Raba'a, Fathi Ma; Schallig, Henk Dfh; Elnaiem, Dia-Eldin A.

2009-01-01

The study aims to determine the role of domestic dogs in transmission of visceral leishmaniasis in eastern Sudan. A cross-sectional survey was conducted in 10 villages along the River Rahad in eastern Sudan to elucidate the role of domestic dogs (Canis familiaris, Linnaeus, 1758) as a reservoir host
CANINE EHRLICHIOSIS

OpenAIRE

Gutierrez, Clara Nancy; Perez Yabarra, Luis; agrela, Irma Fatima

2016-01-01

La ehrlichiosis canina es una enfermedad infecciosa emergente transmitida por garrapatas, producida por Ehrlichia spp. (Proteobacteria: Ricketsiales), la cual afecta a miembros de la familia Canidae. Los agentes etiológicos son bacterias Gram negativas, intracelulares obligatorias, redondeadas y pleomórficas, esto último especialmente en cultivos celulares. Estas bacterias se localizan en vacuolas rodeadas de membranas (mórulas) en el citoplasma de células sanguíneas y dependiendo de la espec...
Dirofilariose canina na Ilha de São Luís, Nordeste do Brasil: uma zoonose potencial Canine heartworm on São Luís Island, Northeastern Brazil: a potential zoonosis

Directory of Open Access Journals (Sweden)

Silvia Maria Mendes Ahid

1999-04-01

Full Text Available Um inquérito sobre a prevalência da dirofilariose canina foi realizado entre 1.495 cães de 64 localidades na Ilha de São Luís, de 1991 a 1994, através da pesquisa de microfilárias. Desses, 1.358 cães (12,8% positivos não tinham história pregressa conhecida, sendo 1.265 errantes (10,3% microfilarêmicos e 93 domiciliados (37,8%. A dirofilariose foi detectada em 46 das localidade, porém a prevalência da infecção aumenta consideravelmente quando se trata de cães da orla marítima, de onde procederam 47% dos animais positivos. Em alguns bairros costeiros, a prevalência é elevada, como em Olho d'Água e Calhau (46% e 43% positivos, respectivamente. A pesquisa de microfilárias em 137 cães estritamente domiciliados (DO e com história pregressa conhecida (43% microfilarêmicos permitiu a comprovação da existência de transmissão na Ilha. Este estudo é o primeiro dessa natureza e abrangência realizado no Nordeste do País. Sabendo-se que a dirofilariose é uma zoonose, e diante da elevada prevalência de cães microfilarêmicos, particularmente os domiciliados da orla marítima da Ilha, chama-se a atenção para que se considere tal parasitose como possível causa de lesões pulmonares solitárias na população humana local e naquelas assentadas em áreas com clima e paisagem semelhantes no Nordeste.A survey on the prevalence of canine heartworm was conducted in 1,495 dogs from Maranhão Island, State of Maranhão, Northeastern Brazil, from 1991 to 1994, by testing for microfilariae in blood. Of the total, 1,358 (12.8% of which were infected were dogs with no known history; they included 1,265 homeless animals (10.3% with microfilariae and 93 kept by owners at the time the survey was conducted (37.8% of which were infected. Prevalence is high among dogs captured and/or living along the seashore. Examples of such high coastal prevalence rates were found in Olho d'Água and Calhau (46% and 43%, respectively. The search for
Serological Surveillance for Non-Rabies Lyssaviruses among ...

African Journals Online (AJOL)

Out of the seven recognized and four putative genotypes of lyssaviruses, genotypes 1-3 comprising namely the classical rabies virus (RABV), Lagos bat virus (LBV) and Mokola virus (MOKV) respectively have been reported in Nigeria. The domestic dog, Canis familiaris, is recognized as the reservoir for genotype 1, and the ...
Drilled teeth and shell artefacts from a grave at Prague-Březiněves and a review of decorative artefacts made from animal material from Corded Ware culture in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Kyselý, René; Dobeš, Miroslav; Svoboda, K.

-, - (2017) ISSN 1866-9557 R&D Projects: GA ČR(CZ) GA16-14855S Institutional support: RVO:67985912 Keywords : tooth pendants * shell beads * solar disc * dog (Canis familiaris) * Margaritifera auricularia * Chalcolithic (Copper Age) * Bohemia * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 1.844, year: 2016
Isolation of viable neospora caninum from brains of wild gray wolves (canis lupus)

Science.gov (United States)

Neospora caninum is a common cause of abortion in cattle worldwide. Canids, including the dog and the dingo (Canis familiaris), the coyote (Canis latrans), and the gray wolf (Canis lupus) are its definitive hosts, but also can act as intermediate hosts by harbor tissue stages of the parasite that ca...
An Attachment Perspective on the Child--Dog Bond: Interdisciplinary and International Research Findings

Science.gov (United States)

Jalongo, Mary Renck

2015-01-01

Understanding the process of attachment formation in young children has been a focal point in child development research for decades. However, young children's attachments are not only with human beings; they also form bonds with companion animals, particularly dogs ("Canis familiaris"). Given the number of dogs that are kept by families…
Image steganography based on 2k correction and coherent bit length

Science.gov (United States)

Sun, Shuliang; Guo, Yongning

2014-10-01

In this paper, a novel algorithm is proposed. Firstly, the edge of cover image is detected with Canny operator and secret data is embedded in edge pixels. Sorting method is used to randomize the edge pixels in order to enhance security. Coherent bit length L is determined by relevant edge pixels. Finally, the method of 2k correction is applied to achieve better imperceptibility in stego image. The experiment shows that the proposed method is better than LSB-3 and Jae-Gil Yu's in PSNR and capacity.
Geometric technique for the kinematic modeling of a 5 DOF redundant manipulator

CSIR Research Space (South Africa)

Makondo, N

2012-11-01

Full Text Available ,? Dipartimento di Elettronica, Informatica e Sistemistica (DEIS), Universit a di Bologna [Online]; Available at: http://www- lar.deis.unibo.it/people/cmelchiorri/Files Robotica/FIR 04 Kinem.pdf[31 October 2012] [18] Manocha, D.; Canny, J.F.; , ?Efficient... to the inverse kinematics of the Pioneer 2 robotic arm ?, Robotica, 2005, vol.23, pp.123, DOI: 10.1017/S0263574704000529 [20] De Xu, Carlos A. Acosta Calderon, John Q. Gan etc .An Analysis of the Inverse Kinematics for a 5-DOF Manipulator, International...

Independent component analysis of edge information for face recognition

CERN Document Server

Karande, Kailash Jagannath

2013-01-01

The book presents research work on face recognition using edge information as features for face recognition with ICA algorithms. The independent components are extracted from edge information. These independent components are used with classifiers to match the facial images for recognition purpose. In their study, authors have explored Canny and LOG edge detectors as standard edge detection methods. Oriented Laplacian of Gaussian (OLOG) method is explored to extract the edge information with different orientations of Laplacian pyramid. Multiscale wavelet model for edge detection is also propos
Autochthonous canine visceral leishmaniasis in a non-endemic area: Bom Sucesso, Minas Gerais State, Brazil Ocorrência de leishmaniose visceral canina autóctone em uma área não-endêmica: Bom Sucesso, Minas Gerais, Brasil

Directory of Open Access Journals (Sweden)

Marcio Roberto Silva

2008-02-01

sintomas característicos de leishmaniose visceral canina. Os resultados desta investigação epidemiológica foram enviados às autoridades locais e estaduais de saúde pública requerendo medidas preventivas e de controle para leishmaniose visceral de forma a interromper a transmissão da doença e evitar a ocorrência de casos humanos.
Unigene BLAST: CBRC-CFAM-35-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-35-0003 gnl|UG|Cfa#S19200945 ip12b05.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip12b05, mRNA sequence /clone=ip12b05 /gb=CK996905 /gi=45760585 /ug=Cfa.32635 /len=996 1.5 24% ...
Unigene BLAST: CBRC-CFAM-23-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-23-0020 gnl|UG|Cfa#S19198630 ip04e12.g1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip04e12, mRNA sequence /clone=ip04e12 /gb=CN002408 /gi=45766087 /ug=Cfa.29570 /len=708 8e-08 38% ...
Unigene BLAST: CBRC-CFAM-28-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-28-0014 gnl|UG|Cfa#S19200361 ip42h12.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip42h12, mRNA sequence /clone=ip42h12 /gb=CK995838 /gi=45759518 /ug=Cfa.10205 /len=413 4e-05 37% ...
Unigene BLAST: CBRC-CFAM-33-0021 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-33-0021 gnl|UG|Cfa#S19197038 ip37b10.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip37b10, mRNA sequence /clone=ip37b10 /gb=CK998901 /gi=45762581 /ug=Cfa.4074 /len=820 2e-18 79% ...
Unigene BLAST: CBRC-CFAM-01-0041 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-01-0041 gnl|UG|Cfa#S19200707 ip06d09.b1 Brain - Cerebellum Library (DOGEST8) Canis familiaris cDNA clone ip06d09, mRNA sequence /clone=ip06d09 /gb=CK996471 /gi=45760151 /ug=Cfa.45094 /len=754 7e-17 70% ...
Automated detection of slum area change in Hyderabad, India using multitemporal satellite imagery

Science.gov (United States)

Kit, Oleksandr; Lüdeke, Matthias

2013-09-01

This paper presents an approach to automated identification of slum area change patterns in Hyderabad, India, using multi-year and multi-sensor very high resolution satellite imagery. It relies upon a lacunarity-based slum detection algorithm, combined with Canny- and LSD-based imagery pre-processing routines. This method outputs plausible and spatially explicit slum locations for the whole urban agglomeration of Hyderabad in years 2003 and 2010. The results indicate a considerable growth of area occupied by slums between these years and allow identification of trends in slum development in this urban agglomeration.
A 3D edge detection technique for surface extraction in computed tomography for dimensional metrology applications

DEFF Research Database (Denmark)

Yagüe-Fabra, J.A.; Ontiveros, S.; Jiménez, R.

2013-01-01

Many factors influence the measurement uncertainty when using computed tomography for dimensional metrology applications. One of the most critical steps is the surface extraction phase. An incorrect determination of the surface may significantly increase the measurement uncertainty. This paper...... presents an edge detection method for the surface extraction based on a 3D Canny algorithm with sub-voxel resolution. The advantages of this method are shown in comparison with the most commonly used technique nowadays, i.e. the local threshold definition. Both methods are applied to reference standards...
Olin C. Wilson (1909-1994)

Science.gov (United States)

Preston, George W.

1995-02-01

Congenial, fiercely independent, and firmly grounded in the virtues of experimental science, Olin Wilson was a canny practitioner of the art of the possible in observational astrophysics as it flourished in the middle of the 20th century. He enjoyed a long association with the Astronomical Society of the Pacific as a contributor to its Publications, as President of the Society, and as recipient of its Catherine Wolfe Bruce Medal. By the time he departed, stellar astrophysics had matured and had acquired new dimensions due to Olin's diligence and curiosity. (SECTION: Obituary)
The DMM Bound

DEFF Research Database (Denmark)

Emiris, Ioannis Z.; Mourrain, Bernard; Tsigaridas, Elias

2010-01-01

) resultant by means of mixed volume, as well as recent advances on aggregate root bounds for univariate polynomials, and are applicable to arbitrary positive dimensional systems. We improve upon Canny's gap theorem [7] by a factor of O(dn-1), where d bounds the degree of the polynomials, and n is the number...... bound on the number of steps that subdivision-based algorithms perform in order to isolate all real roots of a polynomial system. This leads to the first complexity bound of Milne's algorithm [22] in 2D....
First- and Second-Order Full-Differential in Edge Analysis of Images

Directory of Open Access Journals (Sweden)

Dong-Mei Pu

2014-01-01

mathematics. We propose and reformulate them with a uniform definition framework. Based on our observation and analysis with the difference, we propose an algorithm to detect the edge from image. Experiments on Corel5K and PASCAL VOC 2007 are done to show the difference between the first order and the second order. After comparison with Canny operator and the proposed first-order differential, the main result is that the second-order differential has the better performance in analysis of changes of the context of images with good selection of control parameter.
[Trattamento della dipendenza da alcol. Alcol e giovani: punto di vista sociale].

Science.gov (United States)

Alessandrini, Giovanni; Ciccarelli, Rosaria; Battagliese, Gemma; Lombardo, Giuseppe; De Rosa, Francesca; Messina, Marisa Patrizia; Vitali, Mario; Pisciotta, Fabiola; Nanut, Miriana; Attilia, Maria Luisa; Ceccanti, Mauro

2018-01-01

RIASSUNTO. Gli adolescenti rappresentano la fascia di età più vulnerabile ai danni causati dall'abuso di alcol, in quanto iniziare a bere in giovane età è associato a un aumento del rischio di dipendenza da alcolici in età adulta. I giovani tendono a bere grandi quantità di alcolici al fine di ricercare forti emozioni e nel tentativo di raggiungere il divertimento a ogni costo, tramite le proprietà psicotrope degli alcolici. Le cause che li inducono ad assumere questi comportamenti sono da ricercare nella non conoscenza degli effetti dannosi dell'alcol, nel rito di convivialità sociale (evenienza per la quale si attribuisce all'alcol la funzione di facilitatore dell'aggregazione tra giovani), nella mancanza di interessi personali, nella scarsità dei controlli e nelle abitudini familiari. Le azioni da intraprendere per limitare o arrestare il consumo nocivo di alcol nei giovani si devono basare su interventi finalizzati a ritardare l'età del primo contatto con le bevande alcoliche, mediante la realizzazione di campagne educazionali rivolte ai giovani stessi, ai loro familiari e alla società intera.
Effects of pH on antioxidant and prooxidant properties of common medicinal herbs

Directory of Open Access Journals (Sweden)

Bayliak Maria M.

2016-01-01

Full Text Available Background: We studied in vitro and vivo antioxidant and prooxidant abilities of aqueous extracts from Rosa canina L., Rhodiola rosea L., Hypericum perforatum L., and Gentiana lutea L. Methodology: Total antioxidant capacity was measured by four assays (phosphomolybdate method, Fe3+-reducing activity, ABTS•+ scavenging, H2O2 scavenging. Prooxidant activity was estimated by H2O2 production. Yeast viability in the presence of H2O2 and/or plant extracts was determined by plating or by counting live cells’ number. Results: Plant extracts differed in the total phenolic content (R. canina > R. rosea > H. perforatum > G. lutea which clearly correlated with their ABTS•+ scavenging activity (R2 = 0.963. H2O2 scavenging activity was not clearly associated with plant phenol levels and was significantly higher in acidic, than in alkaline medium. In line with this, plant extracts effectively protected yeast S. cereviasiae against H2O2 and stimulated reproductive ability of yeast cells at acidic but not at alkaline pH. At alkaline pH, plant extracts produced certain amounts of H2O2 which were related to their phenolic content. Conclusion: The antioxidant activity of plant extracts is decreased at alkaline pH with an increase in the prooxidant activity. It reduces protective capacity of plant extracts against oxidative and other stresses in vivo.
Avaliação das atividades de controle da leishmaniose visceral em Belo Horizonte, Minas Gerais, 2006-2011

Directory of Open Access Journals (Sweden)

Maria Helena Franco Morais

Full Text Available OBJETIVO: avaliar as atividades de controle da leishmaniose visceral (LV em Belo Horizonte-MG, Brasil. MÉTODOS: estudo descritivo para avaliação do Programa de Vigilância e Controle da Leishmaniose Visceral pautado em seus objetivos; utilizaram-se dados dos Sistemas de Informação de Controle de Zoonoses e de Agravos de Notificação. RESULTADOS: entre 2007 e 2011, verificou-se adequação da estratégia de controle do reservatório com aumento da cobertura de áreas priorizadas (23,4% e da população canina examinada (43,3%, eutanásia dos cães sororreagentes superior a 85,0% e redução de 47,8% na soroprevalência canina; no período 2008-2011, observou-se redução na incidência de casos humanos de 7,2 para 3,9/100 mil habitantes; não houve ampliação da cobertura de áreas priorizadas para o controle do vetor. CONCLUSÃO: os indicadores de resultados demonstraram o alcance dos objetivos do programa, com diferente adequação entre as estratégias de controle; a complexidade da intervenção, porém, indica a necessidade de revisão das ações propostas.
Another way to learn about teaching: What dogs can tell us about the evolution of pedagogy.

