WorldWideScience

Sample records for californium 253

  1. Magnetism in californium

    International Nuclear Information System (INIS)

    Moore, J.R.

    1988-03-01

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  2. Medical applications of californium-252

    International Nuclear Information System (INIS)

    Oliver, G.D. Jr.

    1975-01-01

    Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)

  3. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  4. Radiography using californium-252 neutron sources

    International Nuclear Information System (INIS)

    Ray, J.W.

    1975-01-01

    The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)

  5. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    Stoddard, D.H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  6. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    King, L.J.

    1987-01-01

    The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  7. Fabrication of californium-252 sources in the United Kingdom

    International Nuclear Information System (INIS)

    Ainsworth, A.; Brady, M.W.; Thornett, W.H.

    1975-01-01

    The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)

  8. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1997-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  9. Biomedical neutron research at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1998-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)

  10. Californium Multiplier. Part I. Design for neutron radiography

    International Nuclear Information System (INIS)

    Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.

    1982-01-01

    The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX

  11. Californium-252 radiotherapy sources for interstitial afterloading

    International Nuclear Information System (INIS)

    Permar, P.H.; Walker, V.W.

    1976-01-01

    Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute

  12. Uranium standards for Californium Shuffler

    International Nuclear Information System (INIS)

    Gibbs, A.; Boynton, S.P.

    1978-10-01

    The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis

  13. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-01-01

    A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein

  14. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  15. Local Structure in Americium and Californium Hexa-cyanoferrates - Comparison with Their Lanthanide Analogues

    International Nuclear Information System (INIS)

    Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.

    2011-01-01

    Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)

  16. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Martin, R.C.; Laxson, R.R.; Knauer, J.B.

    1996-01-01

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  17. Californium loan programme

    International Nuclear Information System (INIS)

    1974-01-01

    The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September

  18. Production, Distribution, and Applications of Californium-252 Neutron Sources

    International Nuclear Information System (INIS)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-01-01

    The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations

  19. Isomeric states in 253No and 253Fm

    International Nuclear Information System (INIS)

    Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Khuyagbaatar, J.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Leino, M.; Nishio, K.; Streicher, B.

    2011-01-01

    Nuclear structure and decay of isomeric states in 253 No were investigated. The isotope was produced by the reaction 48 Ca + 207 Pb. The excitation energy of the known single-particle isomeric state (5/2 + [622]) was measured by delayed coincidences between γ-rays and implanted evaporation residues and was placed into the level scheme. In addition, decay of a high-lying multi-quasiparticle isomer in 253 No was studied using e - -γ coincidence measurements. A rotational band populated by its de-excitation was identified in 253 No. A new isomeric state in 253 Fm was observed and a partial-level scheme for this isotope is suggested. In addition γ transitions from excited levels are reported for 253 Md. (orig.)

  20. Californium source transfer

    International Nuclear Information System (INIS)

    Wallace, C.R.

    1995-01-01

    In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather

  1. Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

    International Nuclear Information System (INIS)

    Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.

    1983-01-01

    Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

  2. Californium-252

    International Nuclear Information System (INIS)

    1975-01-01

    This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)

  3. X-ray-diffraction study of californium metal to 16 GPa

    International Nuclear Information System (INIS)

    Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.

    1983-01-01

    The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa

  4. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    Davila R, I.

    1991-06-01

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  5. Convenient method of simultaneously analyzing aluminum and magnesium in pharmaceutical dosage forms using californium-252 thermal neutron activation

    International Nuclear Information System (INIS)

    Landolt, R.R.; Hem, S.L.

    1983-01-01

    A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well

  6. Identification of 253Md

    International Nuclear Information System (INIS)

    Kadkhodayan, B.; Czerwinski, K.R.; Kreek, S.A.; Hannink, N.J.; Gregorich, K.E.; Lee, D.M.; Nurmia, M.J.; Hoffman, D.C.; Hall, H.L.

    1992-01-01

    We have measured the half-life and production cross section of the new isotope 253 Md, produced via the 243 Am( 13 C,3n) reaction. Isolation of Md from other activities was accomplished using elution with ammonium α-hydroxyisobutyrate from a cation exchange resin column. Experiments were performed with different irradiation time intervals, but the chemical separation always began and ended at exactly the same length of time after the end of irradiation. All separations with the same irradation lengths were combined and analyzed for growth and decay of the 3.0-d 253 Fm daughter and 20.47-d 253 Es, granddaugther of 253 Md. The amount of 253 Es in each fraction depends on the length of each irradiation and the 253 Md half-life. An increase in the length of irradiation will cause a corresponding increase in the amount of the new isotope 253 Md and hence, in the amount of 253 Es produced, provided the length of irradiations are not very long compared to the half-life of 253 Md. In this way, the Md half-life was estimated to be about 6 minutes with a production cross section of the order of 50 nb. (orig.)

  7. Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis

    International Nuclear Information System (INIS)

    Zimmer, W.H.

    1976-08-01

    The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized

  8. Californium oxygen system for 1.50 < O/Cf < 1.72

    International Nuclear Information System (INIS)

    Turcotte, R.P.; Haire, R.G.

    1975-01-01

    The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)

  9. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...

  10. 6 CFR 25.3 - Delegation.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Delegation. 25.3 Section 25.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.3 Delegation. All of the Secretary's responsibilities, powers, and functions...

  11. Assessment of the neutron component in a neutron-gamma field of a californium-252 source

    International Nuclear Information System (INIS)

    Tetteh, G.K.

    1978-12-01

    Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%

  12. 48 CFR 253.209 - Contractor qualifications.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contractor qualifications. 253.209 Section 253.209 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.209 Contractor qualifications. ...

  13. 28 CFR 25.3 - System information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI a...

  14. Alpha-gamma decay studies of 253No and its daughter products 253Md, 249Fm

    International Nuclear Information System (INIS)

    Hessberger, F.P.; Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Streicher, B.; Leino, M.; Nishio, K.

    2012-01-01

    Nuclear structure and decay of the isotope 253 No and its decay products 249 Fm and 253 Md were investigated by means of α - γ spectroscopy. Besides the established strong γ transitions from the 9/2 - [734] Nilsson level in 249 Fm, populated predominantly by the α decay of 253 No, into the ground-state (gs) rotational band, a couple of weaker γ lines (58.3, 129.2, 209.3 and 669.5keV) were observed and placed into the 249 Fm level scheme. The transition from the 7/2 - level in 249 Es, populated by the α decay of 253 Md, into the 9/2 + member of the gs rotational band, so far established for other odd-mass Es isotopes, was observed clearly. GEANT4 simulations were performed to investigate the influence of energy summing between α particles and conversion electrons (CE) on the shape of the α spectra at different implantation energies, leading to evidence for a weak α decay branch of 253 No into the gs of 249 Fm or the ground-state rotational band, respectively. (orig.)

  15. 36 CFR 25.3 - Supervision; suspensions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Supervision; suspensions. 25.3 Section 25.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL MILITARY PARKS; LICENSED GUIDE SERVICE REGULATIONS § 25.3 Supervision; suspensions. (a) The guide service will operate under the direction...

  16. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.

    1977-01-01

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  17. Instrumental neutron activation determination of gold in mineral raw materials using a californium neutron source

    International Nuclear Information System (INIS)

    Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.

    1983-01-01

    A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)

  18. Neutron reflector design with Californium 252 neutron for Boron neutron chapter therapy facility using MCNP5 simulation method

    International Nuclear Information System (INIS)

    Muhammad Fakhrurreza; Kusminanto; Y Sardjono

    2014-01-01

    In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)

  19. Calibration of a Modified Californium Shuffler

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.

    1995-01-01

    A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers

  20. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation...

  1. 50 CFR 253.18 - Program operating guidelines.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Program operating guidelines. 253.18 Section 253.18 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Guarantee Program § 253.18 Program operating guidelines. The Division may issue Program operating guidelines...

  2. 50 CFR 253.16 - Fees.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Fees. 253.16 Section 253.16 Wildlife and... Fees. (a) Application fee. The Division will not accept an application without the application fee. Fifty percent of the application fee is fully earned at application acceptance, and is not refundable...

  3. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.

    1976-01-01

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  4. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  5. Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.

    1990-01-01

    The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined

  6. Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.

    1990-01-01

    Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined

  7. A californium-252 source for radiobiological studies at Hiroshima University

    International Nuclear Information System (INIS)

    Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo

    1987-01-01

    A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)

  8. Dicty_cDB: VHP253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

  9. Californium production at the transuranium processing plant

    International Nuclear Information System (INIS)

    King, L.J.