Science.gov (United States)

Johnston, Angie M; McAuliffe, Katherine; Santos, Laurie R

2015-01-01

Kline argues that it is crucial to isolate the respective roles of teaching and learning in order to understand how pedagogy has evolved. We argue that doing so requires testing species that learn from pedagogy but that rarely teach themselves. Here, we review how one previously neglected species - domesticated dogs (Canis familiaris) - may allow researchers to do just that.
Determination of fatty acids and volatile compounds in fruits of rosehip(Rosa L.) species by HS-SPME/GC-MS and Im-SPME/GC-MS techniques

OpenAIRE

MURATHAN, ZEHRA TUĞBA; ZARIFIKHOSROSHAHI, MOZGAN; KAFKAS, NESİBE EBRU

2016-01-01

In this study, we aimed to compare fatty acid and volatile compound compositions of four rosehip species, namely Rosa pimpinellifolia, R. Villosa, R. Canina, and R. Dumalis, by gas chromatography with flame ionization detector (GC/FID) and headspace and immersion solid-phase microextraction gas chromatography-mass spectrometry (HS-SPME/GC-MS and Im-SPME/GC-MS) techniques. The total lipid contents in fruits of the rosehip species varied from 5.83% (R. Villosa) to 7.84% (R. Dumalis). A total of...
Herpesvirus canino 1: agente etiológico y enfermedad

OpenAIRE

Galosi, Cecilia Mónica

2007-01-01

El herpesvirus canino 1 es un alphaherpesvirus del cual se describe un solo serotipo. Este virus fue aislado en varios paises y en Europa es enzoótico en la población canina. Es uno de los principales agentes infecciosos relacionados a lesiones vesiculares en mucosas genitales y es causante de desórdenes reproductivos en caninos tales como reabsorciones fetales, abortos y muertes perinatales. Participa ocasionalmente como causante de la denominada Tos de las Perreras. Epidemiológicamente revi...
Dicty_cDB: Contig-U01557-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22
Genome Sequence of Canine Polyomavirus in Respiratory Secretions of Dogs with Pneumonia of Unknown Etiology.

Science.gov (United States)

Delwart, Eric; Kapusinszky, Beatrix; Pesavento, Patricia A; Estrada, Marko; Seguin, M Alexis; Leutenegger, Christian M

2017-07-20

We report here the first canine polyomavirus genome, identified by metagenomics in respiratory secretions of two dogs with severe pneumonia, which tested negative for all canine respiratory pathogens except Mycoplasma cynos The isolate, Canis familiaris polyomavirus 1 (DogPyV-1), is a beta polyomavirus whose closest known LT antigen relatives are primate polyomaviruses. Copyright © 2017 Delwart et al.

Patient positioning method based on binary image correlation between two edge images for proton-beam radiation therapy

International Nuclear Information System (INIS)

Sawada, Akira; Yoda, Kiyoshi; Numano, Masumi; Futami, Yasuyuki; Yamashita, Haruo; Murayama, Shigeyuki; Tsugami, Hironobu

2005-01-01

A new technique based on normalized binary image correlation between two edge images has been proposed for positioning proton-beam radiotherapy patients. A Canny edge detector was used to extract two edge images from a reference x-ray image and a test x-ray image of a patient before positioning. While translating and rotating the edged test image, the absolute value of the normalized binary image correlation between the two edge images is iteratively maximized. Each time before rotation, dilation is applied to the edged test image to avoid a steep reduction of the image correlation. To evaluate robustness of the proposed method, a simulation has been carried out using 240 simulated edged head front-view images extracted from a reference image by varying parameters of the Canny algorithm with a given range of rotation angles and translation amounts in x and y directions. It was shown that resulting registration errors have an accuracy of one pixel in x and y directions and zero degrees in rotation, even when the number of edge pixels significantly differs between the edged reference image and the edged simulation image. Subsequently, positioning experiments using several sets of head, lung, and hip data have been performed. We have observed that the differences of translation and rotation between manual positioning and the proposed method were within one pixel in translation and one degree in rotation. From the results of the validation study, it can be concluded that a significant reduction in workload for the physicians and technicians can be achieved with this method
Sepsis y muertes neonatales asociadas a estreptococo β hemolítico en caninos

OpenAIRE

Guerrero López, Ana Elizabeth

2016-01-01

Los porcentajes de mortalidad neonatal en caninos oscilan entre en el 5 y 35% siendo causales de importantes pérdidas económicas en los criaderos. Las enfermedades infecciosas bacterianas son la segunda causa de muertes neonatales caninas después de los problemas de manejo. Las bacterias implicadas pueden habitar en la vagina de la perra. El estreptococo β hemolítico es frecuentemente aislado de las vaginas de perras. En humanos, el estreptococo β hemolítico causa muertes neonatales infectánd...
Hepatozoon canis infection in a domestic dog in Southern Brazil confirmed by molecular techniques

OpenAIRE

Lasta, Camila Serina; Santos, Andrea Pires dos; Mello, Fabíola Peixoto da Silva; Lacerda, Luciana de Almeida; Messick, Joanne Belle; Díaz González, Félix Hilário

2009-01-01

Hepatozoonose canina é uma doença transmitida por carrapatos e causada pelo protozoário Hepatozoon spp. No Brasil, existem poucos relatos da infecção e dados sobre sua epidemiologia, patogenicidade, seus vetores e sua caracterização genética. No presente estudo, são utilizadas técnicas moleculares para o diagnóstico e a caracterização do parasita. Foi estudado um canino que apresentava emagrecimento progressivo, anemia regenerativa, neutropenia e hiperglobulinemia. Gamontes de Hepatozoon spp....
Aspectos epidemiológicos da infecção por leptospira spp em caninos urbanos de Araguaína, Tocantins, Brasil

OpenAIRE

GALVÃO, Samara Rocha

2009-01-01

Este estudo teve como objetivo investigar a prevalência de anticorpos anti- Leptospira spp, identificar os sorovares mais prevalentes, bem como avaliar possíveis fatores associados à prevalência sorológica antileptospírica em cães urbanos de Araguaína, Tocantins. Foi realizado um estudo transversal, abrangendo a população canina domiciliada na zona urbana do município. Analisaram-se 275 amostras, tendo sido realizada colheita domiciliar dos soros, em unidades sorteadas, após o consentiment...
Factores de riesgo implicados en el comportamiento agresivo del perro y del gato

OpenAIRE

Amat Grau, Marta

2011-01-01

El presente trabajo se centra en el estudio de algunos aspectos de la agresividad del perro y del gato. El estudio de la agresividad canina y felina es importante por varios motivos. En primer lugar, los problemas de agresividad del perro y del gato son muy frecuentes y, al menos en los centros de referencia, son el principal problema de comportamiento. La agresividad del perro y del gato también es importante, porque constituye una de las principales causas de eutanasia y abandono de perros ...
Identificação do sangue ingerido por Lutzomyia (Lutzomyia) longipalpis (Lutz & Neiva, 1912) e Lutzomyia (Lutzomyia) almerioi (Galati & Nunes, 1999) pela técnica imunoenzimática do ELISA de captura, no sistema avidina-biotina

OpenAIRE

Marassá,Ana Maria; Consales,Cleide Aschenbrenner; Galati,Eunice Aparecida Bianchi; Nunes,Vânia Lúcia Brandão

2006-01-01

Lutzomyia longipalpis e Lutzomyia almerioi, espécies integrantes da fauna flebotomínea da Serra da Bodoquena, no Estado de Mato Grosso do Sul, têm sido objeto de estudo devido às suas elevadas abundâncias no Assentamento Guaicurus, foco de leishmaniose tegumentar humana e visceral canina. Em pesquisas que vem sendo realizadas neste acampamento para a identificação de vetores destas parasitoses, foram capturados no período de 2002 a 2004, com armadilhas automáticas luminosas, instaladas em amb...
Registration of airborne LiDAR data and aerial images based on straight lines and POS data

Science.gov (United States)

Du, Quanye; Xu, Biao; Cao, Hui

2009-10-01

This paper presents a registration method which based on straight lines primitive. Firstly, 2D straight lines are extracted from aerial images using Canny operator and straight line fitting. In the similar way, 3D straight lines are extracted from LiDAR range images which derive from laser scanning point cloud. Secondly, 3D straight lines are projected to aerial images using collinearity equations and Position and Orientation System (POS) data. Then the corresponding lines are determined by straight line error. At last, each image's new exterior orientation elements are calculated by generalized point (straight line) photogrammetry.
Raiva humana transmitida por cães: áreas de risco em Minas Gerais, Brasil, 1991-1999 Human rabies transmitted by dogs: risk areas in Minas Gerais, Brazil, 1991-1999

Directory of Open Access Journals (Sweden)

Cristiana Ferreira Jardim de Miranda

2003-02-01

Full Text Available Com o objetivo de identificar e caracterizar as diferentes áreas de risco para a raiva humana transmitida por cães em Minas Gerais, realizou-se um estudo observacional retrospectivo quali-quantitativo, no período de 1991 a 1999. Utilizou-se a divisão do estado em 25 Diretorias Regionais de Saúde (DRS, vinculadas à Secretaria de Estado da Saúde de Minas Gerais (SES-MG. Os indicadores estudados foram a estimativa de população canina, a ocorrência de raiva canina e felina confirmada por exames laboratoriais, raiva humana notificada, coberturas vacinais e a infra-estrutura do serviço na DRS. Foram analisados os resultados de 2.845 fichas de diagnóstico laboratorial para raiva canina, felina e humana, provenientes dos laboratórios de referência para a raiva, relatórios de consolidados de vacinação anti-rábica animal da SES-MG dos anos de 1997 a 1999 e fichas de notificação dos casos de raiva humana da Fundação Nacional de Saúde (FUNASA. Realizou-se entrevista semi-estruturada com cada responsável regional pelo programa de controle da raiva. Os resultados permitem classificar Minas Gerais em quatro diferentes modalidades de risco: nulo, baixo, médio e alto.A retrospective study based on observation with the objective of identifying and characterizing the different risk areas for rabies transmission by dogs took place in Minas Gerais State, Brazil, from 1991 to 1999. Indicators confirmed occurrences of canine and feline rabies, notification of human rabies, and administration of appropriate vaccination. The Minas Gerais State Health System is divided into 25 Regional Health Centers, which are linked to the State Health Department (SES-MG. These Health Centers were utilized in the study. The results of 2,845 records of laboratory diagnosis for canine, feline, and human rabies were analyzed. Consolidated SES-MG reports from 1997 to 1999 for rabies vaccination and notification records for cases of human rabies from the National
Cultural Resource Reconnaissance of U.S. Army Corps of Engineers Land Alongside Lake Sakakawea in Mountrail County, North Dakota. Volume 1. Main Report

Science.gov (United States)

1987-02-11

introduced by man] (Canis familiaris), otter (Mustela lutra canadensis), badger (Taxidea taxus), porcupine (Erethizon epixanthus), beaver (Castor...grasslands to flourish, and was accompanied by an increase in the size of bison herds . The earliest European observers on the Northern Plains witnessed...Pleistocene megafauna living in herds .. .became extinct about 3000 years ago" (Hester 1960:66). 50 While present evidence from the study region is very
Estudo histológico e parasitológico do trato gastrintestinal de cães infectados com Leishmania (Leishmania) chagasi

OpenAIRE

Aldair Junio Woyames Pinto

2011-01-01

São poucas as descrições das alterações patológicas e parasitológicas relacionadas ao envolvimento do trato gastrointestinal (TGI) na leishmaniose visceral canina e, sobretudo considerando-se o TGI de forma sistemática. Assim, neste trabalho objetivou-se um estudo sistemático, clínico, anatomopatológico e parasitológico do TGI de cães naturalmente infectados com Leishmania (Leishmania) chagasi provenientes da região metropolitana de Belo Horizonte, MG. Após confirmação sorológica (RIFI e ELIS...
Epidemiological surveillance of cystic echinococcosis in dogs, sheep farms and humans in the Rio Negro Province

OpenAIRE

Pérez, Alicia; Costa, María T.; Gustavo, Cantoni; Mancini, Sergio; Mercapide, Carlos; Herrero, Eduardo; Volpe, Marcela; Araya, Daniel; Talmon, Gabriel; Chiosso, Carlos; Vázquez, Gabriela; Del Carpio, Mario; Santillán, Graciela; Larrieu, Edmundo

2006-01-01

La vigilancia de la equinococcosis quística para detectar infestación por Echinococcus granulosus en la Provincia de Río Negro en el período 1980-2002 fue efectuada en el hombre mediante encuestas serológicas y ultrasonográficas en población joven, y en el perro por el test de arecolina. Dadas las limitaciones de esta técnica, se planteó suplantarla por el complejo copro ELISA Western Blot en heces caninas recolectadas del suelo. El objetivo del presente trabajo fue comparar las ventajas y li...
Desarrollo de procesos biotecnológicos para la producción heteróloga de proteínas del virus de la rabia para su uso en medicina veterinaria

OpenAIRE

Picotto, Leandro Daniel

2018-01-01

El virus de la rabia causa una forma letal de encefalomielitis tanto en seres humanos como en animales. El control de la rabia canina, mediante programas de vacunación masiva y eliminación de los perros callejeros, puede reducir la incidencia de la rabia en humanos. En Argentina, las campañas de vacunación utilizan vacunas producidas en cerebro de ratones lactantes, pero la producción de estas vacunas involucra la manipulación del virus activo y es costosa; además, ha sido desaconsejada por l...
Canine mammary tumours: new insights into prognosis and molecular classification

OpenAIRE

Quaresma, Adelina Maria Gaspar Gama

2008-01-01

Tese de Doutoramento em Ciências Veterinárias Na espécie canina, os tumores mamários espontâneos representam a segunda neoplasia mais comum, sendo apenas ultrapassados pelos tumores de pele. Considerando os indivíduos do sexo feminino, os tumores de mama constituem a neoplasia espontânea mais frequente, representando os tumores malignos cerca de 50% dos casos observados. Estes factos suscitam um interesse crescente na pesquisa de factores de prognóstico credíveis na área dos tumores mamári...
CAUSAS DE MORTE E RAZÕES PARA EUTANÁSIA DE CÃES

OpenAIRE

Rafael Almeida Fighera

2008-01-01

A crescente aproximação afetiva entre os cães e o homem fez com que nos últimos anos fosse gerada muita informação científica sobre medicina canina. Entretanto, como a maior parte dessas informações é obtida através da literatura internacional, é comum que os clínicos e patologistas veterinários brasileiros necessitem extrapolar dados referentes à prevalência das diferentes doenças que causam morte de cães para nossa realidade. Baseado nisso, este estudo tem como objetivo principal dete...
Seropositividad a Leptospira interrogans en perros de la ciudad de Rosario, Argentina

OpenAIRE

Seghesso Zabala, Ada; Anthony Omezzolli, Lilian María; Poli Lovagnini, Georgina; Francois Barbagelata, Silvina

2013-01-01

Introducción: la leptospirosis es una de las zoonosis más difundidas mundialmente. La aparición de epidemias urbanas ocasionadas por las inundaciones, la transformaron en un grave problema para la salud pública. Una de las especies animales más afectadas por la leptospirosis es la canina. Los perros se infectan con Leptospira interrogans y padecen la enfermedad, que constituye uno de los factores de riesgo más importante en la transmisión de leptospiras en zonas urbanas. El diagnóstico de cer...
The feasibility of using antigens prepared with rough Brucella strains for diagnosis of canine brucellosis Utilidad de los antígenos preparados con cepas rugosas de Brucella en el diagnóstico de brucelosis canina

Directory of Open Access Journals (Sweden)

G. I. Escobar

2010-02-01

Full Text Available Clinical diagnosis of canine brucellosis is not sensitive enough and a negative blood culture cannot rule out the disease. Indirect methods of serological testing such as agar gel immunodiffusion (AGID, rapid slide agglutination test (RSAT and indirect enzyme linked immunoassay (IELISA are preferred for routine diagnosis. Since Brucella canis shares antigenic components with the Brucella ovis and Brucella abortus RB51 strain, it would seem that either strain could be used as antigen. We present data on AGID and IELISA tests using the B. ovis antigen, RSAT and IELISA using the B. canis antigen and IELISA using the B. abortus RB51 antigen. The cut-off values were adjusted by the ROC analysis; the IELISA-B. ovis cut-off value was 23 (%P and the IELISA-B. abortus RB51, 24 (%P, with 100% sensitivity and 98.8% specificity. RSAT detected 100% of positive cases, while AGID was less sensitive. The sera from dogs treated with antibiotic showed that %P correlated well with the clinical course. Sera from dogs presumptively infected with B. suis were negative in all tests performed with the rough Brucella strains. RSAT is a very sensitive screening test and IELISA-B. canis, B. ovis and B. abortus RB51 could be used as confirmatory tests, since they show good specificity and sensitivity.Las técnicas más usadas en el diagnóstico de brucelosis canina son la inmunodifusión en gel de agar (AGID, la microaglutinación en portaobjetos (RSAT y el ELISA indirecto ya que el diagnóstico clínico es poco sensible y el bacteriológico no excluye la enfermedad. Como Brucella canis comparte componentes antigénicos con Brucella ovis y Brucella abortus RB51, estas cepas podrían ser usadas indistintamente como antígenos. En este trabajo presentamos datos sobre las pruebas de AGID e IELISA con antígeno B. ovis, RSAT e IELISA con antígeno B. canis e IELISA con antígeno B. abortus RB51. Los puntos de corte ajustados con la curva ROC fueron (%P 23 para IELISA-B. ovis y
A 3D Image Filter for Parameter-Free Segmentation of Macromolecular Structures from Electron Tomograms

Science.gov (United States)

Ali, Rubbiya A.; Landsberg, Michael J.; Knauth, Emily; Morgan, Garry P.; Marsh, Brad J.; Hankamer, Ben

2012-01-01

3D image reconstruction of large cellular volumes by electron tomography (ET) at high (≤5 nm) resolution can now routinely resolve organellar and compartmental membrane structures, protein coats, cytoskeletal filaments, and macromolecules. However, current image analysis methods for identifying in situ macromolecular structures within the crowded 3D ultrastructural landscape of a cell remain labor-intensive, time-consuming, and prone to user-bias and/or error. This paper demonstrates the development and application of a parameter-free, 3D implementation of the bilateral edge-detection (BLE) algorithm for the rapid and accurate segmentation of cellular tomograms. The performance of the 3D BLE filter has been tested on a range of synthetic and real biological data sets and validated against current leading filters—the pseudo 3D recursive and Canny filters. The performance of the 3D BLE filter was found to be comparable to or better than that of both the 3D recursive and Canny filters while offering the significant advantage that it requires no parameter input or optimisation. Edge widths as little as 2 pixels are reproducibly detected with signal intensity and grey scale values as low as 0.72% above the mean of the background noise. The 3D BLE thus provides an efficient method for the automated segmentation of complex cellular structures across multiple scales for further downstream processing, such as cellular annotation and sub-tomogram averaging, and provides a valuable tool for the accurate and high-throughput identification and annotation of 3D structural complexity at the subcellular level, as well as for mapping the spatial and temporal rearrangement of macromolecular assemblies in situ within cellular tomograms. PMID:22479430
Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

Directory of Open Access Journals (Sweden)

Éloïse C Déaux

Full Text Available Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual or bimodal (audio-visual stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.
Aggressive Bimodal Communication in Domestic Dogs, Canis familiaris.

Science.gov (United States)

Déaux, Éloïse C; Clarke, Jennifer A; Charrier, Isabelle

2015-01-01

Evidence of animal multimodal signalling is widespread and compelling. Dogs' aggressive vocalisations (growls and barks) have been extensively studied, but without any consideration of the simultaneously produced visual displays. In this study we aimed to categorize dogs' bimodal aggressive signals according to the redundant/non-redundant classification framework. We presented dogs with unimodal (audio or visual) or bimodal (audio-visual) stimuli and measured their gazing and motor behaviours. Responses did not qualitatively differ between the bimodal and two unimodal contexts, indicating that acoustic and visual signals provide redundant information. We could not further classify the signal as 'equivalent' or 'enhancing' as we found evidence for both subcategories. We discuss our findings in relation to the complex signal framework, and propose several hypotheses for this signal's function.
Information Extraction of High-Resolution Remotely Sensed Image Based on Multiresolution Segmentation

Directory of Open Access Journals (Sweden)

Peng Shao

2014-08-01

Full Text Available The principle of multiresolution segmentation was represented in detail in this study, and the canny algorithm was applied for edge-detection of a remotely sensed image based on this principle. The target image was divided into regions based on object-oriented multiresolution segmentation and edge-detection. Furthermore, object hierarchy was created, and a series of features (water bodies, vegetation, roads, residential areas, bare land and other information were extracted by the spectral and geometrical features. The results indicate that the edge-detection has a positive effect on multiresolution segmentation, and overall accuracy of information extraction reaches to 94.6% by the confusion matrix.

Convolutional neural networks and face recognition task

Science.gov (United States)

Sochenkova, A.; Sochenkov, I.; Makovetskii, A.; Vokhmintsev, A.; Melnikov, A.

2017-09-01

Computer vision tasks are remaining very important for the last couple of years. One of the most complicated problems in computer vision is face recognition that could be used in security systems to provide safety and to identify person among the others. There is a variety of different approaches to solve this task, but there is still no universal solution that would give adequate results in some cases. Current paper presents following approach. Firstly, we extract an area containing face, then we use Canny edge detector. On the next stage we use convolutional neural networks (CNN) to finally solve face recognition and person identification task.
Esporotricose canina: relato de caso Canine sporotrichosis: case report

Directory of Open Access Journals (Sweden)

N.T. Souza

2009-06-01

Full Text Available Relata-se um caso de esporotricose em um cão da raça Boxer, macho, com seis anos, encaminhado para uma consulta por causa de massa na região nasal e de dispneia. Após o exame físico, o animal foi internado para a realização de citologia, histologia e radiografia. Nos exames citológico e radiográfico, não foram constatadas alterações que justificassem a massa e a dispneia. Na histologia, observou-se a presença de um granuloma contendo dois esporos de Sporothrix schenckii. Foi realizado tratamento com itraconazol 5mg/kg BID por 60 dias. Após esse período, a massa desapareceu e a respiração do animal melhorou, tendo sido recomendada a manutenção da terapia por mais 30 dias, para evitar recidiva.A case of canine sporotrichosis was reported in a six-year-old male Boxer, referred to a veterinary hospital because of a mass in the region of the nose and dyspnea. After physical examination, the animal was submitted to cytological, histological, and radiographic exams. The cytological and radiographic exams showed no alterations that could justify the mass and the dyspnea. The histological exam showed the presence of a granuloma with two Sporothrix schenckii spores. The dog was treated with itraconazol 5mg/kg BID during 60 days. After this period, the mass disappeared and breathing improved. The therapy was maintained for 30 other days to avoid relapse.
USO DE FIPRONIL SPRAY NO TRATAMENTO DA ESCABIOSE CANINA

Directory of Open Access Journals (Sweden)

Silvia Franco Andrade

2005-06-01

Full Text Available The objective of this work was to prove the effectiveness of the fipronil spray (FRONTLINE, a new synthetic molecule, as a safe acaricide in dogs. Were analyzed 10 dogs from the attendance of the service of Dermatology of the Veterinary Hospital and of the kennel of UNOESTE, Presidente Prudente, SP, with symptomatic and tested positive for scabies by scrapings, and used the fipronil spray in the whole body of the animal, besides external ear conduct, weekly until the disappearance of the symptoms and scrapings from the skin tested negative for scabies. The remission of the symptoms jointly with scraped of skin negative it happened on average from 4 to 6 weeks, demonstrating to be the fipronil spray effective and practical could be a safe alternative in the treatment of the canine scabies.
SOBREPOBLACIÓN CANINA Y FELINA: TENDENCIAS Y NUEVAS PERSPECTIVAS

OpenAIRE

Salamanca, C. A; Polo, L. J; Vargas, J

2011-01-01

A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, se consultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink y Medline, para la búsqueda de la información. Como palabras clave se utilizaron: perros de libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblación y control de población. Además se consultó el banco de publicaciones de la Sociedad Mundial para la Protección Animal (WSPA) y la Organización Internaci...
Alterações bioquímicas na leptospirose canina

Directory of Open Access Journals (Sweden)

Marcia Mery Kogika

1990-12-01

órgãos como fígado e rins, independente do sorotipo infectante. Assim, os níveis séricos de uréia e creatinina estavam relacionados ao comprometimento renal, enquanto a hiperbilirrubinemia e hiperfosfatasemia indicavam o comprometimento hepático, portanto, a existência de uma colestase intra-nepática. Os níveis de ALT e AST normais ou discretamente aumentados permitiram diferenciar a leptospirose de outros processos nepáticos ein que há necrose celular com liberação dessas enzimas citoplasmáticas para a circulação sangüínea.
Detecção do vírus da cinomose canina por RT-PCR utilizando-se oligonucleotídeos para os genes da fosfoproteína, hemaglutinina e neuraminidase Detection of canine distemper virus by RT-PCR using oligonucleotides targeted to the phosphoprotein, hemagglutinin and neuraminidase genes

Directory of Open Access Journals (Sweden)

M. Pozza

2007-10-01

Full Text Available Empregou-se a técnica de reação em cadeia pela polimerase precedida de transcrição reversa para detecção do vírus da cinomose canina (CC. Para a padronização da técnica foram selecionados quatro pares de oligonucleotídeos (P1, P2, N1, H1, baseados em seqüências dos genes da fosfoproteína, neuraminidase e hemaglutinina, sendo utilizadas três cepas vacinais de vírus da CC como controles positivos. Foram analisadas três amostras isoladas de cães com cinomose e quatro amostras provenientes de cães com suspeita clínica de cinomose. Não houve amplificação nas amostras com suspeita clínica da doença. Os resultados obtidos com os oligonucleotídeos P1 e N1 foram superiores aos de H1. Os oligonucleotídeos P2 foram considerados inapropriados para a detecção do vírus da CC. Os amplicons obtidos com os oligonucleotídeos P1, N1 e H1 foram clivados com endonucleases de restrição, sendo os perfis das amostras virais comparados aos da amostra vacinal Lederle, utilizada como referência. Um padrão similar de restrição foi observado em todas as amostras analisadas.The reverse transcription-polymerase chain reaction was used to detect canine distemper virus (CDV. Four oligonucleotide pairs were selected (P1, P2, N1, H1, based on the sequences of the phosphoprotein, hemagglutinin and nuraminidase genes for assay standardization, and three CDV vaccine strains were used as positive controls. Three viral isolates from dogs with canine distemper and four samples from animals clinically suspected of distemper were analysed. No amplification was detected in suspected samples. Results obtained by using P1 and N1 oligonucleotides were superior to those with H1 ones. P2 oligonucleotides were considered inadequate for CDV detection. Amplicons resulting from amplification of P1, N1 and H1 oligonucleotides were submitted to cleavage by restriction endonucleases and restriction patterns of viral samples were compared to that of Lederle strain
Characterisation of phenolic compounds in wild fruits from Northeastern Portugal.

Science.gov (United States)

Guimarães, Rafaela; Barros, Lillian; Dueñas, Montserrat; Carvalho, Ana Maria; Queiroz, Maria João R P; Santos-Buelga, Celestino; Ferreira, Isabel C F R

2013-12-15

This study aimed to analyse the phenolic composition of wild fruits of Arbutus unedo (strawberry-tree), Prunus spinosa (blackthorn), Rosa canina and Rosa micrantha (wild roses). Analyses were performed by HPLC-DAD-ESI/MS. P spinosa fruits presented the highest concentration in phenolic acids (29.78 mg/100 g dry weight), being 3-O-caffeoylquinic acid the most abundant one, and flavone/ols (57.48 mg/100 g), among which quercetin3-O-rutinoside (15.63 mg/100 g) was the majority compound. (+)-Catechin was the most abundant compound in A. unedo (13.51 mg/100 g) and R. canina (3.59 mg/100 g) fruits. A. unedo fruits presented the highest concentration in flavan-3-ols (36.30 mg/100 g). Cyanidin 3-O-glucoside was found in all the studied fruits, being the major anthocyanin in most of them, with the exception of P. spinosa samples, in which cyaniding 3-O-rutinoside and peonidin 3-O-rutinoside predominated; P. spinosa fruit presented the more complex anthocyanin profile among the analysed fruits and also the highest anthocyanin concentrations, which was coherent with its greater pigmentation. All in all, P. spinosa presented the highest levels of phenolic acids and flavonoids, including anthocyanins, flavonols and flavones, although no flavan-3-ols could be identified in its fruits. The present study represents a contribution to the chemical characterisation of phenolic compounds from wild fruits with acknowledged antioxidant activity and traditionally used for several folk medicinal applications. Copyright © 2013 Elsevier Ltd. All rights reserved.
Prevalencia de helmintos intestinales en caninos del departamento del Quindío.

Directory of Open Access Journals (Sweden)

María Isabel Giraldo

2005-09-01

Full Text Available Introducción. Los helmintos intestinales son agentes patógenos que afectan animales domésticos y que a través de ellos pueden infectar humanos. Objetivo. El objetivo del trabajo fue determinar la prevalencia de helmintos intestinales en perros con dueño del departamento del Quindío. Materiales y métodos. Estudio descriptivo prospectivo. Se aplicó una encuesta epidemiológica a los propietarios de los perros. Se recolectaron muestras de heces de los caninos registrados en la jornada de vacunación antirrábica del 2003 en el departamento del Quindío. Las muestras de materia fecal frescas fueron analizadas utilizando la técnica de diagnóstico de Ritchie. Resultados. Se analizaron 324 muestras de heces caninas; el 67,6% de los perros eran de razas puras y el 32,4% razas mestizas. Se encontró una prevalencia del 22,2%; Ancylostoma caninum fue el parásito más frecuente, 13,9%. También se observó Trichuris vulpis, 4,3%; Toxocara canis, 2,5%, y Strongyloides stercoralis, 4,0%. El 2,46% de las mascotas se encontraron multiparasitadas. Conclusión. La frecuencia de helmintos intestinales en el departamento del Quindío fue de 22,2% y la presencia de estos parásitos coincide con factores como la edad y la permanencia del canino en la calle, entre otros. Por esta razón, es necesario establecer programas de vigilancia y prevención en la población humana y canina.
Sensitisation to aeroallergens among asthmatic and non-asthmatic adolescents living in a poor region in the Northeast of Brazil.