    1976-01-01

    The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material

  10. Comparison of the Savannah River Site billet active well coincidence counter and two Californium Shufflers

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.

    1991-01-01

    A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab

  11. 7 CFR 253.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 253.1 Section 253.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.1 General purpose and scope. This part describes the terms...

  12. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose to...

  13. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)

    1996-03-01

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.

  14. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  15. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  16. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  17. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  18. 4 CFR 25.3 - Admission to the GAO building.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Admission to the GAO building. 25.3 Section 25.3 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.3 Admission to the GAO building. A person may be admitted to the GAO Building...

  19. 14 CFR 23.253 - High speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...

  20. Experimental studies on californium bioavailability to marine benthic invertebrates

    International Nuclear Information System (INIS)

    Fowler, S.W.; Carvalho, F.P.; Aston, S.R.

    1986-01-01

    252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)

  1. Gamma spectroscopy of the isotope 253No

    International Nuclear Information System (INIS)

    Kalaninova, Z.

    2009-01-01

    The first part deals with the evaluation of the relative and absolute efficiency of detectors for the registration of gamma radiation to separator SHIP at GSI Darmstadt (Germany). In the second part we discussed the decay alpha-gamma coincidence spectroscopy of isotope 253 No. In conclusion, the basic characteristics of deexcitation of K-isomeric state in isotope 253 No are evaluated. Only sort abstract is published.

  2. In-beam spectroscopy of 253,254No

    International Nuclear Information System (INIS)

    Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.

    2002-01-01

    In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)

  3. 50 CFR 253.14 - Economic and financial requirements.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Economic and financial requirements. 253... Obligation Guarantee Program § 253.14 Economic and financial requirements. (a) Income and expense projections... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital...

  4. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    International Nuclear Information System (INIS)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong

    2011-01-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  5. Teratogenic effect of Californium-252 irradiation in rats

    International Nuclear Information System (INIS)

    Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro

    1989-01-01

    The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)

  6. 30 CFR 253.1 - What is the purpose of this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the purpose of this part? 253.1 Section 253.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES General § 253.1 What is the purpose of this part? This part...

  7. Late effects of inhaled 253Es(NO3)3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.

    1979-01-01

    Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)

  8. Transport calculations of. gamma. -ray flux density and dose rate about implantable californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G

    1976-07-01

    ..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.

  9. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  10. 29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Oxygen-fuel gas welding and cutting. 1910.253 Section 1910..., DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.253 Oxygen-fuel gas welding and cutting. (a) General requirements—(1) Flammable mixture. Mixtures of fuel gases...

  11. 50 CFR 216.253 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.253... shall: (a) Take any marine mammal not specified in § 216.250(b); (b) Take any marine mammal specified in...

  12. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.

    1997-12-01

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  13. 49 CFR 234.253 - Flashing light units and lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...

  14. Application of californium-252 neutron sources for analytical chemistry

    International Nuclear Information System (INIS)

    Ishii, Daido

    1976-01-01

    The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)

  15. Spectral investigation of neutron radiation in three-sectional concrete labyrinth from a californium-252 source

    International Nuclear Information System (INIS)

    Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.

    1985-01-01

    Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated

  16. Use of polyethylene pellets in the design and construction of a storage safe, a transport vessel and a portable shield for californium-252

    International Nuclear Information System (INIS)

    Sharma, S.

    1986-01-01

    A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields

  17. 46 CFR 169.253 - Miscellaneous systems and equipment.

    Science.gov (United States)

    2010-10-01

    ... VESSELS Inspection and Certification Inspections § 169.253 Miscellaneous systems and equipment. (a) At each inspection for certification and periodic inspection all items in the ship's outfit, such as...

  18. 14 CFR 25.253 - High-speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High-speed characteristics. 25.253 Section...-speed characteristics. (a) Speed increase and recovery characteristics. The following speed increase and recovery characteristics must be met: (1) Operating conditions and characteristics likely to cause...

  19. Late effects of inhaled 253Es(NO3)3 in the rat

    International Nuclear Information System (INIS)

    Ballou, J.E.; Smith, L.G.; Dagle, G.E.; Gies, R.A.

    1979-01-01

    The lungs of rats exposed to 253 Es(NO 3 ) 3 aerosols sustained the greatest cumulative radiation dose, approximately 6-fold higher than the skeletal dose. Malignant lung tumors (incidence 8.5, 27.6%) were observed after a mean cumulative lung dose of 26 and 400 rad, respectively. Higher lung doses were associated with severe life shortening that precluded the expression of delayed effects. Osteosarcomas of the skeleton (incidence 6.9%) were found after a mean cumulative skeletal dose of 68 rad. Earlier studies, which showed a high incidence of bone tumors and relatively fewer lung tumors after intratracheal instillation of 253 EsCl 3 , were not confirmed in this study with inhaled 253 Es(NO 3 ) 3

  20. Long-term effects of intratracheally instilled 253EsCl3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Morrow, W.

    1975-01-01

    ts administered 253 EsCl 3 by intratracheal instillation developed more bone tumors and fewer lung tumors than similar rats administered 239 Pu(NO 3 ) 4 . In explanation, it is suggested that 253 Es may irradiatete bone surface cells more effectively while 239 Pu may irradiate a greater total number of cells in the lung. (U.S.)

  1. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. [71 FR 39005...

  2. APTO-253 Stabilizes G-quadruplex DNA, Inhibits MYC Expression, and Induces DNA Damage in Acute Myeloid Leukemia Cells.

    Science.gov (United States)

    Local, Andrea; Zhang, Hongying; Benbatoul, Khalid D; Folger, Peter; Sheng, Xia; Tsai, Cheng-Yu; Howell, Stephen B; Rice, William G

    2018-06-01

    APTO-253 is a phase I clinical stage small molecule that selectively induces CDKN1A (p21), promotes G 0 -G 1 cell-cycle arrest, and triggers apoptosis in acute myeloid leukemia (AML) cells without producing myelosuppression in various animal species and humans. Differential gene expression analysis identified a pharmacodynamic effect on MYC expression, as well as induction of DNA repair and stress response pathways. APTO-253 was found to elicit a concentration- and time-dependent reduction in MYC mRNA expression and protein levels. Gene ontogeny and structural informatic analyses suggested a mechanism involving G-quadruplex (G4) stabilization. Intracellular pharmacokinetic studies in AML cells revealed that APTO-253 is converted intracellularly from a monomer to a ferrous complex [Fe(253) 3 ]. FRET assays demonstrated that both monomeric APTO-253 and Fe(253) 3 stabilize G4 structures from telomeres, MYC, and KIT promoters but do not bind to non-G4 double-stranded DNA. Although APTO-253 exerts a host of mechanistic sequelae, the effect of APTO-253 on MYC expression and its downstream target genes, on cell-cycle arrest, DNA damage, and stress responses can be explained by the action of Fe(253) 3 and APTO-253 on G-quadruplex DNA motifs. Mol Cancer Ther; 17(6); 1177-86. ©2018 AACR . ©2018 American Association for Cancer Research.

  3. 30 CFR 253.40 - What OSFR evidence must I submit to MMS?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What OSFR evidence must I submit to MMS? 253.40... § 253.40 What OSFR evidence must I submit to MMS? (a) You must submit to MMS: (1) A single demonstration... unaltered Form MMS-1016; (3) MMS forms that identify your COFs (Form MMS-1021, Form MMS-1022), and the...

  4. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. [71 FR 69495, Dec. 1, 2006] ...

  5. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  6. Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252

    International Nuclear Information System (INIS)

    Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.

    1975-01-01

    Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr

  7. Use of californium-252 neutron irradiator for in-vivo analysis of the bone calcium content of the hand

    International Nuclear Information System (INIS)

    Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.

    1979-01-01

    With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women

  8. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  9. 37 CFR 253.10 - Cost of living adjustment.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Cost of living adjustment... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.10 Cost of living adjustment. (a) (a) On December 1, 2003, the Librarian of Congress shall publish in the Federal Register a notice of the change in the cost of living as...

  10. 24 CFR 236.253 - Premiums-operating loss loans.

    Science.gov (United States)

    2010-04-01

    ... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...

  11. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra

  12. 14 CFR 253.8 - Qualifications to notice requirements.

    Science.gov (United States)

    2010-01-01

    ... to notice requirements. (a) If notice is not provided in accordance with § 253.5 at a ticket sales location outside of the United States that is not a U.S. air carrier ticket office, the price paid for the portion of such ticket that is for interstate and overseas air transportation shall be refundable without...

  13. 48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155. [71 FR 3413, Jan. 23, 2006] ...

  14. Spectral Energy Distribution and Radio Halo of NGC 253 at Low Radio Frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Kapińska, A. D.; Staveley-Smith, L.; Meurer, G. R.; For, B.-Q. [International Centre for Radio Astronomy Research (ICRAR), University of Western Australia, 35 Stirling Hwy, WA 6009 (Australia); Crocker, R. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Bhandari, S.; Callingham, J. R.; Gaensler, B. M.; Hancock, P. J.; Lenc, E. [ARC Centre of Excellence for All-Sky Astrophysics (CAASTRO), Sydney NSW (Australia); Hurley-Walker, N.; Seymour, N. [International Centre for Radio Astronomy Research (ICRAR), Curtin University, Bentley, WA 6102 (Australia); Offringa, A. R. [Netherlands Institute for Radio Astronomy (ASTRON), P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Hanish, D. J. [Spitzer Science Center, California Institute of Technology, MC 220-6, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Ekers, R. D.; Bell, M. E. [CSIRO Astronomy and Space Science (CASS), P.O. Box 76, Epping, NSW 1710 (Australia); Dwarakanath, K. S. [Raman Research Institute, Bangalore 560080 (India); Hindson, L. [Centre of Astrophysics Research, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Johnston-Hollitt, M. [School of Chemical and Physical Sciences, Victoria University of Wellington, P.O. Box 600, Wellington 6140 (New Zealand); McKinley, B., E-mail: anna.kapinska@uwa.edu.au [School of Physics, The University of Melbourne, Parkville, VIC 3010 (Australia); and others

    2017-03-20

    We present new radio continuum observations of NGC 253 from the Murchison Widefield Array at frequencies between 76 and 227 MHz. We model the broadband radio spectral energy distribution for the total flux density of NGC 253 between 76 MHz and 11 GHz. The spectrum is best described as a sum of a central starburst and extended emission. The central component, corresponding to the inner 500 pc of the starburst region of the galaxy, is best modeled as an internally free–free absorbed synchrotron plasma, with a turnover frequency around 230 MHz. The extended emission component of the spectrum of NGC 253 is best described as a synchrotron emission flattening at low radio frequencies. We find that 34% of the extended emission (outside the central starburst region) at 1 GHz becomes partially absorbed at low radio frequencies. Most of this flattening occurs in the western region of the southeast halo, and may be indicative of synchrotron self-absorption of shock-reaccelerated electrons or an intrinsic low-energy cutoff of the electron distribution. Furthermore, we detect the large-scale synchrotron radio halo of NGC 253 in our radio images. At 154–231 MHz the halo displays the well known X-shaped/horn-like structure, and extends out to ∼8 kpc in the z -direction (from the major axis).

  15. 7 CFR 1726.253 - Prior approved contract modification related to alternative bid provision for payment to...

    Science.gov (United States)

    2010-01-01

    ... alternative bid provision for payment to contractor for bulk purchase of materials. 1726.253 Section 1726.253... contractor for bulk purchase of materials. When construction is to be performed over an extended period of... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Modifications to RUS Standard Contract Forms...

  16. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.

    1976-01-01

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  17. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  18. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Cardoso, Antonio

    1976-01-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  19. G0.253 + 0.016: A MOLECULAR CLOUD PROGENITOR OF AN ARCHES-LIKE CLUSTER

    International Nuclear Information System (INIS)

    Longmore, Steven N.; Ascenso, Joana; Testi, Leonardo; Bressert, Eli; Rathborne, Jill; Bastian, Nate; Alves, Joao; Meingast, Stefan; Bally, John; Battersby, Cara; Longmore, Andy; Purcell, Cormac; Walsh, Andrew; Jackson, James; Foster, Jonathan; Molinari, Sergio; Amorim, A.; Lima, J.; Marques, R.; Moitinho, A.

    2012-01-01

    Young massive clusters (YMCs) with stellar masses of 10 4 -10 5 M ☉ and core stellar densities of 10 4 -10 5 stars per cubic pc are thought to be the 'missing link' between open clusters and extreme extragalactic super star clusters and globular clusters. As such, studying the initial conditions of YMCs offers an opportunity to test cluster formation models across the full cluster mass range. G0.253 + 0.016 is an excellent candidate YMC progenitor. We make use of existing multi-wavelength data including recently available far-IR continuum (Herschel/Herschel Infrared Galactic Plane Survey) and mm spectral line (H 2 O Southern Galactic Plane Survey and Millimetre Astronomy Legacy Team 90 GHz Survey) data and present new, deep, multiple-filter, near-IR (Very Large Telescope/NACO) observations to study G0.253 + 0.016. These data show that G0.253 + 0.016 is a high-mass (1.3 × 10 5 M ☉ ), low-temperature (T dust ∼ 20 K), high-volume, and column density (n ∼ 8 × 10 4 cm –3 ; N H 2 ∼4×10 23 cm –2 ) molecular clump which is close to virial equilibrium (M dust ∼ M virial ) so is likely to be gravitationally bound. It is almost devoid of star formation and, thus, has exactly the properties expected for the initial conditions of a clump that may form an Arches-like massive cluster. We compare the properties of G0.253 + 0.016 to typical Galactic cluster-forming molecular clumps and find it is extreme, and possibly unique in the Galaxy. This uniqueness makes detailed studies of G0.253 + 0.016 extremely important for testing massive cluster formation models.

  20. Refinement of the critical 2p25.3 deletion region

    DEFF Research Database (Denmark)

    De Rocker, Nina; Vergult, Sarah; Koolen, David

    2015-01-01

    PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study...

  1. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food Safety and Inspection Service. 2... Secretary for Food Safety § 2.53 Administrator, Food Safety and Inspection Service. (a) Delegations... to the Administrator, Food Safety and Inspection Service: (1) Exercise the functions of the Secretary...

  2. 30 CFR 206.253 - Coal subject to royalties-general provisions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Coal § 206.253 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM under 43 CFR part 3400) from a...

  3. [Influence of cold spot temperature on 253.7 nm resonance spectra line of electrodeless discharge lamps].

    Science.gov (United States)

    Dong, Jin-yang; Zhang, Gui-xin; Wang, Chang-quan

    2012-01-01

    As a kind of new electric light source, electrodeless discharge lamps are of long life, low mercury and non-stroboscopic light. The lighting effect of electrodeless discharge lamps depends on the radiation efficiency of 253.7 nm resonance spectra line to a large extent. The influence of cold temperature on 253.7 nm resonance spectra line has been studied experimentally by atomic emission spectral analysis. It was found that the radiation efficiency of 253.7 nm resonance spectra line is distributed in a nearly normal fashion with the variation of cold spot temperature, in other words, there is an optimum cold spot temperature for an electrodeless discharge lamp. At last, the results of experiments were analyzed through gas discharge theory, which offers guidance to the improvement of lighting effect for electrodeless discharge lamps.

  4. 40 CFR 96.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 96... (CONTINUED) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS CAIR SO2 Allowance Tracking System § 96.253 Recordation of CAIR SO2 allowances. (a)(1) After a...

  5. 40 CFR 97.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR SO2 Allowance Tracking System § 97.253 Recordation of CAIR SO2 allowances. (a)(1) After a compliance account is...