Science.gov (United States)

Sarinho, E C S; Mariano, J; Sarinho, S W; Medeiros, D; Rizzo, J A; Almerinda R, S; Solé, D

2009-01-01

To assess the kind and frequency of sensitisation to aeroallergens (skin prick test - SPT) of asthmatic and non-asthmatic adolescents (13-14 years old) living in the city of Caruaru, Northeast of Brazil, and to analyse their exposure to some environmental factors. A case-control study was conducted with asthmatic (50) and non-asthmatic (150) adolescents diagnosed by the International Study of Asthma and Allergies in Childhood (ISAAC) written questionnaire. All were submitted to SPT with aeroallergens (house dust mites, cat and dog epithelium, cockroaches, moulds and grass) and completed a questionnaire to evaluate their environmental exposure. There were no significant differences between groups regarding gender, age, number of siblings and environmental exposure. Asthmatic subjects exhibited a higher frequency of positive SPTs than non-asthmatic subjects (54.0% vs 33.3%, p=0.009) mainly due to Periplaneta americana (34.0% vs 12.7%, p=0.0007 respectively) and Canis familiaris (20.0% vs 8.7%, p=0.029). Although sensitisation to aeroallergens was high among non-asthmatic adolescents, asthma was associated with parental history of atopic disease and sensitisation to P. americana and Canis familiaris but not to D. pteronyssinus showing that local studies are mandatory for the tailoring of appropriate management of allergic diseases.
Evaluación de un modelo de infección murino para la evaluación de vacunas homólogas y heterólogas contra Brucella canis Evaluation of a mouse infection model to evaluate homologue and heterologue vaccines against Brucella canis in mouse model

OpenAIRE

M Clausse; S.M. Estein

2011-01-01

La brucelosis canina es una enfermedad zoonótica que afecta a los caninos y provoca importantes pérdidas económicas en criaderos. En la actualidad, no existe una vacuna para la prevención de esta enfermedad. Una limitante en el desarrollo de una vacuna eficaz es la falta de un modelo experimental que permita evaluar la infección con Brucella canis. En este trabajo, se desarrolló un modelo ratón para evaluar la infección esplénica por B. canis empleando distintas dosis, tiempos de sacrificio y...
Perfil dos atendimentos antirrábicos humanos no agreste pernambucano, 2010-2012

OpenAIRE

Santos, Cleber Vinicius Brito dos; Melo, Rafaely Bezerra de; Brandespim, Daniel Friguglietti

2017-01-01

Resumo Objetivo: descrever as características das notificações de atendimento antirrábico humano nos municípios da Mesorregião do Agreste Pernambucano, Brasil, de 2010 a 2012. Métodos: estudo descritivo com dados das fichas de atendimento antirrábico humano do Sistema de Informação de Agravos de Notificação (Sinan). Resultados: foram incluídas 10.138 notificações de atendimento antirrábico humano; a espécie mais frequentemente envolvida foi a canina (68,1%), sob condição sadia (79,9%); ...
Aspectos anatomopatológicos em cães naturalmente infectados por Hepatozoon canis

OpenAIRE

Lima, Pâmela A.; Barçante, Joziana M.P.; Boeloni, Jankerle N.; Bezerra Júnior, Pedro S.; Wouters, Flademir; Wouters, Angélica T.; Varaschin, Mary S.; Seixas, Josilene N.

2017-01-01

RESUMO: A hepatozoonose canina é causada principalmente pelos protozoários Hepatozoon canis e H. americanum, transmitida por ingestão de carrapatos parasitados. Os sinais clínicos podem ser inespecíficos ou de difícil reconhecimento, pois geralmente ocorre associada a outras doenças. No Brasil, o parasito, e a doença, já foram identificados em vários Estados, no entanto pouco se sabe sobre as alterações clínicas e anátomo-patológicas decorrentes da infecção. O presente trabalho relata cinco c...
Avaliação da resposta imune humoral em cães jovens imunizados contra a cinomose com vacina de vírus atenuado

OpenAIRE

Luciane Biazzono; Mitika Kuribayashi Hagiwara; Antonio Roberto Corrêa

2001-01-01

Este estudo foi realizado com o objetivo de se investigar a cinética da resposta imune em cães jovens vacinados contra cinomose, com vírus atenuado, por meio do teste de soroneutralização. Onze cães sadios da raça Beagle, observados do nascimento até 30 meses de idade, isolados de outros cães, receberam vacina monovalente viva atenuada de cinomose canina aos 75, 105 e 135 dias de idade e doze meses após a terceira dose vacinal. O desenvolvimento de anticorpos foi mensurado pela reação de soro...
Alterações espermáticas e dos níveis plasmáticos de testosterona em cães experimentalmente infectados por Leptospira interrogans sorovar Canicola

OpenAIRE

Santana, Lucas Alves de Souza [UNESP

2008-01-01

Conhecendo-se a predileção das leptospiras pelo aparelho urogenital, e a crescente utilização de técnicas de reprodução assistida na espécie canina, o presente trabalho objetivou pesquisar a presença e a ação da Leptospira no sêmen e testículo de cães. Foram utilizados 32 animais, dos quais 20 foram inoculados com uma cepa patogênica de Leptospira interrogans sorovar Canicola e 12 não receberam inóculo algum, sendo considerados animais-controle. Assim, os 32 animais experimentais foram reunid...
Situación actual y control de la rabia en el Perú

OpenAIRE

Navarro V, Ana Maria; Bustamante N, José; Sato S, Alberto

2007-01-01

La rabia es una enfermedad endémica del Perú, que se presenta en dos ciclos, uno urbano relacionado a la transmisión por canes, y otro silvestre causado principalmente por la mordedura de murciélagos hematófagos. La mayoría de casos humanos de las últimas décadas han sido por rabia urbana, sin embargo, las medidas de control empleadas (campañas de vacunación canina, producción de vacunas, identificación del can mordedor, atención oportuna de la víctima y sistemas de vigilancia y notificación)...
Brote de rabia urbana transmitida por perros en el distrito de Santa Marta, Colombia, 2006-2008

OpenAIRE

Páez, Andrés; Rey, Gloria; Agudelo, Carlos; Dulce, Álvaro; Parra, Edgar; Díaz-Granados, Hernando; Heredia, Damaris; Polo, Luis

2009-01-01

Introducción. En el distrito de Santa Marta ocurrió un brote de rabia urbana entre abril de 2006 y enero de 2008, con cuatro casos fatales en humanos y 28 en perros. Objetivos. Describir el brote, las técnicas de diagnóstico de laboratorio y las acciones de control de foco empleadas. Medir el impacto de la vacunación antirrábica canina en términos de seroconversión de anticuerpos neutralizantes. Discutir el significado epidemiológico y las implicaciones en salud pública. Materiales y métodos....
Brote de rabia urbana transmitida por perros en el distrito de Santa Marta, Colombia, 2006-2008

OpenAIRE

Andrés Páez; Gloria Rey; Carlos Agudelo; Alvaro Dulce; Edgar Parra; Hernando Díaz-Granados; Damaris Heredia; Luis Polo

2009-01-01

Introducción. En el distrito de Santa Marta ocurrió un brote de rabia urbana entre abril de 2006 y enero de 2008, con cuatro casos fatales en humanos y 28 en perros. Objetivos. Describir el brote, las técnicas de diagnóstico de laboratorio y las acciones de control de foco empleadas. Medir el impacto de la vacunación antirrábica canina en términos de seroconversión de anticuerpos neutralizantes. Discutir el significado epidemiológico y las implicaciones en salud pública. Materiales y mé...
FIRST CASE OF AUTOCHTHONOUS HUMAN VISCERAL LEISHMANIASIS IN THE URBAN CENTER OF RIO DE JANEIRO: CASE REPORT

OpenAIRE

Silva, Guilherme Almeida Rosa da; Boechat, Thiago de Oliveira; Ferry, Fernando Raphael de Almeida; Pinto, Jorge Francisco da Cunha; Azevedo, Marcelo Costa Velho Mendes de; Carvalho, Ricardo de Souza; Motta, Rogerio Neves; Veras, Mariana Ferreira

2014-01-01

Visceral leishmaniasis is an anthropozoonosis that is caused by protozoa of the genus Leishmania, especially Leishmania (Leishmania) infantum, and is transmitted to humans by the bite of sandflies of the genus Lutzomyia, such as Lutzomyia longipalpis. There are many reservoirs, including Canis familiaris. It is a chronic infectious disease with systemic involvement that is characterized by three phases: the initial period, the state period and the final period. The main symptoms are fever, ma...
Comparison of canny and V1 neural network based edge detectors applied to road extraction

CSIR Research Space (South Africa)

Hauptfleisch, AC

2006-11-01

Full Text Available and vertically, for succes- sive pixels p and q that satisfy the distance and gradient orien- tation conditions. The conditions can be summarised as follows (See Figure 3): • The gradient at p must be approximately equal to the gra- dient at q plus 180...
Sub-surface defects detection of by using active thermography and advanced image edge detection

International Nuclear Information System (INIS)

Tse, Peter W.; Wang, Gaochao

2017-01-01

Active or pulsed thermography is a popular non-destructive testing (NDT) tool for inspecting the integrity and anomaly of industrial equipment. One of the recent research trends in using active thermography is to automate the process in detecting hidden defects. As of today, human effort has still been using to adjust the temperature intensity of the thermo camera in order to visually observe the difference in cooling rates caused by a normal target as compared to that by a sub-surface crack exists inside the target. To avoid the tedious human-visual inspection and minimize human induced error, this paper reports the design of an automatic method that is capable of detecting subsurface defects. The method used the technique of active thermography, edge detection in machine vision and smart algorithm. An infrared thermo-camera was used to capture a series of temporal pictures after slightly heating up the inspected target by flash lamps. Then the Canny edge detector was employed to automatically extract the defect related images from the captured pictures. The captured temporal pictures were preprocessed by a packet of Canny edge detector and then a smart algorithm was used to reconstruct the whole sequences of image signals. During the processes, noise and irrelevant backgrounds exist in the pictures were removed. Consequently, the contrast of the edges of defective areas had been highlighted. The designed automatic method was verified by real pipe specimens that contains sub-surface cracks. After applying such smart method, the edges of cracks can be revealed visually without the need of using manual adjustment on the setting of thermo-camera. With the help of this automatic method, the tedious process in manually adjusting the colour contract and the pixel intensity in order to reveal defects can be avoided. (paper)

Codici di autodisciplina e libertà di coscienza: per una democrazia più partecipativa e solidale

Directory of Open Access Journals (Sweden)

Fortunato Freni

2015-05-01

SOMMARIO: 1. Introduzione - 2. Un primo inventario dell’impegno sociale eticamente motivato: a filantropia; b ambientalismo, animalismo e veganismo; cclubs service; d valorizzazione dei beni culturali; e agricoltura sociale; f oratori; g finanza etica e sharing economy; h fondazioni familiari; i social streets; l architettura sociale; m orti urbani collettivi - 3. I codici di autodisciplina e la libertà di coscienza come trade union tra ordine giuridico e ordini spirituali - 4. Conclusioni.
Sarcoptic-mange detector dogs used to identify infected animals during outbreaks in wildlife

OpenAIRE

Alasaad, Samer; Permunian, Roberto; Gakuya, Francis; Mutinda, Matthew N.; Soriguer, Ramón C.; Rossi, Luca

2012-01-01

Abstract Background One of the main aims of forensic investigation is the detection and location of people and substances of interest, such as missing people and illegal drugs. Dogs (Canis lupus var. familiaris) have had an important role in legal and forensic investigations for decades; nonetheless canines’ keen sense of smell has never been utilized in either the surveillance or control of wildlife diseases. The rapid removal and treatment of infected carcasses and/or sick animals is a key ...
Epidemiological aspects and spatial distribution of human and canine visceral leishmaniasis in an endemic area in northeastern Brazil

OpenAIRE

Roseane Campos; Márcio Santos; Gabriel Tunon; Luana Cunha; Lucas Magalhães; Juliana Moraes; Danielle Ramalho; Sanmy Lima; José Antônio Pacheco; Michael Lipscomb; Amélia Ribeiro de Jesus; Roque Pacheco de Almeida

2017-01-01

Visceral leishmaniasis (VL) is a systemic disease endemic in tropical countries and transmitted through sand flies. In particular, Canis familiaris (or domesticated dogs) are believed to be a major urban reservoir for the parasite causing the disease Leishmania. The average number of human VL cases was 58 per year in the state of Sergipe. The city of Aracaju, capital of Sergipe in Northeastern Brazil, had 159 cases of VL in humans. Correlatively, the percentage of serologically positive dogs ...
High Penetrance of a Pan-Canina Type rDNA Family in Intersection Rosa Hybrids Suggests Strong Selection of Bivalent Chromosomes in the Section Caninae

Czech Academy of Sciences Publication Activity Database

Crhák Khaitová, Lucie; Werlemark, G.; Kovaříková, Alena; Nybom, H.; Kovařík, Aleš

2014-01-01

Roč. 143, 1-3 (2014), s. 104-113 ISSN 1424-8581 R&D Projects: GA ČR(CZ) GA13-10057S Institutional support: RVO:68081707 Keywords : Asymmetrical meiosis * Dogrose * Interspecies hybrid Subject RIV: BO - Biophysics Impact factor: 1.561, year: 2014
Flebotomíneos de áreas com notificações de casos autóctones de leishmaniose visceral canina e leishmaniose tegumentar americana em Angra dos Reis, Rio de Janeiro, Brasil Phlebotomine fauna in areas of autochthonous cases of canine visceral leishmaniasis and American cutaneous leishmaniasis in Angra dos Reis, Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Marcos Barbosa de Souza

2009-01-01

Full Text Available Flebótomos de áreas com notificações de casos autóctones de leishmaniose visceral canina e leishmaniose tegumentar americana em Angra dos Reis, Rio de Janeiro, Brasil. O município de Angra dos Reis apresenta casos humanos de leishmaniose tegumentar americana desde 1945. Inquéritos flebotomínicos realizados em 1978 revelaram a presença de Nyssomyia intermedia e a primeira notificação de Lutzomyia longipalpis no Rio de Janeiro, Ilha Grande, Angra dos Reis. Em agosto de 2002 foi notificado o primeiro caso canino de leishmaniose visceral na Ilha Grande, Angra dos Reis. Inquéritos flebotomínicos realizados nos peridomicílios, no período de novembro de 2002 a maio de 2003, em quatro localidades de Angra dos Reis, resultaram em 12.554 flebotomíneos e a presença de nove espécies: Brumptomyia sp.; Nyssomyia intermedia, Migonemyia migonei, Micropygomyia schreiberi, Pintomyia fischeri, Psychodopygus davisi, Psychodopygus ayrosai, Evandromyia tupinambay, Psathyromyia pelloni. foi Nyssomyia intermedia, predominante em todas as localidades, seguida por M.migonei. O principal vetor da LVA, Lutzomyia longipalpis, não foi detectado nas localidades, incluindo áreas do entorno, onde um cão infectado residia.The city of Angra dos Reis presents human cases of American cutaneous leishmaniasis since 1945. Phlebotomine surveys in 1978 had disclosed the presence of Nyssomyia intermedia and the first notification of Lutzomyia longipalpis in Rio de Janeiro, Ilha Grande, Angra dos Reis. In August of 2002 the first canine case of visceral leishmaniasis in the Ilha Grande, Angra dos Reis was notified. Surveys of phlebotomines in the peridomiciliary areas, in the period of November, 2002, through May, 2003, in four localities of Angra dos Reis, resulted in 12,554 specimens belonging to nine species: Brumptomyia sp. Nyssomyia intermedia, Migonemyia migonei, Micropygomyia schreiberi, Pintomyia fischeri, Psychodopygus davisi, Psychodopygus ayrosai
The use of bead beating to prepare suspensions of nuclei for flow cytometry from fresh leaves, herbarium leaves, petals and pollen.