  6. Activation of p38 MAPK pathway in the skull abnormalities of Apert syndrome Fgfr2+P253R mice

    Directory of Open Access Journals (Sweden)

    Hill Cheryl A

    2010-02-01

    Full Text Available Abstract Background Apert syndrome is characterized by craniosynostosis and limb abnormalities and is primarily caused by FGFR2 +/P253R and +/S252W mutations. The former mutation is present in approximately one third whereas the latter mutation is present in two-thirds of the patients with this condition. We previously reported an inbred transgenic mouse model with the Fgfr2 +/S252W mutation on the C57BL/6J background for Apert syndrome. Here we present a mouse model for the Fgfr2+/P253R mutation. Results We generated inbred Fgfr2+/P253R mice on the same C56BL/6J genetic background and analyzed their skeletal abnormalities. 3D micro-CT scans of the skulls of the Fgfr2+/P253R mice revealed that the skull length was shortened with the length of the anterior cranial base significantly shorter than that of the Fgfr2+/S252W mice at P0. The Fgfr2+/P253R mice presented with synostosis of the coronal suture and proximate fronts with disorganized cellularity in sagittal and lambdoid sutures. Abnormal osteogenesis and proliferation were observed at the developing coronal suture and long bones of the Fgfr2+/P253R mice as in the Fgfr2+/S252W mice. Activation of mitogen-activated protein kinases (MAPK was observed in the Fgfr2+/P253R neurocranium with an increase in phosphorylated p38 as well as ERK1/2, whereas phosphorylated AKT and PKCα were not obviously changed as compared to those of wild-type controls. There were localized phenotypic and molecular variations among individual embryos with different mutations and among those with the same mutation. Conclusions Our in vivo studies demonstrated that the Fgfr2 +/P253R mutation resulted in mice with cranial features that resemble those of the Fgfr2+/S252W mice and human Apert syndrome. Activated p38 in addition to the ERK1/2 signaling pathways may mediate the mutant neurocranial phenotype. Though Apert syndrome is traditionally thought to be a consistent phenotype, our results suggest localized and regional

  7. SHAKEN, NOT STIRRED: THE DISRUPTED DISK OF THE STARBURST GALAXY NGC 253

    International Nuclear Information System (INIS)

    Davidge, T. J.

    2010-01-01

    Near-infrared images obtained with WIRCam on the Canada-France-Hawaii Telescope are used to investigate the recent history of the nearby Sculptor Group spiral NGC 253, which is one of the nearest starburst galaxies. Bright asymptotic giant branch (AGB) stars are traced out to projected distances of ∼22-26 kpc (∼13-15 disk scale lengths) along the major axis. The distribution of stars in the disk is lopsided, in the sense that the projected density of AGB stars in the northeast portion of the disk between 10 and 20 kpc from the galaxy center is ∼0.5 dex higher than on the opposite side of the galaxy. A large population of red supergiants is also found in the northeast portion of the disk and, with the exception of the central 2 kpc, this area appears to have been the site of the highest levels of star-forming activity in the galaxy during the past ∼0.1 Gyr. It is argued that such high levels of localized star formation may have produced a fountain that ejected material from the disk, and the extraplanar H I detected by Boomsma et al. may be one manifestation of such activity. Diffuse stellar structures are found in the periphery of the disk, and the most prominent of these is to the south and east of the galaxy. Bright AGB stars, including cool C stars that are identified based on their J - K colors, are detected out to 15 kpc above the disk plane, and these are part of a diffusely distributed, flattened extraplanar component. Comparisons between observed and model luminosity functions suggest that the extraplanar regions contain stars that formed throughout much of the age of the universe. Additional evidence of a diffuse, extraplanar stellar component that contains moderately young stars comes from archival Galaxy Evolution Explorer images. It is suggested that the disk of NGC 253 was disrupted by a tidal encounter with a now defunct companion. This encounter introduced asymmetries that remain to this day, and the projected distribution of stars in and

  8. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.

  9. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. [71 FR 39005, July 11, 2006] ...

  10. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  11. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.

    2015-01-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  12. Neutron flux characterization of californium-252 Neutron Research Facility at the University of Texas - Pan American by nuclear analytical technique

    Science.gov (United States)

    Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad

    2014-03-01

    In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.

  13. Hemorroidectomia convencional versus hemorroidopexia mecânica (PPH: estudo retrospectivo de 253 casos Conventional hemorrhoidectomy versus stapled hemorrhoidopexy (PPH: a retrospective study of 253 patients

    Directory of Open Access Journals (Sweden)

    Raphael Marianelli

    2009-03-01

    Full Text Available O objetivo deste estudo foi rever a experiência do serviço de coloproctologia do HSPM-SP no tratamento cirúrgico da doença hemorroidária. Estudou-se retrospectivamente 253 pacientes portadores de hemorroidas submetidos à cirurgia no período de 10/05/2004 a 31/12/2007. Foram estabelecidos dois grupos: Grupo 1 Pacientes operados pela técnica convencional (212; Grupo 2 Pacientes operados pelo PPH (41. Estudou-se, pela revisão de prontuários, as características epidemiológicas, indicações, resultados e complicações de cada grupo. Entre os 253 pacientes analisados, 170 eram mulheres, com média de idade de 50 anos. O tempo operatório médio foi de 52 minutos para o grupo 1, e 31 minutos para o grupo 2 (p=0,0001. O tempo médio de alta ambulatorial foi de 10 e 6 semanas para o grupo 1 e 2, respectivamente (p=0,021. As complicações totalizaram 28 casos no grupo 1, e 3 casos no grupo 2 (p>0,05. Cerca de 13 casos no grupo 1, e 1 caso no grupo 2 necessitaram de reintervenção cirúrgica. Neste serviço a técnica mais utilizada foi a hemorroidectomia convencional. O método do PPH apresentou tempo operatório mais curto, e recuperação pós-operatória mais breve. Houve uma maior tendência a complicações tardias e recidivas com o grupo de hemorroidectomia convencional, porém sem significância estatística.The aim of this study was to review the experience of the Coloproctology Department of HSPM-SP in the treatment of hemorrhoids. We have retrospectively studied 253 patients submitted to the surgical treatment of hemorrhoids between 05/10/ 2004 and 12/31/2007. Patients were distributed in groups: Group 1 Conventional Hemorrhoidectomy (212; Group 2 Stapled Hemorrhoidopexy (41. Epidemiology, indications, results and complications were studied based on registers. From 253 patients studied, 170 were women, with a mean age of 50 years. Mean operating time was 52 minutes (25 -120 in group 1 and 31 minutes (20 - 65 in group 2 (p=0

  14. Luminescent properties of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F oxyfluorides

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sangmoon, E-mail: spark@silla.ac.kr [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of)

    2012-04-15

    Effective orange Sm{sup 3+}-doped Sr{sub 2.5}Ba{sub 0.5}AlO{sub 4}F phosphors excited at 254 and 408 nm excitation were prepared by the solid-state method. The excitation and emission spectra of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001{approx}0.1) based on photoluminescence spectroscopy are investigated. The defects in anion-deficient Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001, 0.01) are monitored by broad-band photoluminescence emission centered near 480 nm along with the orange emission transitions of Sm{sup 3+}. CIE values and relative luminescent intensities of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} by changing the Sm{sup 3+} content (x=0.001{approx}0.1) are discussed. - Highlights: Black-Right-Pointing-Pointer Under the excitation of 408 nm competent orange emitting Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F phosphor is initiated. Black-Right-Pointing-Pointer Sm{sup 3+}-activated oxyfluoride phosphor is quite effective to prepare white-emitting light for near-UV LED applications. Black-Right-Pointing-Pointer Defects could be visibly created in the Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}Al O{sub 4}F host lattices when Sm{sup 3+} ions are doped less than 5 mol %. Black-Right-Pointing-Pointer The gradual substitution of Sm{sup 3+} contents in oxyfluoride hosts is amenable to change CIE values and desired emitting intensity.

  15. 30 CFR 253.50 - How can MMS refuse or invalidate my OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can MMS refuse or invalidate my OSFR... can MMS refuse or invalidate my OSFR evidence? (a) If MMS determines that any OSFR evidence you submit... acceptable evidence without being subject to civil penalty under § 253.51. (b) MMS may immediately and...

  16. Clinical significance of circulating miR-25-3p as a novel diagnostic and prognostic biomarker in osteosarcoma.

    Science.gov (United States)

    Fujiwara, Tomohiro; Uotani, Koji; Yoshida, Aki; Morita, Takuya; Nezu, Yutaka; Kobayashi, Eisuke; Yoshida, Akihiko; Uehara, Takenori; Omori, Toshinori; Sugiu, Kazuhisa; Komatsubara, Tadashi; Takeda, Ken; Kunisada, Toshiyuki; Kawamura, Machiko; Kawai, Akira; Ochiya, Takahiro; Ozaki, Toshifumi

    2017-05-16

    Emerging evidence has suggested that circulating microRNAs (miRNAs) in body fluids have novel diagnostic and prognostic significance for patients with malignant diseases. The lack of useful biomarkers is a crucial problem of bone and soft tissue sarcomas; therefore, we investigated the circulating miRNA signature and its clinical relevance in osteosarcoma. Global miRNA profiling was performed using patient serum collected from a discovery cohort of osteosarcoma patients and controls and cell culture media. The secretion of the detected miRNAs from osteosarcoma cells and clinical relevance of serum miRNA levels were evaluated using in vitro and in vivo models and a validation patient cohort. Discovery screening identified 236 serum miRNAs that were highly expressed in osteosarcoma patients compared with controls, and eight among these were also identified in the cell culture media. Upregulated expression levels of miR-17-5p and miR-25-3p were identified in osteosarcoma cells, and these were abundantly secreted into the culture media in tumor-derived exosomes. Serum miR-25-3p levels were significantly higher in osteosarcoma patients than in control individuals in the validation cohort, with favorable sensitivity and specificity compared with serum alkaline phosphatase. Furthermore, serum miR-25-3p levels at diagnosis were correlated with patient prognosis and reflected tumor burden in both in vivo models and patients; these associations were more sensitive than those of serum alkaline phosphatase. Serum-based circulating miR-25-3p may serve as a non-invasive blood-based biomarker for tumor monitoring and prognostic prediction in osteosarcoma patients.

  17. THE GALACTIC CENTER CLOUD G0.253+0.016: A MASSIVE DENSE CLOUD WITH LOW STAR FORMATION POTENTIAL

    Energy Technology Data Exchange (ETDEWEB)

    Kauffmann, Jens; Pillai, Thushara [Astronomy Department, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Zhang Qizhou, E-mail: jens.kauffmann@astro.caltech.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street MS78, Cambridge, MA 02138 (United States)

    2013-03-10

    We present the first interferometric molecular line and dust emission maps for the Galactic Center (GC) cloud G0.253+0.016, observed using CARMA and the SMA. This cloud is very dense, and concentrates a mass exceeding the Orion Molecular Cloud Complex (2 Multiplication-Sign 10{sup 5} M{sub Sun }) into a radius of only 3 pc, but it is essentially starless. G0.253+0.016 therefore violates ''star formation laws'' presently used to explain trends in galactic and extragalactic star formation by a factor {approx}45. Our observations show a lack of dense cores of significant mass and density, thus explaining the low star formation activity. Instead, cores with low densities and line widths {approx}< 1 km s{sup -1}-probably the narrowest lines reported for the GC region to date-are found. Evolution over several 10{sup 5} yr is needed before more massive cores, and possibly an Arches-like stellar cluster, could form. Given the disruptive dynamics of the GC region, and the potentially unbound nature of G0.253+0.016, it is not clear that this evolution will happen.

  18. PCA/HEXTE Observations of M82 and NGC253

    Science.gov (United States)

    Rephaeli, Yoel

    1999-01-01

    The nearby starburst galaxies M82 & NGC 253 were observed by the RXTE satellite during the period February - November 1997. Data reduction and analysis began in summer 1998, and continued through March 1999. The spectral analysis indicates that the main emission in these galaxies is from hot gas. We find a considerable degree of variability in the emission from M82, possibly due to M81 (a known AGN) in the FOV. The main spectral parameters were determined for both sources. The results of the analysis were reported in the March 1999 meeting of the AAS. Summary of the data analysis, theoretical modeling, and interpretation will be presented in a paper which is currently being prepared for publication in the Astrophysical Journal.

  19. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1976

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1977-10-01

    During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  20. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    International Nuclear Information System (INIS)

    Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  1. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)

    2016-01-11

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  2. H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7

    NARCIS (Netherlands)

    Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.

    We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very

  3. miR-25-3p, Positively Regulated by Transcription Factor AP-2α, Regulates the Metabolism of C2C12 Cells by Targeting Akt1

    Directory of Open Access Journals (Sweden)

    Feng Zhang

    2018-03-01

    Full Text Available miR-25, a member of the miR-106b-25 cluster, has been reported as playing an important role in many biological processes by numerous studies, while the role of miR-25 in metabolism and its transcriptional regulation mechanism remain unclear. In this study, gain-of-function and loss-of-function assays demonstrated that miR-25-3p positively regulated the metabolism of C2C12 cells by attenuating phosphoinositide 3-kinase (PI3K gene expression and triglyceride (TG content, and enhancing the content of adenosine triphosphate (ATP and reactive oxygen species (ROS. Furthermore, the results from bioinformatics analysis, dual luciferase assay, site-directed mutagenesis, qRT-PCR, and Western blotting demonstrated that miR-25-3p directly targeted the AKT serine/threonine kinase 1 (Akt1 3′ untranslated region (3′UTR. The core promoter of miR-25-3p was identified, and the transcription factor activator protein-2α (AP-2α significantly increased the expression of mature miR-25-3p by binding to its core promoter in vivo, as indicated by the chromatin immunoprecipitation (ChIP assay, and AP-2α binding also downregulated the expression of Akt1. Taken together, our findings suggest that miR-25-3p, positively regulated by the transcription factor AP-2α, enhances C2C12 cell metabolism by targeting the Akt1 gene.

  4. En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™

    DEFF Research Database (Denmark)

    Kruckow, Line; Eldrup, Jesper

    Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og...

  5. THE COMPACT STAR-FORMING COMPLEX AT THE HEART OF NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Davidge, T. J., E-mail: tim.davidge@nrc.ca [Dominion Astrophysical Observatory, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada)

    2016-02-20

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C{sub 2} bandhead. If this feature is due to C{sub 2} then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe ii], and He i 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages <8 Myr, are found along the western edge of the complex, and there is evidence that one such pocket contains a rich population of Wolf–Rayet stars. Unless the star-forming complex is significantly more metal-poor than the surroundings, then a significant fraction of its total mass is in stars with ages <8 Myr. If the present-day star formation rate is maintained then the timescale to double its stellar mass ranges from a few Myr to a few tens of Myr, depending on the contribution made by stars older than ∼8 Myr. If—as suggested by some studies—the star-forming complex is centered on the galaxy’s nucleus, which presumably contains a large population of old and intermediate-age stars, then the nucleus of NGC 253 is currently experiencing a phase of rapid growth in its stellar mass.

  6. 30 CFR 253.27 - When I submit audited annual financial statements to verify my unencumbered assets, what...

    Science.gov (United States)

    2010-07-01

    ... financial statements to verify my unencumbered assets, what standards must they meet? Any audited annual financial statements that you submit must: (a) Meet the standards in § 253.24; and (b) Include a certification by the independent accountant who audited the financial statements that states: (1) The value of...

  7. Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253

    DEFF Research Database (Denmark)

    Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array ( NuSTAR ) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner ~ 20 arcsec ( ~ 400 pc) nuclear region...

  8. In-beam study of {sup 253}No using the SAGE spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, A.K.; Herzberg, R.D.; Butler, P.A.; Cox, D.M.; Joss, D.T.; Page, R.D.; Seddon, D.; Thornhill, J.; Wells, D. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Greenlees, P.T.; Papadakis, P.; Auranen, K.; Grahn, T.; Jakobsson, U.; Julin, R.; Konki, J.; Leino, M.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Sorri, J.; Stolze, S.; Uusitalo, J. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Garnsworthy, A.B.; Ketelhut, S. [University of British Columbia, TRIUMF, Vancouver, British Columbia (Canada); Hauschild, K.; Lopez-Martens, A. [Universite Paris-Sud, CSNSM, CNRS, IN2P3, Orsay (France); Simpson, J. [STFC, Daresbury Laboratory, Daresbury, Warrington (United Kingdom)

    2017-02-15

    The heavy actinide nucleus {sup 253}No (Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyvaeskylae. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2{sup -}[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections. (orig.)