Science.gov (United States)

Roberts, Andy V

2007-12-01

"Bead beating" is commonly used to release DNA from cells for genomic studies but it was used here to prepare suspensions of plant nuclei for measurement of DNA amounts by flow cytometry. Plant material was placed in 2-ml screw-capped tubes containing beads of zirconia/silica (2.5 mm diameter) or glass (2.5 or 1.0 mm diameter) and 1 ml of lysis buffer. The tubes were mechanically shaken with an FP120 FastPrep Cell Disrupter to release intact nuclei from plant tissue by the impact of the beads. The nuclei were then stained with propidium iodide (PI) and analyzed by flow cytometry. The method was tested using fresh leaves, fresh petals and herbarium leaves of Rosa canina, leaves and pollen of R. rugosa, and fresh leaves of Petroselinum crispum, Nicotiana tabacum, and Allium cepa. Batches of 12 samples of fresh leaves were prepared, simultaneously, in 45 s by bead beating in the Cell Disrupter. In flow cytometry histograms, nuclei of fresh leaves gave G(1)/G(0) peaks with CVs of less than 3.0% and nuclei from fresh petals and herbarium leaves of R. canina, and pollen of the generative nuclei of R. rugosa gave peaks with coefficients of variation (CVs) of less than 4.0%. DNA amounts estimated from 24-month-old herbarium leaves, using P. crispum as an internal standard, were less than those of fresh leaves by a small but significant amount. Suspensions of nuclei can be prepared rapidly and conveniently from a diversity of tissues by bead beating. Exposure of laboratory workers to harmful substances in the lysis buffer is minimized. (c) 2007 International Society for Analytical Cytology
Papilomatosis in dogs: literature review and study of twelve cases/ Papilomatose oral em cães: revisão da literatura e estudo de doze casos

Directory of Open Access Journals (Sweden)

Jane Megid

2009-07-01

Full Text Available Canine papillomatosis is an infectious viral disease characterized by oral, cutaneous or ocular papillomas, usually benign. The treatment is indicated in animals, with multiple tumors that produce pharyngeal obstruction, and problems of eating or for aesthetic reasons. Different treatment protocols have been proposed, including surgical excision, cryosurgery, electro surgery, autogenous or recombinant vaccines, imunomodulators drugs, systemic and intralesional chemotherapy. In this study were reviewed the more important aspects of canine oral papillomatosis. In the 12 studied animals, the papillomas were observed predominantly in mouth, gum and palate regions, in puppies until 12 months, presenting combined infection with ehrlichiosis. The treatment using Propionibacterium acnes and/or autogenous vaccine showed efficacy in eight dogs (66.7%.Papilomatose canina é uma enfermidade infecto-contagiosa viral caracterizada pela formação de papilomas orais, cutâneos ou oculares, geralmente benignos. O tratamento é indicado quando ocorre persistência dos tumores, lesões múltiplas causando obstrução faringeana, disfagia ou por razões estéticas. Diferentes protocolos de tratamento são descritos incluindo excisão cirúrgica, criocirurgia, eletrocirurgia, vacinas autógenas ou recombinantes, drogas imunomoduladoras, quimioterapia sistêmica ou intralesional. Foram revisados os principais aspectos clínico-epidemiológicos da papilomatose oral canina. Nos 12 animais estudados foram observados papilomas predominantemente em região de língua, gengiva e palato, com até 12 meses de idade e infecção combinada com erliquiose. O tratamento com Propionibacterium acnes e/ou vacina autócne surtiu efeito em oito animais (66,7%.
Estudo do uso do carvedilol em caes com cardiomiopatia dilatada

OpenAIRE

Wendt, Hamilton

2012-01-01

Resumo: A cardiomiopatia dilatada canina é uma doença do músculo cardíaco, de progressão lenta, na qual ocorre inicialmente uma dilatação excêntrica das paredes ventriculares com diminuição da contratilidade miocárdica, levando a uma disfunção sistólica. Posteriormente as câmaras atriais se dilatam, levando a uma insuficiência diastólica com quadro final de insuficiência cardíaca congestiva. É o distúrbio mais comum no miocárdio canino. Ocorre em cães jovens ou de meia idade e de médio ou gra...
ULTRASSONOGRAFIA DE ALTA FREQUÊNCIA PARA AVALIAÇÃO DO DESENVOLVIMENTO GESTACIONAL E DA FETOMETRIA EM CADELAS

OpenAIRE

FERRARI, Marlon

2009-01-01

O acompanhamento da gestação e os cuidados pré-natais estão intimamente relacionados com o nascimento de filhotes sadios. Na espécie canina a data em que ocorre a fecundação é muito imprecisa, tendo em vista que as fêmeas podem ovular durante sete a dez dias e o espermatozóide pode permanecer viável e armazenado por todo o estro, com isso a cópula não representa o melhor indicador do dia da fecundação. O conhecimento detalhado dos eventos que ocorrem durante a fecundação, desenvolvimento e ma...
High frequency of visceral leishmaniasis in dogs under veterinary clinical care in an intense transmission area in the state of Tocantins, Brazil

OpenAIRE

Santos, Helcileia Dias; Galvão, Samara Rocha; Dias, Francisca Elda Ferreira; Ribeiro, Taiã Mairon Peixoto; Negreiros Filho, Osmar; Sousa, Sebastiana Adriana Pereira; Minharro, Silvia

2017-01-01

ABSTRACT: A direct search for parasites were used as the diagnostic test to determine the frequency of Leishmania spp. infection in dogs ( Canis lupus familiaris ) under veterinary clinical care in the city of Araguaína, Tocantins, Brazil. For this approach, lymph node cell samples were collected using needle aspiration from 649 dogs of different breeds and ages. Two hundred and sixty four (40.7%) dogs tested positive for amastigote forms of Leishmania spp. Furthermore, 202 (76.5%) dogs tha...
First Case of Natural Infection in Pigs: Review of Trypanosoma cruzi Reservoirs in Mexico

Directory of Open Access Journals (Sweden)

Paz María Salazar-Schettino

1997-07-01

Full Text Available An epidemiological research project was performed in the State of Morelos including collection of samples for blood smears and culture, serological tests, and xenodiagnoses from a total of 76 domestic and peridomestic mammals. Two strains of Trypanosoma cruzi were isolated by haemocultures; one from a pig (Sus scrofa, the first case of natural infection reported in Mexico, and the other from a dog (Canis familiaris. This study summarizes current information in Mexico concerning confirmed reservoirs of T. cruzi
Dogs catch human yawns

OpenAIRE

Joly-Mascheroni, Ramiro M; Senju, Atsushi; Shepherd, Alex J

2008-01-01

This study is the first to demonstrate that human yawns are possibly contagious to domestic dogs (Canis familiaris). Twenty-nine dogs observed a human yawning or making control mouth movements. Twenty-one dogs yawned when they observed a human yawning, but control mouth movements did not elicit yawning from any of them. The presence of contagious yawning in dogs suggests that this phenomenon is not specific to primate species and may indicate that dogs possess the capacity for a rudimentary f...
Basic aspects of scintiphotography for the encephalopathy studies in Canis familiaris L.; Bases fotocintilograficas para o estudo das encefalopatias em Canis familiaris L.

Energy Technology Data Exchange (ETDEWEB)

Ramadinha, L S

1988-12-31

The development of encephalic scintillography on dogs using intravenous administered radiotracer, was presented. The study was conducted by administrating 20 m Cu/99 mTc pertechnetate into the radial vein of 14 normal dogs; the tracer was detected externally on the encephalus using a computerized gamma camera. The static pictures were easily obtained in 4 standard positions and presents good information about encephalic morphology. (author). 29 refs, 15 figs, 3 tabs.
Sobrepoblación canina y felina: tendencias y nuevas perspectivas

Directory of Open Access Journals (Sweden)

C. A. Salamanca

2011-06-01

Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, seconsultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink yMedline, para la búsqueda de la información. Como palabras clave se utilizaron: perrosde libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblacióny control de población. Además se consultó el banco de publicaciones de la SociedadMundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias(OIE. El objetivo de esta revisión fue presentar una posición crítica sobre laproblemática de la sobrepoblación de mascotas, su percepción cultural y la relaciónhombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posiblessoluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséisreferencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos quecumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión.A medida que aumente nuestro conocimiento acerca de la tenencia responsablede las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de laeducación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos conrespecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental queejerce el médico veterinario en la comunidad.
Sobrepoblación canina y felina: tendencias y nuevas perspectivas

Directory of Open Access Journals (Sweden)

C. A. Salamanca

2011-01-01

Full Text Available A través de una revisión sistemática de la literatura, publicada entre 1973 y 2009, se consultaron las siguientes bases de datos, a saber: ScienceDirect, Ebsco, Springerlink y Medline, para la búsqueda de la información. Como palabras clave se utilizaron: perros de libre ambulación, vínculo animal-humano, población de mascotas, sobrepoblación y control de población. Además se consultó el banco de publicaciones de la Sociedad Mundial para la Protección Animal (WSPA y la Organización Internacional de Epizootias (OIE. El objetivo de esta revisión fue presentar una posición crítica sobre la problemática de la sobrepoblación de mascotas, su percepción cultural y la relación hombre-animal. Asimismo, los fracasos asociados con esta relación, estableciendo posibles soluciones sin desconocer nuestro marco cultural. Se obtuvo un total de dieciséis referencias, a las que se aplicó los criterios de inclusión y exclusión; los artículos que cumplieron estos criterios son los que constituyeron la unidad de análisis de esta revisión. A medida que aumente nuestro conocimiento acerca de la tenencia responsable de las mascotas, mejorarán nuestros vínculos afectivos con estas. Solo a través de la educación sanitaria se puede adquirir el conocimiento necesario para evitar fracasos con respecto a una tenencia adecuada, de allí la responsabilidad y el papel fundamental que ejerce el médico veterinario en la comunidad.
Distance between images

Science.gov (United States)

Gualtieri, J. A.; Le Moigne, J.; Packer, C. V.

1992-01-01

Comparing two binary images and assigning a quantitative measure to this comparison finds its purpose in such tasks as image recognition, image compression, and image browsing. This quantitative measurement may be computed by utilizing the Hausdorff distance of the images represented as two-dimensional point sets. In this paper, we review two algorithms that have been proposed to compute this distance, and we present a parallel implementation of one of them on the MasPar parallel processor. We study their complexity and the results obtained by these algorithms for two different types of images: a set of displaced pairs of images of Gaussian densities, and a comparison of a Canny edge image with several edge images from a hierarchical region growing code.
Robot Navigation Control Based on Monocular Images: An Image Processing Algorithm for Obstacle Avoidance Decisions

Directory of Open Access Journals (Sweden)

William Benn

2012-01-01

Full Text Available This paper covers the use of monocular vision to control autonomous navigation for a robot in a dynamically changing environment. The solution focused on using colour segmentation against a selected floor plane to distinctly separate obstacles from traversable space: this is then supplemented with canny edge detection to separate similarly coloured boundaries to the floor plane. The resulting binary map (where white identifies an obstacle-free area and black identifies an obstacle could then be processed by fuzzy logic or neural networks to control the robot’s next movements. Findings show that the algorithm performed strongly on solid coloured carpets, wooden, and concrete floors but had difficulty in separating colours in multicoloured floor types such as patterned carpets.
Improved Palmprint Identification System

Directory of Open Access Journals (Sweden)

Harshala C. Salave

2015-03-01

Full Text Available Abstract Generally private information is provided by using passwords or Personal Identification Numbers which is easy to implement but it is very easily stolen or forgotten or hack. In Biometrics for individuals identification uses human physiological which are constant throughout life like palm face DNA iris etc. or behavioral characteristicswhich is not constant in life like voice signature keystroke etc.. But mostly gain more attention to palmprint identification and is becoming more popular technique using for identification and promising alternatives to the traditional password or PIN based authentication techniques. In this paper propose palmprint identification using veins on the palm and fingers. Here use fusion of techniques such as Discrete Wavelet transformDWT Canny Edge Detector Gaussian Filter Principle Component AnalysisPCA.
Gipuzkoan hegazti habigile batzuen lehen aipamenak eta beste aipamen interesgarri batzuk

Directory of Open Access Journals (Sweden)

OLANO, M., VAZQUEZ, J., AIERBE, T.

1998-01-01

Full Text Available Como resultado del trabajo de campo realizado estos últimos años, se da cuenta por primera vez de la presencia como aves nidificantes en Gipuzkoa de Fulica atra, Policeps cristatus, Tachybaptus ruficollis, Riparia riparia, Falco subbuteo, Asio otus, Aquila chysaëtos, Circaetus Gallicus y Drycopus martius. Además, se recogen datos de unas cuantas especies muy poco conocidas en esta provincia : Accipiter gentilis, Hieraëtus pennatus, Milvus migrans, Bubo bubo, Motacilla flava, Monticola solitarius and Certthia familiaris.
Effects of Harvest Times on the Fatty Acids Composition of Rose Hip (Rosa sp. Seeds

Directory of Open Access Journals (Sweden)

Mehmet Güneş

2017-04-01

Full Text Available This study was conducted to determine the change of fatty acids ratios of some rose hip species seeds in different harvest times. Seeds of five genotypes belonging to rose hip species (Rosa sp. were used in the study. The fruits of species were harvested in six different ripening times and analyzed. Total oil analysis was performed for the fifth harvest only, which was determined as the optimal harvest time. As a result; total oil ratio of rose hip seeds varied as 5.22 and 6.62 g/100g respectively for accessions of Rosa dumalis (MR-12 and MR-15, 6.37 g/100g for R. canina (MR-26, 5.00 g/100g for R. dumalis ssp. boissieri (MR-46 and 5.29 g/100g for R. villosa (MR-84. Eleven fatty acids were determined in rose hip seeds. Among these fatty acids linoleic, oleic, linolenic, palmitic and stearic acids respectively had high ratio. Saturated fatty acids ratio (SFAs was the highest in R. canina (MR-26 and the lowest in R. dumalis (MR-12; monounsaturated fatty acids ratio (MUFAs was the highest in R. dumalis (MR-12 and the lowest in R. dumalis ssp. boissieri (MR-46; polyunsaturated fatty acids ratio (PUFAs was the highest in R. dumalis ssp. boissieri (MR-46 and the lowest in R. dumalis (MR-12. Mono and polyunsaturated fatty acid contents obtained in this study was high; the change of fatty acid profile in the studied species in relation to harvest time was significant for some species and insignificant for others. A conclusion was reached that it is important to pay attention to qualitative and quantitative properties of seeds when conducting studies about rose hip improvement.