  9. Evidence for large-scale winds from starburst galaxies. I. The nature of the ionized gas in M82 and NGC 253

    International Nuclear Information System (INIS)

    Mccarthy, P.J.; Van breugel, W.; Heckman, T.; Maryland Univ., College Park)

    1987-01-01

    The results of long-slit spectroscopy and narrow-band imaging of M82 and NGC 253, the two nearest examples of FIR luminous galaxies believed to be undergoing intense bursts of star formation, are presented. The profile of the gas pressure in the emission-line filaments in M82 is derived and found to be in good agreement with the model of Chevalier and Clegg (1985) of a supernovae-driven wind from a starburst nucleus. Lower quality data from NGC 253 support the same interpretation. Analysis of the emission-line ratios suggests that the line-emitting gas may be heated by low-velocity shocks, although photoionization from dilute UV radiation from unusually hot stars in the central starburst may also be important. 56 references

  10. A VST and VISTA study of globular clusters in NGC 253

    Science.gov (United States)

    Cantiello, Michele; Grado, Aniello; Rejkuba, Marina; Arnaboldi, Magda; Capaccioli, Massimo; Greggio, Laura; Iodice, Enrica; Limatola, Luca

    2018-03-01

    Context. Globular clusters (GCs) are key to our understanding of the Universe, as laboratories of stellar evolution, fossil tracers of the past formation epoch of the host galaxy, and effective distance indicators from local to cosmological scales. Aim. We analyze the properties of the sources in the NGC 253 with the aim of defining an up to date catalog of GC candidates in the galaxy. Given the distance of the galaxy, GCs in NGC 253 are ideal targets for resolved color-magnitude diagram studies of extragalactic GCs with next-generation diffraction limited ground-based telescopes. Methods: Our analysis is based on the science verification data of two ESO survey telescopes, VST and VISTA. Using ugri photometry from VST and JKs from VISTA, GC candidates were selected using as reference the morpho-photometric and color properties of spectroscopically confirmed GCs available in the literature. The strength of the results was verified against available archival HST/ACS data from the GHOSTS survey: all but two of the selected GC candidates appear as star clusters in HST footprints. Results: The adopted GC selection leads to the definition of a sample of ˜350 GC candidates. At visual inspection, we find that 82 objects match all the requirements for selecting GC candidates and 155 are flagged as uncertain GC candidate; however, 110 are unlikely GCs, which are most likely background galaxies. Furthermore, our analysis shows that four of the previously spectroscopically confirmed GCs, i.e., ˜20% of the total spectroscopic sample, are more likely either background galaxies or high-velocity Milky Way stars. The radial density profile of the selected best candidates shows the typically observed r1/4-law radial profile. The analysis of the color distributions reveals only marginal evidence of the presence of color bimodality, which is normally observed in galaxies of similar luminosity. The GC luminosity function does not show the typical symmetry, mainly because of the lack

  11. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  12. Effect of variable doses of ultraviolet radiation (253.7 nm) on thermoluminescence NaCl:Ca(T) material

    International Nuclear Information System (INIS)

    Nehate, A.K.; Joshi, T.R.; Kathuria, S.P.; Joshi, R.V.

    1986-01-01

    This paper studies the thermoluminescence (TL) glow curves of NaCl:Ca(T) phosphors to various doses of 253.7-nm ultraviolet (UV) radiation at room temperature. TLD grade NaCl:Ca(T) material was obtained by crystallization from solution and was subsequently annealed at 750 degrees C for 2 h, followed by sudden quenching. We undertook measurement of the effect of variable UV radiation doses (10(2) to 10(6) J m-2) on the TL behaviour of NaCl:Ca(T) phosphors. It was observed that the phosphor exhibits a dominant peak around 167 degrees C along with a weak peak at lower temperature. The high-temperature peak (Peak II) is found to grow linearly with the increase in UV dose in the range of 10(2) to 10(6) J m-2. Since the nature of the glow curves under the influence of different doses remains more or less identical, it is believed that the phosphor does not undergo radiation damage and displays high intrinsic TL around Peak II. Examination of the system for fundamental dosimetry requirements shows that it can be used in dosimetry work at 253.7 nm

  13. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Mosley, W.C.; Smith, P.K.

    1976-01-01

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  14. XMM-Newton Observations of NGC 253: Resolving the Emission Components in the Disk and Nuclear Area

    Science.gov (United States)

    Pietsch, W.; Borozdin, K. N.; Branduardi-Raymont, G.; Cappi, M.; Ehle, M.; Ferrando, P.; Freyberg, M. J.; Kahn, S. M.; Ponman, T. J.; Ptak, A.

    2000-01-01

    We describe the first XMM-Newton observations of the starburst galaxy NGC 253. As known from previous X-ray observations, NGC 253 shows a mixture of extended (disk and halo) and point-source emission. The high XMM-Newton throughput allows for the first time a detailed investigation of the spatial, spectral and variability properties of these components simultaneously. We detect a bright X-ray transient approx. 70 sec SSW of the nucleus and show the spectrum and light curve of the brightest point source (approx. 30 sec S of the nucleus, most likely a black-hole X-ray binary, BHXRB). The unprecedented combination of RGS and EPIC also sheds new light on the emission of the complex nuclear region, the X-ray plume and the disk diffuse emission. In particular, EPIC images reveal that the limb-brightening of the plume is mostly seen in higher ionization emission lines, while in the lower ionization lines, and below 0.5 keV, the plume is more homo- geneously structured, pointing to new interpretations as to the make up of the starburst-driven outflow. Assuming that type IIa supernova remnants (SNRs) are mostly responsible for the E greater than 4 keV emission, the detection with EPIC of the 6.7 keV line allows us to estimate a supernova rate within the nuclear starburst of 0.2 /yr.

  15. Direct Evidence for Maser Emission from the 36.2 GHz Class I Transition of Methanol in NGC253

    Science.gov (United States)

    Chen, Xi; Ellingsen, Simon P.; Shen, Zhi-Qiang; McCarthy, Tiege P.; Zhong, Wei-Ye; Deng, Hui

    2018-04-01

    Observations made with the Jansky Very large Array (JVLA) at an angular resolution of ∼0.″1 have detected class I methanol maser emission from the 36.2 GHz transition toward the starburst galaxy NGC 253. The methanol emission is detected toward four sites which lie within the regions of extended methanol emission detected in previous lower angular resolution (a few arcseconds) observations. The peak flux densities of the detected compact components are in the range 3–9 mJy beam‑1. Combining the JVLA data with single-dish observations from the Shanghai Tianma Radio Telescope (TMRT) and previous interferometric observations with the Australia Telescope Compact Array (ATCA), we show that the 36.2 GHz class I methanol emission consists of both extended and compact structures, with typical scales of ∼6″ (0.1 kpc) and ∼0.″05 (1 pc), respectively. The strongest components have a brightness temperature of >103 K, much higher than the maximum kinetic temperature (∼100 K) of the thermal methanol emission from NGC 253. Therefore, these observations conclusively demonstrate for the first time the presence of maser emission from a class I methanol transition in an external galaxy.

  16. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity

    NARCIS (Netherlands)

    Rocker, N. de; Vergult, S.; Koolen, D.A.; Jacobs, E.; Hoischen, A.; Zeesman, S.; Bang, B.; Bena, F.; Bockaert, N.; Bongers, E.M.H.F.; Ravel, T. de; Devriendt, K.; Giglio, S.; Faivre, L.; Joss, S.; Maas, S.; Marle, N.; Novara, F.; Nowaczyk, M.J.; Peeters, H.; Polstra, A.; Roelens, F.; Rosenberg, C.; Thevenon, J.; Tumer, Z.; Vanhauwaert, S.; Varvagiannis, K.; Willaert, A.; Willemsen, M.H.; Willems, M.; Zuffardi, O.; Coucke, P.; Speleman, F.; Eichler, E.E.; Kleefstra, T.; Menten, B.

    2015-01-01

    PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study

  17. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity

    NARCIS (Netherlands)

    de Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M.; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J. M.; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E.; Kleefstra, Tjitske; Menten, Björn

    2015-01-01

    Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a

  18. Trends in radioisotope development and utilization in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)

    1976-06-01

    The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.

  19. Deformed Skull Morphology Is Caused by the Combined Effects of the Maldevelopment of Calvarias, Cranial Base and Brain in FGFR2-P253R Mice Mimicking Human Apert Syndrome.

    Science.gov (United States)

    Luo, Fengtao; Xie, Yangli; Xu, Wei; Huang, Junlan; Zhou, Siru; Wang, Zuqiang; Luo, Xiaoqing; Liu, Mi; Chen, Lin; Du, Xiaolan

    2017-01-01

    Apert syndrome (AS) is a common genetic syndrome in humans characterized with craniosynostosis. Apert patients and mouse models showed abnormalities in sutures, cranial base and brain, that may all be involved in the pathogenesis of skull malformation of Apert syndrome. To distinguish the differential roles of these components of head in the pathogenesis of the abnormal skull morphology of AS, we generated mouse strains specifically expressing mutant FGFR2 in chondrocytes, osteoblasts, and progenitor cells of central nervous system (CNS) by crossing Fgfr2 +/P253R-Neo mice with Col2a1-Cre, Osteocalcin-Cre (OC-Cre), and Nestin-Cre mice, respectively. We then quantitatively analyzed the skull and brain morphology of these mutant mice by micro-CT and micro-MRI using Euclidean distance matrix analysis (EDMA). Skulls of Col2a1-Fgfr2 +/P253R mice showed Apert syndrome-like dysmorphology, such as shortened skull dimensions along the rostrocaudal axis, shortened nasal bone, and evidently advanced ossification of cranial base synchondroses. The OC-Fgfr2 +/P253R mice showed malformation in face at 8-week stage. Nestin-Fgfr2 +/P253R mice exhibited increased dorsoventral height and rostrocaudal length on the caudal skull and brain at 8 weeks. Our study indicates that the abnormal skull morphology of AS is caused by the combined effects of the maldevelopment in calvarias, cranial base, and brain tissue. These findings further deepen our knowledge about the pathogenesis of the abnormal skull morphology of AS, and provide new clues for the further analyses of skull phenotypes and clinical management of AS.

  20. H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7

    Science.gov (United States)

    Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.

    2015-07-01

    We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very sensitive to large-scale, low-surface-brightness emission. The KAT-7 observations detected 33 per cent more flux than previous Very Large Array observations, mainly in the outer parts and in the halo for a total H I mass of 2.1 ± 0.1 × 109 M⊙. H I can be found at large distances perpendicular to the plane out to projected distances of ˜9-10 kpc away from the nucleus and ˜13-14 kpc at the edge of the disc. A novel technique, based on interactive profile fitting, was used to separate the main disc gas from the anomalous (halo) gas. The rotation curve (RC) derived for the H I disc confirms that it is declining in the outer parts, as seen in previous optical Fabry-Perot measurements. As for the anomalous component, its RC has a very shallow gradient in the inner parts and turns over at the same radius as the disc, kinematically lagging by 100 km s-1. The kinematics of the observed extra-planar gas is compatible with an outflow due to the central starburst and galactic fountains in the outer parts. However, the gas kinematics shows no evidence for inflow. Analysis of the near-IR WISE data, shows clearly that the star formation rate is compatible with the starburst nature of NGC 253.

  1. El Límite a la Protección de las Tierras Indígenas de la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Mario Salamanca Huenchullán

    Full Text Available Este trabajo aborda el tema del límite a la protección de las tierras indígenas, que como una exigencia del interés nacional introduce en la legislación chilena la Ley Indígena 19.253, en su relación con la expropiación para la construcción de obras públicas, que en virtud de la utilidad pública se construyen sobre estas mismas tierras.

  2. The 253-kb inversion and deep intronic mutations in UNC13D are present in North American patients with familial hemophagocytic lymphohistiocytosis 3.

    Science.gov (United States)

    Qian, Yaping; Johnson, Judith A; Connor, Jessica A; Valencia, C Alexander; Barasa, Nathaniel; Schubert, Jeffery; Husami, Ammar; Kissell, Diane; Zhang, Ge; Weirauch, Matthew T; Filipovich, Alexandra H; Zhang, Kejian

    2014-06-01

    The mutations in UNC13D are responsible for familial hemophagocytic lymphohistiocytosis (FHL) type 3. A 253-kb inversion and two deep intronic mutations, c.118-308C > T and c.118-307G > A, in UNC13D were recently reported in European and Asian FHL3 patients. We sought to determine the prevalence of these three non-coding mutations in North American FHL patients and evaluate the significance of examining these new mutations in genetic testing. We performed DNA sequencing of UNC13D and targeted analysis of these three mutations in 1,709 North American patients with a suspected clinical diagnosis of hemophagocytic lymphohistiocytosis (HLH). The 253-kb inversion, intronic mutations c.118-308C > T and c.118-307G > A were found in 11, 15, and 4 patients, respectively, in which the genetic basis (bi-allelic mutations) explained 25 additional patients. Taken together with previously diagnosed FHL3 patients in our HLH patient registry, these three non-coding mutations were found in 31.6% (25/79) of the FHL3 patients. The 253-kb inversion, c.118-308C > T and c.118-307G > A accounted for 7.0%, 8.9%, and 1.3% of mutant alleles, respectively. Significantly, eight novel mutations in UNC13D are being reported in this study. To further evaluate the expression level of the newly reported intronic mutation c.118-307G > A, reverse transcription PCR and Western blot analysis revealed a significant reduction of both RNA and protein levels suggesting that the c.118-307G > A mutation affects transcription. These specified non-coding mutations were found in a significant number of North American patients and inclusion of them in mutation analysis will improve the molecular diagnosis of FHL3. © 2014 Wiley Periodicals, Inc.

  3. Gene expression response of A253 human salivary cell line to radiation, Cis-Pt, and EGF

    International Nuclear Information System (INIS)

    Woloschak, G.; Paunesku, T.; Mittal, B.; Dyck, P.; Pauloski, B.; Rademaker, A.; Logemann, J.; Quigg, R.

    2003-01-01

    We are interested in long and short term effects of head and neck cancers treatment, and prior to the studies of patient samples, experiments were designed to observe treatment effects in cultured cells, and examine gene expression profiles from A253 human salivary cells (derived from a head and neck tumor) following exposure to gamma-rays, cisplatin (cis-Pt), and a combination of either with epidermal growth factor (EGF) treatment. A253 cells were treated by: 2 Gy or 10 Gy of γ-rays (Cs137 source, 77 cGy/min), Cis-Pt at 50 μ/mL, and EGF at 40 ng/mL. RNAs were processed and hybridized with Affymetrix Hu95A arrays according to the manufacturer's instructions. Data were scanned and analyzed and we found significant differences in the expression patterns of numerous genes were observed. Some of the more interesting genes are: Requeim [a protein required for apoptosis]; Cyclin D1 (prad1/bcl1) [a cyclin that can function as an oncogene]; FK506 Binding Protein [which may be competing with TGF-beta type I receptor for binding with FK506 thus acting against this powerful immunosuppressant]; Thioredoxin (TXN) [an oxidoreductase with multiple in vitro substrates, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin]; Glutathione Peroxidase (GPX) [whose role in protection against oxidative stress was long ago well documented]; Aquaporin 3 (AQP3) [protein with a water-channel function that was confirmed by functional expression in Xenopus oocytes]; Eukaryotic Initiation Factor 1A (EIF1A) [a translation factor, proposed as a candidate gene for Turner syndrome]; and finally Insulin-like Growth Factor-Binding Protein 6 (IGFBP6) [an autocrine growth inhibitor shown to inhibit growth of HaCat cells and other keratinocyte cell lines

  4. A Thorough View of the Nuclear Region of NGC 253: Combined Herschel, SOFIA, and APEX Data Set

    Science.gov (United States)

    Pérez-Beaupuits, J. P.; Güsten, R.; Harris, A.; Requena-Torres, M. A.; Menten, K. M.; Weiß, A.; Polehampton, E.; van der Wiel, M. H. D.

    2018-06-01

    We present a large set of spectral lines detected in the 40″ central region of the starburst galaxy NGC 253. Observations were obtained with the three instruments SPIRE, PACS, and HIFI on board the Herschel Space Observatory, upGREAT on board the SOFIA airborne observatory, and the ground-based Atacama Pathfinder EXperiment telescope. Combining the spectral and photometry products of SPIRE and PACS, we model the dust continuum spectral energy distribution (SED) and the most complete 12CO line SED reported so far toward the nuclear region of NGC 253. The properties and excitation of the molecular gas were derived from a three-component non-LTE radiative transfer model, using the SPIRE 13CO lines and ground-based observations of the lower-J 13CO and HCN lines, to constrain the model parameters. Three dust temperatures were identified from the continuum emission, and three components are needed to fit the full CO line SED. Only the third CO component (fitting mostly the HCN and PACS 12CO lines) is consistent with a shock-/mechanical-heating scenario. A hot core chemistry is also argued as a plausible scenario to explain the high-J 12CO lines detected with PACS. The effect of enhanced cosmic-ray ionization rates, however, cannot be ruled out and is expected to play a significant role in the diffuse and dense gas chemistry. This is supported by the detection of ionic species like OH+ and H2O+, as well as the enhanced fluxes of the OH lines with respect to those of H2O lines detected in both PACS and SPIRE spectra.

  5. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  6. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  7. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    Energy Technology Data Exchange (ETDEWEB)

    Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)

    2016-03-21

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  8. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    International Nuclear Information System (INIS)

    Cha Gon, Lee

    2016-01-01

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  9. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    Eccleston, G.W.; Speir, L.G.; Garcia, D.C.

    1985-04-01

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  10. Physicochemical properties of binary solutions of propylene carbonate-acetonitrile in the range of 253.15-313.15 K

    Science.gov (United States)

    Tyunina, E. Yu.; Chekunova, M. D.