Foco de leishmaniasis en El Hobo, municipio de El Carmen de Bolívar, Bolívar, Colombia

Directory of Open Access Journals (Sweden)

Luis Alberto Cortés

2006-10-01

Full Text Available Introducción. Se describen las características epidemiológica e importancia de la especies de Lutzomyia presentes en un foco de leishmaniasis en la vereda El Hobo Carmen de Bolívar, departamento de Bolívar. Objetivos. Obtener un conocimiento preliminar de la transmisión de leishmaniasis en la vereda El Hobo Carmen de Bolívar. Materiales y métodos. Se analizaron datos epidemiológicos y se realizaron capturas de flebótomos con trampas CDC y cebo humano en la vereda El Hobo. Para establecer la sero prevalencia de leishmaniasis visceral canina se hizo un estudio en perros mediante la técnica de inmunofluorescencia indirecta. Resultados. Se capturaron nueve especies de Lutzomyia: L. trinidadensis, L. evansi, L .cayennensis, L. venezuelensis, L. gomezi,L. dubitans, L. ylephiletor, L. yuilli, y L. walkeri. Las especie de mayor importancia por sus implicaciones en la transmisión de leishmaniasis cutánea y visceral fueron L. gomezi, y L. evansi respectivamente. Se reporta por primera vez para Bolívar especimenes de L. venezuelensis, L. dubitans, L. ylephiletor, L. yuilli, y L. walkeri. Se determinó una prevalencia de leishmaniasis visceral del 36% en los caninos estudiados. Según los reportes epidemiológicos, en el 2002 en el municipio de Carmen de Bolívar la leishmaniasis cutánea mostró un aumento del 40% y la leishmaniasis visceral canina del 80% de los casos con respecto al 2001, debido al brote presentado en la vereda El Hobo Conclusiones. Los resultados determinan a la vereda El Hobo como una zona de riesgo potencial de transmisión de leishmaniasis cutánea y visceral.
Distribución de Lutzomyia longipalpis en el Chaco Argentino, 2010

Directory of Open Access Journals (Sweden)

Oscar D. Salomón

2011-06-01

Full Text Available El riesgo de leishmaniasis visceral (LV urbana epidémica se registró por primera vez en la Argentina en el año 2004, por presencia del vector Lutzomyia longipalpis en la provincia de Formosa, la provincia de Misiones registra casos de LV humana, LV canina y vector en el año 2006, y la provincia de Corrientes en el verano 2008-2009. En la provincia de Santiago del Estero los casos de LV humana y LV canina en el año 2008 estuvieron asociados posiblemente a vectores secundarios. Por ello, para conocer la distribución del riesgo en la región del Chaco, entre enero y abril del 2010 se realizó la búsqueda sistemática del vector de LV en 30 localidades de las provincias de Formosa, Chaco y en la ciudad de Reconquista, Santa Fe (224 trampas/noche. Se comprobó la presencia de Lu. longipalpis, por primera vez, en las localidades de Resistencia y Puerto Antequera (Chaco. En Clorinda y Puerto Pilcomayo (Formosa se obtuvieron las trampas con más ejemplares, 158 y 241 Lu. longipalpis trampa/sitio/noche respectivamente. Los resultados muestran que el vector de la LV urbana epidémica continúa dispersándose en el territorio argentino, habiendo ingresado a la provincia de Chaco. La notificación de casos esporádicos en la región chaqueña, transmitidos por vectores secundarios, como Lu. migonei, podría aumentar también debido a la vigilancia intensificada, y a la dispersión del parásito asociada al tránsito de perros infectados, sintomáticos o asintomáticos.
Estructura comunitaria de helmintos de perros vagabundos de San Juan de Lurigancho, Lima, Perú Community structure of helminths in stray dogs from San Juan de Lurigancho, Lima, Peru

Directory of Open Access Journals (Sweden)

José O. Iannacone

2001-07-01

Full Text Available Thirty stray dogs Canis familiaris Linnaeus, 1758 were collected in San Juan de Lurigancho, Lima, Peru, between January and March 1997 and necropsied for helminths. Three species were collected: the cestodes Dipylidium caninum (Linnaeus, 1758 Railliet, 1892 and Taenia pisiformis (Bloch, 1780 and the nematode Toxocara canis (Werner, 1782 Stiles, 1905. Fifty per cent of the examined dogs showed one or two parasites. A total of 303 (0-116 helminths were recovered and the intensity of infection was 30,3. The Simpson index (C for all parasite species was 0,414, indicating a dominance by one species in the parasite community. The mean diversity in the infracommunities of C. familiaris was H' = 0,038 and uniformity index of Pielou J = 0,207. Dipylidium caninum, T. pisiformis, and T. canis presented a prevalence of infection of 33,30%, 10% and 16,6% respectively. Dipylidium caninum presented the highest frequency and mean intensity of infection. Dipylidium caninum was the helminth with the highest dominance (94% whereas the lowest was due to T. pisiformis (4% and T. canis (2%. Helminths were not related to the age of the hosts, prevalence and mean intensity of infection. Out of the 10 equally divided segments of the intestinal gut, D. caninum was found from the 6th to the 9th segment. T canis preferred almost exclusively the 1st segment while T. pisiformis was randomly distributed.
Adaptation of a lead-tolerant population of Agrostis tenuis to low soil fertility

Energy Technology Data Exchange (ETDEWEB)

Jowett, D

1959-07-04

A population of Agrostis tenuis growing on lead ore grindings at Goginan was found to be tolerant of lead. The pasture populations responded to calcium and phosphate, whereas the lead mine population showed no response to calcium and a lesser response to phosphate. The lead mine population data was included. A considerable range of adaption to soil mineral levels has now been found in this species. It has populations tolerant of lead, copper, and nickel poisoning, and of low levels of calcium and phosphate. In lead mine habitats A tenuis is not replaced by A. canina as in more normal habitats. A tenuis is subject to the most extreme conditions of low fertility. 4 tables.
cuidados de enfermagem veterinária

OpenAIRE

Sousa, Ana Margarida Gomes de

2014-01-01

O herpesvírus está disseminado na população canina mundial, com uma seroprevalência de cerca de 40 a 80%. A infeção por herpesvírus canino causa elevadas taxas de mortalidade em cachorros e em cães adultos pode permanecer em estado latente ou ser reativado. A infeção por este vírus em canis de reprodução representa grandes perdas económicas, pelo que se pretende estudar a seroprevalência de herpesvírus em 52 cães pertencentes a dois canis de reprodução, para fins de venda de cães de raça. ...
NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0952 ref|NP_003851.1| barrier to autointegration factor 1 [Homo sapien...s] ref|NP_892033.1| barrier to autointegration factor 1 [Bos taurus] ref|XP_854776.1| PREDICTED: similar to barrier to autointegratio...n factor 1 [Canis familiaris] ref|XP_001111817.1| PREDICTED: similar to barrier to autointegration...: similar to barrier to autointegration factor 1 isoform 2 [Macaca mulatta] ref|XP_001111884.1| PREDICTED: s...imilar to barrier to autointegration factor 1 isoform 3 [Macaca mulatta] ref|XP_001111924.1| PREDICTED: similar to barrier to autoint
Polar lipid composition of mammalian hair.

Science.gov (United States)

Wix, M A; Wertz, P W; Downing, D T

1987-01-01

The types and amounts of polar lipids from the hair of monkey (Macacca fascicularis), dog (Canis familiaris), pig (Sus scrofa) and porcupine (Erethizon dorsatum) have been determined by quantitative thin-layer chromatography. The polar lipid content of the hair samples ranged from 0.6 to 1.6 wt%. Lipid compositions included ceramides (57-63% of the polar lipid by weight), glycosphingolipids (7-9%) and cholesteryl sulfate (22-29%). Several minor components (4-7%) remain unidentified. The results suggest that cholesteryl sulfate may be an important determinant of the cohesiveness of hair.
Data structures and algorithm analysis in Java

CERN Document Server

Shaffer, Clifford A

2011-01-01

With its focus on creating efficient data structures and algorithms, this comprehensive text helps readers understand how to select or design the tools that will best solve specific problems. It uses Java as the programming language and is suitable for second-year data structure courses and computer science courses in algorithm analysis. Techniques for representing data are presented within the context of assessing costs and benefits, promoting an understanding of the principles of algorithm analysis and the effects of a chosen physical medium. The text also explores tradeoff issues, familiari
Do domestic dogs (Canis lupus familiaris) perceive the Delboeuf illusion?

Science.gov (United States)

Miletto Petrazzini, Maria Elena; Bisazza, Angelo; Agrillo, Christian

2017-05-01

In the last decade, visual illusions have been repeatedly used as a tool to compare visual perception among species. Several studies have investigated whether non-human primates perceive visual illusions in a human-like fashion, but little attention has been paid to other mammals, and sensitivity to visual illusions has been never investigated in the dog. Here, we studied whether domestic dogs perceive the Delboeuf illusion. In human and non-human primates, this illusion creates a misperception of item size as a function of its surrounding context. To examine this effect in dogs, we adapted the spontaneous preference paradigm recently used with chimpanzees. Subjects were presented with two plates containing food. In control trials, two different amounts of food were presented in two identical plates. In this circumstance, dogs were expected to select the larger amount. In test trials, equal food portion sizes were presented in two plates differing in size: if dogs perceived the illusion as primates do, they were expected to select the amount of food presented in the smaller plate. Dogs significantly discriminated the two alternatives in control trials, whereas their performance did not differ from chance in test trials with the illusory pattern. The fact that dogs do not seem to be susceptible to the Delboeuf illusion suggests a potential discontinuity in the perceptual biases affecting size judgments between primates and dogs.
Performance constraints in strength events in dogs (Canis lupus familiaris).

Science.gov (United States)

Helton, William S

2011-01-01

Ecological performance in animals is considered to be constrained by trade-offs between structural and physiological features. Some of the best anatomical and physiological data in support of this perspective are based on findings from canines, in which researchers have demonstrated skeletal shape trade-offs between running efficiency and strength. There has, however, actually been little examination of the link between these structural differences and relevant performance. In this paper I analyze the performance of six breeds of dogs in standardized weight pulling competitions. More brachycephalic shaped (broad headed) dogs are indeed significantly stronger than more dolichocephalic shaped (narrow headed) dogs even when controlling for body mass. Morphological trade-offs between power and running ability may be an important constraint on the evolution of canines and other terrestrial vertebrates. Copyright © 2010 Elsevier B.V. All rights reserved.
Word generalization by a dog (Canis familiaris: is shape important?

Directory of Open Access Journals (Sweden)

Emile van der Zee

Full Text Available We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs.
Word Generalization by a Dog (Canis familiaris): Is Shape Important?

Science.gov (United States)

van der Zee, Emile; Zulch, Helen; Mills, Daniel

2012-01-01

We investigated the presence of a key feature of human word comprehension in a five year old Border Collie: the generalization of a word referring to an object to other objects of the same shape, also known as shape bias. Our first experiment confirmed a solid history of word learning in the dog, thus making it possible for certain object features to have become central in his word comprehension. Using an experimental paradigm originally employed to establish shape bias in children and human adults we taught the dog arbitrary object names (e.g. dax) for novel objects. Two experiments showed that when briefly familiarized with word-object mappings the dog did not generalize object names to object shape but to object size. A fourth experiment showed that when familiarized with a word-object mapping for a longer period of time the dog tended to generalize the word to objects with the same texture. These results show that the dog tested did not display human-like word comprehension, but word generalization and word reference development of a qualitatively different nature compared to humans. We conclude that a shape bias for word generalization in humans is due to the distinct evolutionary history of the human sensory system for object identification and that more research is necessary to confirm qualitative differences in word generalization between humans and dogs. PMID:23185321
Reasonable threshold value used to segment the individual comet from the comet assay image

International Nuclear Information System (INIS)

Yan Xuekun; Chen Ying; Du Jie; Zhang Xueqing; Luo Yisheng

2009-01-01

Reasonable segmentation of the individual comet contour from the Comet Assay (CA) images is the precondition for all of parameters analysis during the automatic analyzing for the CA. The Otsu method and several arithmetic operators for image segmentation, such as Sobel, Prewitt, Roberts and Canny were used to segment the comet contour, and characters of the CA images were analyzed firstly. And then the segmentation methods which had been adopted in the software for CA automatic analysis, such as the CASP, the TriTek CometScore TM , were put for-ward and compared. At last, a two-step procedure for threshold calculation based on image-content analysis is adopted to segment the individual comet from the CA images, and several principles for the segmentation are put forward too.(authors)
A Novel Machine Vision System for the Inspection of Micro-Spray Nozzle

Directory of Open Access Journals (Sweden)

Kuo-Yi Huang

2015-06-01

Full Text Available In this study, we present an application of neural network and image processing techniques for detecting the defects of an internal micro-spray nozzle. The defect regions were segmented by Canny edge detection, a randomized algorithm for detecting circles and a circle inspection (CI algorithm. The gray level co-occurrence matrix (GLCM was further used to evaluate the texture features of the segmented region. These texture features (contrast, entropy, energy, color features (mean and variance of gray level and geometric features (distance variance, mean diameter and diameter ratio were used in the classification procedures. A back-propagation neural network classifier was employed to detect the defects of micro-spray nozzles. The methodology presented herein effectively works for detecting micro-spray nozzle defects to an accuracy of 90.71%.
Why Do Markets Crash? Bitcoin Data Offers Unprecedented Insights.

Science.gov (United States)

Donier, Jonathan; Bouchaud, Jean-Philippe

2015-01-01

Crashes have fascinated and baffled many canny observers of financial markets. In the strict orthodoxy of the efficient market theory, crashes must be due to sudden changes of the fundamental valuation of assets. However, detailed empirical studies suggest that large price jumps cannot be explained by news and are the result of endogenous feedback loops. Although plausible, a clear-cut empirical evidence for such a scenario is still lacking. Here we show how crashes are conditioned by the market liquidity, for which we propose a new measure inspired by recent theories of market impact and based on readily available, public information. Our results open the possibility of a dynamical evaluation of liquidity risk and early warning signs of market instabilities, and could lead to a quantitative description of the mechanisms leading to market crashes.
USO DA DORAMECTINA NO TRATAMENTO DA DEMODICOSE CANINA: RELATO DE CASO

Directory of Open Access Journals (Sweden)

Lívia Silva JACOMINE

2017-12-01

Full Text Available A demodicose ou sarna demodécica é uma dermatoparasitose não contagiosa e ocasionada por uma reação cutânea inflamatória relacionada à multiplicação excessiva do ácaro Demodex canis. As causas da doença não estão totalmente definidas, entretanto, a baixa imunidade é um fator que predispõe a doença. A classificação da demodicose baseia-se na localização corpórea do animal, sendo localizada ou generalizada. O prognóstico é variável. Os sinais clínicos são alopecia, eritema, descamação, hiperpigmentação, liquenificação, febre e linfoadenopatia. O diagnóstico é realizado através de raspado cutâneo, impressão em fita de acetato, tricograma ou biópsia de pele. O tratamento há décadas foi realizado através do uso do amitraz, porém, além da toxicidade, o uso inadequado desse fármaco ocasionou em desenvolvimento de resistência. Atualmente, as lactonas macrocíclicas, tais como ivermectina, doramectina, milbemicina oxima e moxidectina vêm sendo empregadas com sucesso em cães. Entretanto, cães das raças dolicocéfalas, tais como Collie e Pastor Alemão, dentre outras, manifestam reações tóxicas graves com o uso da ivermectina. Assim, o objetivo desse trabalho foi relatar um caso do uso da doramectina na dose de 0,6 mg/kg, via oral a cada 72 horas, durante 60 dias no tratamento da demodicose generalizada em um cão da raça Pastor Alemão. Os resultados obtidos demostraram a melhora clínica do animal e nenhum efeito adverso foi clinicamente observado. Concluindo, não obstante a demodicose ser uma doença clínica desafiadora, o uso da doramectina demostrou vantagens pelo maior intervalo de administração, redução na duração do tratamento e a ausência de reações adversas, comuns as avermectinas quando usadas em animais dolicocéfalos.
Ecologia Comportamental dos cães domésticos em áreas rurais e urbanas do município de Viçosa, MG

OpenAIRE

Martinez, Edilberto Nobrega

2012-01-01

Após a revolução industrial principalmente a partir do século XX, auge do êxodo rural, houve um incremento do processo de urbanização no Brasil. Nos dias atuais o progresso de atividades econômicas tem contribuído para a crescente aquisição de animais de estimação nos lares brasileiros, principalmente cães (Canis lupus familiaris). Para contemplar essa demanda, milhares de novos indivíduos nascem todos os anos sem um controle adequado. Este processo corrobora com o aumento de cães abandonados...
Instant Autodesk AutoCAD 2014 customization with .NET

CERN Document Server

Nelson, Tom

2013-01-01

Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks. An instruction-based guide with examples written in the C# programming language. VB.NET programmers can also take advantage of these examples by using one of the free conversion websites to convert the examples to VB.NET.Clear, step-by-step instructions and complete code examples illustrate the processes, making it easy to develop your own custom AutoCAD tools.This book is perfect if you are interested in customizing AutoCAD 2014 using the .NET API. You should have a basic familiari
Why Do Markets Crash? Bitcoin Data Offers Unprecedented Insights.

Directory of Open Access Journals (Sweden)

Jonathan Donier

Full Text Available Crashes have fascinated and baffled many canny observers of financial markets. In the strict orthodoxy of the efficient market theory, crashes must be due to sudden changes of the fundamental valuation of assets. However, detailed empirical studies suggest that large price jumps cannot be explained by news and are the result of endogenous feedback loops. Although plausible, a clear-cut empirical evidence for such a scenario is still lacking. Here we show how crashes are conditioned by the market liquidity, for which we propose a new measure inspired by recent theories of market impact and based on readily available, public information. Our results open the possibility of a dynamical evaluation of liquidity risk and early warning signs of market instabilities, and could lead to a quantitative description of the mechanisms leading to market crashes.
Modeling of welded bead profile for rapid prototyping by robotic MAG welding

Institute of Scientific and Technical Information of China (English)

CAO Yong; ZHU Sheng; WANG Tao; WANG Wanglong

2009-01-01

As a deposition technology, robotic metal active gas(MAG) welding has shown new promise for rapid prototyping (RP) of metallic parts. During the process of metal forming using robotic MAG welding, sectional profile of single-pass welded bead is critical to formed accuracy and quality of metal pans. In this paper, the experiments of single-pass welded bead for rapid prototyping using robotic MAG welding were carried out. The effect of some edge detectors on the cross-sectional edge of welded bead was discussed and curve fitting was applied using leat square fitting. Consequently, the mathematical model of welded bead profile was developed. The experimental results show that good shape could be obtained under suitable welding parameters. Canny operawr is suitable to edge detection of welded bead profile, and the mathematical model of welded bead profile developed is approximately parabola.

Why Do Markets Crash? Bitcoin Data Offers Unprecedented Insights

Science.gov (United States)

Donier, Jonathan; Bouchaud, Jean-Philippe

2015-01-01

Crashes have fascinated and baffled many canny observers of financial markets. In the strict orthodoxy of the efficient market theory, crashes must be due to sudden changes of the fundamental valuation of assets. However, detailed empirical studies suggest that large price jumps cannot be explained by news and are the result of endogenous feedback loops. Although plausible, a clear-cut empirical evidence for such a scenario is still lacking. Here we show how crashes are conditioned by the market liquidity, for which we propose a new measure inspired by recent theories of market impact and based on readily available, public information. Our results open the possibility of a dynamical evaluation of liquidity risk and early warning signs of market instabilities, and could lead to a quantitative description of the mechanisms leading to market crashes. PMID:26448333
Exodoncias dentarias e interferencias oclusales postratamiento ortodóncico Dental extractions and occlusal interferences postorthodontic treatment

Directory of Open Access Journals (Sweden)

Gladys Otaño Laffitte

2008-12-01

Full Text Available Se realizó un estudio de 20 pacientes egresados del Servicio de Ortodoncia de la Facultad de Estomatología de Ciudad de La Habana, cuyas edades no excedieran los 30 años. El objetivo fue evaluar la influencia de algunas variables morfológicas como la relación canina, contacto en posición de máxima intercuspidación (PMI, sobrepase y resalte. El estudio reveló el predominio de los pacientes con interferencias oclusales, que fueron más frecuentes en el grupo sin exodoncias. La mayor cantidad de pacientes presentaron neutroclusión canina, no obstante, ambos grupos presentaron un gran porcentaje de interferencias oclusales. En el grupo con exodoncias fue donde más se logró el contacto en PMI de los dientes anteriores; en todos los movimientos correspondientes las interferencias fueron más frecuentes en el área de trabajo, hubo predominio de pacientes con sobrepase canino y anterior de 1/3 de corona, pero igualmente predominaron las interferencias oclusales, principalmente en el grupo sin exodoncias.A study of 20 patients under 30 years old discharged from the Orthodontics Service of the Faculty of Stomatology of Havana City was conducted to evaluate the influence of some morphological variables as the canine relation, contact in maximum intercuspidation position (MIP, overbite and overjet. The study revealed the predominance of patients with occlusal interferences that were more frequent in the group with no dental extractions. Most of the patients presented canine neutro-occlusion; however, both groups showed a great percentage of occlusal interferences. In the group with extractions, the contact in MIP of the anterior teeth was mostly attained in the group with extractions. In all the corresponding movements the interferences were more frequent in the working area. It was observed a prevalence of anterior canine overbite of 1/3 of the crown, but the occlusal interferences predominated in the same way, mainly in the group without
Dogs (Canis familiaris, but not chimpanzees (Pan troglodytes, understand imperative pointing.

Directory of Open Access Journals (Sweden)

Katharina C Kirchhofer

Full Text Available Chimpanzees routinely follow the gaze of humans to outside targets. However, in most studies using object choice they fail to use communicative gestures (e.g. pointing to find hidden food. Chimpanzees' failure to do this may be due to several difficulties with this paradigm. They may, for example, misinterpret the gesture as referring to the opaque cup instead of the hidden food. Or perhaps they do not understand informative communicative intentions. In contrast, dogs seem to be skilful in using human communicative cues in the context of finding food, but as of yet there is not much data showing whether they also use pointing in the context of finding non-food objects. Here we directly compare chimpanzees' (N = 20 and dogs' (N = 32 skills in using a communicative gesture directed at a visible object out of reach of the human but within reach of the subject. Pairs of objects were placed in view of and behind the subjects. The task was to retrieve the object the experimenter wanted. To indicate which one she desired, the experimenter pointed imperatively to it and directly rewarded the subject for handing over the correct one. While dogs performed well on this task, chimpanzees failed to identify the referent. Implications for great apes' and dogs' understanding of human communicative intentions are discussed.
Clinical approach to canine vaginitisAbordagem clínica da vaginite canina

Directory of Open Access Journals (Sweden)

Maria Isabel Mello Martins

2012-08-01

Full Text Available Vaginitis is a rare disease in adult female dogs. However, knowledge regarding this illness is important because, if secondary to reproductive tract anomalies that go uncorrected, it can cause ascending uterine infections and, consequently, subfertility or even infertility. Usually, these infections are caused by Enterobacter or microorganisms from the urogenital inferior system, such as Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, etc. In some cases, vaginitis may be caused by primary infections with Brucella canis, which is zoonotic, or by canine herpesvirus; both of these agents have the potential to cause reproductive failure. The disease can occur in any age, breed or ovarian condition and can be identified by vaginal cytology, vaginoscopy and culture of vaginal secretions. The most common clinical signs are erythema of the vaginal mucous, vaginal discharge, pollakiuria, licking of the vulva and attraction of male dogs, independent of the phase of the estrous cycle. This disease is generally self-limiting, and the treatment, when necessary, consists of antibiotic therapy, vaginal cleaning with antiseptic and, eventually, surgical correction of predisposing abnormalities. A vaginite é uma afecção rara em cadelas adultas. É uma causa importante de subfertilidade ou infertilidade, quando secundária à anomalias do trato reprodutivo. Normalmente, são causadas por enterobactérias ou pela microbiota do sistema urogenital inferior, tais como Staphylococcus spp, Streptococcus spp, Escherichia coli, Proteus spp, Pseudomonas aeruginosa, Pasteurella, entre outras. Em alguns casos, pode ser primária como infecções por Brucella canis, a qual é uma zoonose ou herpesvírus canino, importante causa de falhas reprodutivas. A afecção acomete fêmeas de qualquer idade, raça ou condição ovariana. Os sinais clínicos envolvem mucosa vaginal hiperêmica, corrimento vulvar, polaquiúria, lambedura vulvar, e atração de machos independente da fase do ciclo estral. Pode ser diagnosticada por citologia vaginal, vaginoscopia e cultura da secreção. A enfermidade, muitas vezes, é autolimitante e o tratamento, quando necessário, e’ realizado com infusão vaginal de antissépticos ou antibióticos e, eventualmente, correção cirúrgica de anormalidades predisponentes.
Minipig and beagle animal model genomes aid species selection in pharmaceutical discovery and development

Energy Technology Data Exchange (ETDEWEB)

Vamathevan, Jessica J., E-mail: jessica.j.vamathevan@gsk.com [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom); Hall, Matthew D.; Hasan, Samiul; Woollard, Peter M. [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom); Xu, Meng; Yang, Yulan; Li, Xin; Wang, Xiaoli [BGI-Shenzen, Shenzhen (China); Kenny, Steve [Safety Assessment, PTS, GlaxoSmithKline, Ware (United Kingdom); Brown, James R. [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Collegeville, PA (United States); Huxley-Jones, Julie [UK Platform Technology Sciences (PTS) Operations and Planning, PTS, GlaxoSmithKline, Stevenage (United Kingdom); Lyon, Jon; Haselden, John [Safety Assessment, PTS, GlaxoSmithKline, Ware (United Kingdom); Min, Jiumeng [BGI-Shenzen, Shenzhen (China); Sanseau, Philippe [Computational Biology, Quantitative Sciences, GlaxoSmithKline, Stevenage (United Kingdom)

2013-07-15

Improving drug attrition remains a challenge in pharmaceutical discovery and development. A major cause of early attrition is the demonstration of safety signals which can negate any therapeutic index previously established. Safety attrition needs to be put in context of clinical translation (i.e. human relevance) and is negatively impacted by differences between animal models and human. In order to minimize such an impact, an earlier assessment of pharmacological target homology across animal model species will enhance understanding of the context of animal safety signals and aid species selection during later regulatory toxicology studies. Here we sequenced the genomes of the Sus scrofa Göttingen minipig and the Canis familiaris beagle, two widely used animal species in regulatory safety studies. Comparative analyses of these new genomes with other key model organisms, namely mouse, rat, cynomolgus macaque, rhesus macaque, two related breeds (S. scrofa Duroc and C. familiaris boxer) and human reveal considerable variation in gene content. Key genes in toxicology and metabolism studies, such as the UGT2 family, CYP2D6, and SLCO1A2, displayed unique duplication patterns. Comparisons of 317 known human drug targets revealed surprising variation such as species-specific positive selection, duplication and higher occurrences of pseudogenized targets in beagle (41 genes) relative to minipig (19 genes). These data will facilitate the more effective use of animals in biomedical research. - Highlights: • Genomes of the minipig and beagle dog, two species used in pharmaceutical studies. • First systematic comparative genome analysis of human and six experimental animals. • Key drug toxicology genes display unique duplication patterns across species. • Comparison of 317 drug targets show species-specific evolutionary patterns.
Minipig and beagle animal model genomes aid species selection in pharmaceutical discovery and development

International Nuclear Information System (INIS)

Vamathevan, Jessica J.; Hall, Matthew D.; Hasan, Samiul; Woollard, Peter M.; Xu, Meng; Yang, Yulan; Li, Xin; Wang, Xiaoli; Kenny, Steve; Brown, James R.; Huxley-Jones, Julie; Lyon, Jon; Haselden, John; Min, Jiumeng; Sanseau, Philippe

2013-01-01

Improving drug attrition remains a challenge in pharmaceutical discovery and development. A major cause of early attrition is the demonstration of safety signals which can negate any therapeutic index previously established. Safety attrition needs to be put in context of clinical translation (i.e. human relevance) and is negatively impacted by differences between animal models and human. In order to minimize such an impact, an earlier assessment of pharmacological target homology across animal model species will enhance understanding of the context of animal safety signals and aid species selection during later regulatory toxicology studies. Here we sequenced the genomes of the Sus scrofa Göttingen minipig and the Canis familiaris beagle, two widely used animal species in regulatory safety studies. Comparative analyses of these new genomes with other key model organisms, namely mouse, rat, cynomolgus macaque, rhesus macaque, two related breeds (S. scrofa Duroc and C. familiaris boxer) and human reveal considerable variation in gene content. Key genes in toxicology and metabolism studies, such as the UGT2 family, CYP2D6, and SLCO1A2, displayed unique duplication patterns. Comparisons of 317 known human drug targets revealed surprising variation such as species-specific positive selection, duplication and higher occurrences of pseudogenized targets in beagle (41 genes) relative to minipig (19 genes). These data will facilitate the more effective use of animals in biomedical research. - Highlights: • Genomes of the minipig and beagle dog, two species used in pharmaceutical studies. • First systematic comparative genome analysis of human and six experimental animals. • Key drug toxicology genes display unique duplication patterns across species. • Comparison of 317 drug targets show species-specific evolutionary patterns
SU-E-J-142: Performance Study of Automatic Image-Segmentation Algorithms in Motion Tracking Via MR-IGRT

International Nuclear Information System (INIS)

Feng, Y; Olsen, J.; Parikh, P.; Noel, C; Wooten, H; Du, D; Mutic, S; Hu, Y; Kawrakow, I; Dempsey, J

2014-01-01

Purpose: Evaluate commonly used segmentation algorithms on a commercially available real-time MR image guided radiotherapy (MR-IGRT) system (ViewRay), compare the strengths and weaknesses of each method, with the purpose of improving motion tracking for more accurate radiotherapy. Methods: MR motion images of bladder, kidney, duodenum, and liver tumor were acquired for three patients using a commercial on-board MR imaging system and an imaging protocol used during MR-IGRT. A series of 40 frames were selected for each case to cover at least 3 respiratory cycles. Thresholding, Canny edge detection, fuzzy k-means (FKM), k-harmonic means (KHM), and reaction-diffusion level set evolution (RD-LSE), along with the ViewRay treatment planning and delivery system (TPDS) were included in the comparisons. To evaluate the segmentation results, an expert manual contouring of the organs or tumor from a physician was used as a ground-truth. Metrics value of sensitivity, specificity, Jaccard similarity, and Dice coefficient were computed for comparison. Results: In the segmentation of single image frame, all methods successfully segmented the bladder and kidney, but only FKM, KHM and TPDS were able to segment the liver tumor and the duodenum. For segmenting motion image series, the TPDS method had the highest sensitivity, Jarccard, and Dice coefficients in segmenting bladder and kidney, while FKM and KHM had a slightly higher specificity. A similar pattern was observed when segmenting the liver tumor and the duodenum. The Canny method is not suitable for consistently segmenting motion frames in an automated process, while thresholding and RD-LSE cannot consistently segment a liver tumor and the duodenum. Conclusion: The study compared six different segmentation methods and showed the effectiveness of the ViewRay TPDS algorithm in segmenting motion images during MR-IGRT. Future studies include a selection of conformal segmentation methods based on image/organ-specific information
SU-E-J-142: Performance Study of Automatic Image-Segmentation Algorithms in Motion Tracking Via MR-IGRT

Energy Technology Data Exchange (ETDEWEB)

Feng, Y; Olsen, J.; Parikh, P.; Noel, C; Wooten, H; Du, D; Mutic, S; Hu, Y [Washington University, St. Louis, MO (United States); Kawrakow, I; Dempsey, J [Washington University, St. Louis, MO (United States); ViewRay Co., Oakwood Village, OH (United States)

2014-06-01

Purpose: Evaluate commonly used segmentation algorithms on a commercially available real-time MR image guided radiotherapy (MR-IGRT) system (ViewRay), compare the strengths and weaknesses of each method, with the purpose of improving motion tracking for more accurate radiotherapy. Methods: MR motion images of bladder, kidney, duodenum, and liver tumor were acquired for three patients using a commercial on-board MR imaging system and an imaging protocol used during MR-IGRT. A series of 40 frames were selected for each case to cover at least 3 respiratory cycles. Thresholding, Canny edge detection, fuzzy k-means (FKM), k-harmonic means (KHM), and reaction-diffusion level set evolution (RD-LSE), along with the ViewRay treatment planning and delivery system (TPDS) were included in the comparisons. To evaluate the segmentation results, an expert manual contouring of the organs or tumor from a physician was used as a ground-truth. Metrics value of sensitivity, specificity, Jaccard similarity, and Dice coefficient were computed for comparison. Results: In the segmentation of single image frame, all methods successfully segmented the bladder and kidney, but only FKM, KHM and TPDS were able to segment the liver tumor and the duodenum. For segmenting motion image series, the TPDS method had the highest sensitivity, Jarccard, and Dice coefficients in segmenting bladder and kidney, while FKM and KHM had a slightly higher specificity. A similar pattern was observed when segmenting the liver tumor and the duodenum. The Canny method is not suitable for consistently segmenting motion frames in an automated process, while thresholding and RD-LSE cannot consistently segment a liver tumor and the duodenum. Conclusion: The study compared six different segmentation methods and showed the effectiveness of the ViewRay TPDS algorithm in segmenting motion images during MR-IGRT. Future studies include a selection of conformal segmentation methods based on image/organ-specific information
Characterization of rabies virus from a human case in Nepal.

Science.gov (United States)

Pant, G R; Horton, D L; Dahal, M; Rai, J N; Ide, S; Leech, S; Marston, D A; McElhinney, L M; Fooks, A R

2011-04-01

Rabies is endemic throughout most of Asia, with the majority of human cases transmitted by domestic dogs (Canis familiaris). Here, we report a case of rabies in a 12-year-old girl in the Lalitpur district of Nepal that might have been prevented by better public awareness and timely post-exposure prophylaxis. Molecular characterization of the virus showed 100% identity over a partial nucleoprotein gene sequence to previous isolates from Nepal belonging to the 'arctic-like' lineage of rabies virus. Sequence analysis of both partial nucleoprotein and glycoprotein genes showed differences in consensus sequence after passage in vitro but not after passage in vivo.
First occurrence of an autochthonous canine case of Leishmania (Leishmania infantum chagasi in the municipality of Campinas, State of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Elisa San Martin Mouriz Savani

2011-08-01

Full Text Available An autochthonous case of visceral leishmaniasis is reported in a dog (Canis familiaris as an apparently natural infection in a non-endemic area. DNA obtained from spleen and liver samples produced the expected fragment in a Leishmania-specific rDNA-based nested-PCR assay. The PCR product, a 490 bp fragment, was sequenced and the nucleotide sequence was identical to that of Leishmania (Leishmania infantum chagasi. These results are surprising since no autochthonous human or canine cases of visceral leishmaniasis have ever been reported in this municipality. This case suggests that natural transmission of this disease is occurring in this area.
Antropologia visuale dei senza casa di Place de la Réunion

Directory of Open Access Journals (Sweden)

Sylvaine Conord

2008-07-01

Full Text Available Questo quartiere negli anni 90 veniva considerato una zona prevalentemente popolare. Oggi resta l’esempio emblematico di una Parigi popolare in mutamento. Questa ricerca è sempre attuale grazie al soggetto: i senza casa. La questione dei senza casa nella regione parigina non è risolta: migliaia di nuclei familiari attendono l'assegnazione di un alloggio abitabile. Numerose famiglie vivono in palazzi occupati, nonostante abbiano presentato presso i servizi pubblici la loro domanda da molti anni. Quindi, oltre ad un osservazione partecipante, questo lavoro pone l’accento "su una sociologia militante" che prende corpo attraverso le testimonianze e la partecipazione attiva dell'osservatrice alle diverse situazioni che vive e vede.
An Interactive Procedure to Preserve the Desired Edges during the Image Processing of Noise Reduction

Directory of Open Access Journals (Sweden)

Lin-Tsang Lee

2010-01-01

Full Text Available The paper propose a new procedure including four stages in order to preserve the desired edges during the image processing of noise reduction. A denoised image can be obtained from a noisy image at the first stage of the procedure. At the second stage, an edge map can be obtained by the Canny edge detector to find the edges of the object contours. Manual modification of an edge map at the third stage is optional to capture all the desired edges of the object contours. At the final stage, a new method called Edge Preserved Inhomogeneous Diffusion Equation (EPIDE is used to smooth the noisy images or the previously denoised image at the first stage for achieving the edge preservation. The Optical Character Recognition (OCR results in the experiments show that the proposed procedure has the best recognition result because of the capability of edge preservation.
PARASITISMO POR ANCILOSTOMATÍDEOS EM CÃES (Canis familiaris DOMICILIADOS EM CAMPOS DOS GOYTACAZES, RJ. PARASITISM BY ANCYLOSTOMIDES IN DOGS (Canis familiaris DOMICILIATED IN CAMPOS DOS GOYTACAZES, RJ.

Directory of Open Access Journals (Sweden)

Francimar Fernandes Gomes

2008-12-01

Full Text Available Os ancilostomatídeos são nematóides hematófagos parasitas do intestino delgado, podendo causar retardo no crescimento, inapetência, anorexia, apatia, anemia e até a morte. No homem, algumas espécies como Ancylostoma caninum, A. braziliense e A. tubaeforme podem causar larva migrans cutânea, quando as larvas infectantes de terceiro estágio penetram ativamente a pele íntegra. O objetivo deste trabalho foi detectar o parasitismo por ancilostomatídeos em fezes de cães domiciliados e assintomáticos na cidade de Campos dos Goytacazes, RJ, tendo em vista a proximidade do convívio destes animais com homem. Com esse propósito, amostras fecais de 68 cães foram coletadas, sendo trinta (44,12% considerados parasitados através de exame coproparasitológico utilizando-se o método de Willis-Molley.

PALAVRAS-CHAVES: Ancylostoma sp., fezes, método Willis-Mollay. The ancylostomides are hematophagous nematodes parasites of the small intestine, being able to cause retardation in the growth, anorexy, apathy, anemia and death. In the man, some species as Ancylostoma caninum, A. braziliense and A. tubaeforme can cause cutaneous larva migrans, when the larvae infects of third period of stage penetrate actively the skin. The objective of this work was to detect the parasitism for ancylostomides in excrements of domiciliated and asymptomatic dogs in Campos dos Goytacazes, RJ, in view of the proximity of the conviviality of these animals with the man. With this intention, faecal samples of 68 dogs had been collected, being 30 (44.12% considered parasitized through stool parasitology using the method of Willis-Molley.

KEY WORDS: Ancylostoma sp. feces, Willis-Mollay Method.
O problema do ethos da escrita de si em Montaigne e em Petrarca: do ensaio à epístola

Directory of Open Access Journals (Sweden)

Sergio Xavier Gomes de Araujo

2012-12-01

Full Text Available Montaigne insiste ao longo dos Ensaios em seu desprezo pela retórica. Mas como procuraremos mostrar aqui, sua "forma natural" inscreve-se em grande medida dentro dos termos da própria retórica, sob uma mobilização particular dos preceitos e convenções tradicionalmente apropriados à escrita em primeira pessoa, especialmente aqueles que regulavam o sermo familiaris, gênero recuperado pela primeira vez na Renascença por Petrarca. Retomamos assim, para desenvolvê-la, a fecunda intuição de Hugo Friedrich que, em sua clássica obra sobre os Ensaios de Montaigne, aponta o seu parentesco com a forma epistolar de Petrarca, sem, porém, acompanhá-lo quando distancia o ensaio da epístola familiar, por entendê-lo como marco de ruptura com os procedimentos da retórica e, assim, com toda a prosa artisticamente trabalhada do humanismo.Montaigne insists throughout the course of the Essays on his disdain for rhetoric. But as we try to expose here, his "natural form" includes itself to a large extent in the terms of rhetoric itself, under a particular usage of the precepts and conventions traditionally appropriate to the discourse in first person, especially those which regulated the sermo familiaris, genre recuperated for the first time in the Renaissance by Petrarch. We retake, in order to develop it, the fruitful intuition of Hugo Friedrich in his classical work about Montaigne's Essays, indicating its kinship with Petrarch's epistolary form, without, however, following him when he moves the essay away from the familiar epistle by interpreting the essay as a rupture with the rhetorical procedures and therefore with all the artistically worked prose of humanism.
Retrospective study of canine cases of leishmaniasis attended in São Paulo, Brazil (1997-2007Estudo retrospectivo de casos caninos de leishmaniose atendidos na cidade de São Paulo, Brasil (1997-2007

Directory of Open Access Journals (Sweden)

Márcia Cristina Sonoda

2013-05-01

ênero Leishmania. Em face da magnitude de alastramentro da doença no Brasil, foi realizado um levantamento retrospectivo de casos de leishmaniose canina diagnosticados nos Serviços de Dermatologia e de Clínica Médica de cães e gatos do HOVET/USP. A amostragem compôs-se de 36 casos caninos naturalmente infectados por Leishmania sp, cujo diagnóstico fora estabelecido pela caracterização por pelos dados anamnésticos, de exames físico e dermatológico, complementados por exames hematológicos, bioquímicos e imagéticos, afora sorologia (Ensaio Imunoenzimático Indireto – ELISA e/ou Reação de Imunofluorescência Indireta – RIFI, histopatologia de pele e/ou pela evidenciação do protozoário em exames parasitológicos de biópsia aspirativa de linfonodos e/ou medula óssea e pela técnica de imuno-histoquímica. Não houve predisposição por um determinado sexo; a faixa etária (52,8% mais prevalente foi aquela dos 13 a 48 meses de vida, com maior acometimento de cães de raça definida (66,7%, principalmente Poodles e Labradores (20,8% cada. Pôde-se concluir que todos os casos foram alóctones. Quanto aos municípios de origem os animais provieram de: Campinas, Campo Limpo Paulista, Holambra, Ilha Bela, São Roque, Sorocaba, Ubatuba e Uberaba (um caso / município. Os demais 28 cães do Estado de São Paulo originaram-se de municípios com transmissão: canina e humana (Araçatuba – três, Bauru – um, canina (Cotia – cinco, Embu – quatro ou sob investigação (São Paulo – 11, Mogi das Cruzes – um. Já Portugal (um e Minas Gerais (Belo Horizonte – dois são locais caracterizados como de transmissão canina e humana. Puderam-se evidenciar deslocamentos breves ou longos a 14 municípios paulistas (Araçatuba, Birigui, Caraguatatuba, Cotia, Eldorado, Embu e Embu Guaçu, Guarujá, Ilha Bela, Itapecerica da Serra, Peruíbe, Presidente Prudente, São Roque e São Paulo e a cinco Estados (Maranhão, Minas Gerais, Paraná, Rio de Janeiro e Santa Catarina. De
Factors associated with Leishmania chagasi infection in domestic dogs from Teresina, State of Piauí, Brazil Fatores associados à infecção por Leishmania chagasi em cães domiciliados de Teresina, Estado do Piauí, Brasil

Directory of Open Access Journals (Sweden)

João Pereira da Silva

2012-08-01

Full Text Available INTRODUCTION: Many studies have evaluated risk factors for human visceral leishmaniasis, but few have focused on the infection among dogs. The objective of this study was to assess the association between peridomestic socioeconomic and environmental factors and the presence of dogs seropositive for Leishmania chagasi in the City of Teresina, Brazil. METHODS: This case-control study was based on the results of a routine seroepidemiological survey among domestic dogs carried out in 2007. Serological tests were performed by means of indirect immunofluorescence antibody test. All dwellings in which at least one seropositive dog was detected were considered cases, and controls were a random sample of dwellings in which only seronegative dogs were identified. Associations between variables were expressed as odds ratios (OR and their respective 95% confidence intervals (95%CI estimated using multivariate logistic regression. RESULTS: Dwellings with a history of dogs removed by the visceral leishmaniasis control program in the last 12 months had five-fold higher odds of having at least one seropositive dog as compared with dwellings having no history of dog removal (OR = 5.19; 95%CI = 3.20-8.42. Dwellings with cats had 58% increased odds of dog infection as compared with those having no cats (OR = 1.58; 95%CI = 1.01-2.47. CONCLUSIONS: Identification of factors associated with canine visceral leishmaniasis might be used for the delimitation of areas of higher risk for human visceral leishmaniasis, since infection in dogs generally precedes the appearance of human cases.INTRODUÇÃO: Diversos estudos avaliaram fatores de risco para leishmaniose visceral humana, mas poucos focalizaram a infecção canina. O objetivo deste estudo é avaliar a associação entre condições sócio-ambientais peridomiciliares e a presença de cães sorologicamente positivos para Leishmania chagasi em Teresina, Brasil. MÉTODOS: Estudo caso-controle baseado nos resultados de
Il loricato acefalo di Rusellae (Roselle, GR: una proposta di identificazione

Directory of Open Access Journals (Sweden)

Eleonora Romanò

2013-07-01

Full Text Available Lo studio è incentrato sul tentativo di comprendere la scena presente sulla lorica di una statua acefala di probabile fine età claudia rinvenuta nell'area archeologica di Rusellae (Roselle, GR all'interno di un edificio connesso al culto imperiale. La decorazione analizzata è composta da diversi elementi: un trofeo di armi ed un'aquila in posizione pressocchè centrale, ai loro lati si dispongono figure umane interpretabili come barbari e per le quali si propone l'identificazione con il britanno Caratacus accompagnato dai suoi familiari mentre rivolge una supplica di liberazione al Senato ed all'imperatore Claudio, secondo l'episodio riportato negli Annales di Tacito (12.33-40.
Reemergence of rabies in the southern Han river region, Korea.

Science.gov (United States)

Oem, Jae-Ku; Kim, Seong-Hee; Kim, Yeon-Hee; Lee, Myoung-Heon; Lee, Kyoung-Ki

2014-07-01

Recently, 11 cases of animal rabies were reported in the southern region (Suwon and Hwaseong cities) of Gyeonggi Province, South Korea. The cases were temporally separated into two cases in dogs (Canis lupus familiaris) in spring 2012 and nine cases in domestic animals and wildlife in winter 2012-13. All carcasses were submitted for histopathologic examination and viral antigen identification. Sequences of the glycoprotein, nucleoprotein, and glycoprotein-large polymerase protein intergenic noncoding loci of the 11 strains were determined and compared with published reference sequences. All rabies strains were closely related to the Gangwon strains isolated in 2008-09, suggesting that the rabies virus strains isolated in Gyeonggi were introduced from Gangwon Province.
An enhanced narrow-band imaging method for the microvessel detection

Science.gov (United States)

Yu, Feng; Song, Enmin; Liu, Hong; Wan, Youming; Zhu, Jun; Hung, Chih-Cheng

2018-02-01

A medical endoscope system combined with the narrow-band imaging (NBI), has been shown to be a superior diagnostic tool for early cancer detection. The NBI can reveal the morphologic changes of microvessels in the superficial cancer. In order to improve the conspicuousness of microvessel texture, we propose an enhanced NBI method to improve the conspicuousness of endoscopic images. To obtain the more conspicuous narrow-band images, we use the edge operator to extract the edge information of the narrow-band blue and green images, and give a weight to the extracted edges. Then, the weighted edges are fused with the narrow-band blue and green images. Finally, the displayed endoscopic images are reconstructed with the enhanced narrow-band images. In addition, we evaluate the performance of enhanced narrow-band images with different edge operators. Experimental results indicate that the Sobel and Canny operators achieve the best performance of all. Compared with traditional NBI method of Olympus company, our proposed method has more conspicuous texture of microvessel.
Nondestructive Detection of the Internalquality of Apple Using X-Ray and Machine Vision

Science.gov (United States)

Yang, Fuzeng; Yang, Liangliang; Yang, Qing; Kang, Likui

The internal quality of apple is impossible to be detected by eyes in the procedure of sorting, which could reduce the apple’s quality reaching market. This paper illustrates an instrument using X-ray and machine vision. The following steps were introduced to process the X-ray image in order to determine the mould core apple. Firstly, lifting wavelet transform was used to get a low frequency image and three high frequency images. Secondly, we enhanced the low frequency image through image’s histogram equalization. Then, the edge of each apple's image was detected using canny operator. Finally, a threshold was set to clarify mould core and normal apple according to the different length of the apple core’s diameter. The experimental results show that this method could on-line detect the mould core apple with less time consuming, less than 0.03 seconds per apple, and the accuracy could reach 92%.

Some links on this page may take you to non-federal websites. Their policies may differ from this site.