    2017-05-01

    The density, dynamic viscosity, and dielectric constant of propylene carbonate solutions with acetonitrile are measured over the composition of a mixed solvent at temperatures of 253.15, 273.15, 293.15, and 313.15 K. The molar volume, molar viscosity, and molar capacity of a mixture of propylene carbonate-acetonitrile and an excess amount of it are calculated. The effect the temperature and composition of the mixture have on the excess molar properties is discussed. A linear correlation is observed between the values of the molar fluidity, capacity, polarization, and molar volume of the studied system.

  11. Radionuclides in rodents

    International Nuclear Information System (INIS)

    Taylor, G.N.

    1985-01-01

    Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline

  12. The new high-resolution IRMS MAT253 ULTRA at Utrecht University

    Science.gov (United States)

    Röckmann, Thomas; Hofmann, Magdalena; Paul, Dipayan; Popa, Elena; Adnew, Getachew

    2017-04-01

    In 2016, the new high-resolution, multi-collector isotope ratio mass spectrometer MAT253 ULTRA [1] was installed at Utrecht University. This instrument is designed to reach a mass resolving power of 20,000 to 40,000 (M/ΔM). The ion currents are detected with a variable multi-collector unit that allows to register up to 9 ion currents simultaneously with Faraday cups and ion counters. The width of the entrance slit can be varied between 5 and 250μm so that the instrument can be operated under low, medium and high mass resolution, and an optimum balance between resolution and sensitivity can be selected for the respective applications. The central field of application of the new IRMS at Utrecht University is the measurement of multiply substituted isotopologues (clumped isotopes) in atmospheric trace compounds (e.g. 13CDH3, 13C18O16O, 18O18O, 15N14N18O) [1-7]. It is known from thermodynamics that the zero point energy of a chemical bond usually decreases when multiple heavy isotopes clump together in a molecule, and this effect depends on temperature [7]. Therefore, the abundance of clumped isotopes can be used as temperature indicator under thermodynamical equilibrium conditions. However, in the atmosphere, many reactions are controlled kinetically. It has been shown recently for a few examples that negative clumping signatures (anti-clumping) can be produced under non-equilibrium conditions [3,4]. In addition, based on purely statistical reasons, anti-clumping signatures will be produced in any molecule that contains indistinguishable atoms, which originate from isotopically distinct reservoir [5,6]. Thus, the investigation of multiply substituted isotopologues is expected to generate novel isotope signatures that can complement conventional stable isotope analysis in atmospheric science. We will present data on the performance of the MAT 253 ULTRA instrument and first scientific applications to atmospheric research. 1. Eiler, J.M., et al., A high-resolution gas

  13. Quantum-chemical consideration of extermal valent forms of actinides

    International Nuclear Information System (INIS)

    Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.

    1982-01-01

    Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution

  14. Measurements of the viscosity of carbon dioxide at temperatures from (253.15 to 473.15) K with pressures up to 1.2 MPa

    International Nuclear Information System (INIS)

    Schäfer, Michael; Richter, Markus; Span, Roland

    2015-01-01

    Highlights: • A new rotating-body viscometer for the low-pressure region was presented. • A viscosity dependent offset was compensated by calibrating the viscometer. • The viscosity of carbon dioxide was measured at low pressures. • Measurements were carried out from T = (253.15 to 473.15) K with p ≤ 1.2 MPa. • The relative expanded combined uncertainty (k = 2) was U r,c (η) = (0.20 to 0.41)%. - Abstract: The viscosity of carbon dioxide was measured over the temperature range T = (253.15 to 473.15) K with pressures up to 1.2 MPa utilizing a new rotating-body viscometer. The relative expanded combined uncertainty (k = 2) in viscosity (including uncertainties of temperature and pressure) was (0.20 to 0.41)%. The instrument was specifically designed for measurements at low gas densities and enables measurements of the dynamic viscosity at temperatures between T = 253.15 K and T = 473.15 K with pressures up to 2 MPa. For carbon dioxide, the fluid specific measuring range with regard to pressure was limited to 1.2 MPa due to the formation of disturbing vortices inside the measuring cell at higher pressures. The model function for the viscosity measurement was extended in such a way that the dynamic viscosity was measured relative to helium. Therefore, the influence of the geometry of the concentric cylindrical system inside the measuring cell became almost negligible. Moreover, a systematic offset resulting from a small but inevitable eccentricity of the cylindrical system was compensated for. The residual damping, usually measured in vacuum, was calibrated in the entire temperature range using viscosity values of helium, neon and argon calculated ab initio; at T = 298.15 K recommended reference values were used. A viscosity dependent offset of the measured viscosities, which was observed in previously published data, did not occur when using the calibrated residual damping. The new carbon dioxide results were compared to other experimental literature data

  15. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity.

    Science.gov (United States)

    De Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J M; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E; Kleefstra, Tjitske; Menten, Björn

    2015-06-01

    Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a cohort of 22 patients (15 sporadic patients and two families) with a 2p25.3 aberration to further refine the clinical phenotype and to delineate the role of MYT1L in intellectual disability and obesity. In addition, myt1l spatiotemporal expression in zebrafish embryos was analyzed by quantitative polymerase chain reaction and whole-mount in situ hybridization. Complete MYT1L deletion, intragenic deletion, or duplication was observed in all sporadic patients, in addition to two patients with a de novo point mutation in MYT1L. The familial cases comprise a 6-Mb deletion in a father and his three children and a 5' MYT1L overlapping duplication in a father and his two children. Expression analysis in zebrafish embryos shows specific myt1l expression in the developing brain. Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal intellectual disability. Moreover, because 17 patients present with obesity/overweight, haploinsufficiency of MYT1L might predispose to weight problems with childhood onset.Genet Med 17 6, 460-466.

  16. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  17. Spatially resolving a starburst galaxy at hard X-ray energies: NuSTAR, CHANDRA, AND VLBA observations of NGC 253

    DEFF Research Database (Denmark)

    Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.

    2014-01-01

    for the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and Very Long Baseline Array monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated within...... is detected at E > 40 keV. We report upper limits on diffuse inverse Compton emission for a range of spatial models. For the most extended morphologies considered, these hard X-ray constraints disfavor a dominant inverse Compton component to explain the γ-ray emission detected with Fermi and H.E.S.S. If NGC...

  18. Comment on "Applications of homogenous balanced principle on investigating exact solutions to a series of time fractional nonlinear PDEs", [Commun Nonlinear Sci Numer Simulat 47 (2017) 253-266

    Science.gov (United States)

    Li, Xiangzheng

    2018-06-01

    A counterexample is given to show that the product rule of the Caputo fractional derivatives does not hold except on a special point. The function-expansion method of separation variable proposed by Rui[Commun Nonlinear Sci Numer Simulat 47 (2017) 253-266] based on the product rule must be modified.

  19. ALMA MULTI-LINE IMAGING OF THE NEARBY STARBURST NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Meier, David S. [New Mexico Institute of Mining and Technology, 801 Leroy Place, Socorro, NM 87801 (United States); Walter, Fabian; Zschaechner, Laura K. [Max-Planck Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Bolatto, Alberto D.; Veilleux, Sylvain; Warren, Steven R. [Department of Astronomy and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States); Leroy, Adam K. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Ott, Jürgen [National Radio Astronomy Observatory, Pete V. Domenici Array Science Center, P.O. Box O, Socorro, NM 87801 (United States); Rosolowsky, Erik [Department of Physics, University of Alberta, Edmonton, AB T6G 2E1 (Canada); Weiß, Axel [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Zwaan, Martin A., E-mail: dmeier@nmt.edu [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching bei München (Germany)

    2015-03-01

    We present spatially resolved (∼50 pc) imaging of molecular gas species in the central kiloparsec of the nearby starburst galaxy NGC 253, based on observations taken with the Atacama Large Millimeter/submillimeter Array. A total of 50 molecular lines are detected over a 13 GHz bandwidth imaged in the 3 mm band. Unambiguous identifications are assigned for 27 lines. Based on the measured high CO/C{sup 17}O isotopic line ratio (≳350), we show that {sup 12}CO(1-0) has moderate optical depths. A comparison of the HCN and HCO{sup +} with their {sup 13}C-substituted isotopologues shows that the HCN(1-0) and HCO{sup +}(1-0) lines have optical depths at least comparable to CO(1-0). H{sup 13}CN/H{sup 13}CO{sup +} (and H{sup 13}CN/HN{sup 13}C) line ratios provide tighter constraints on dense gas properties in this starburst. SiO has elevated abundances across the nucleus. HNCO has the most distinctive morphology of all the bright lines, with its global luminosity dominated by the outer parts of the central region. The dramatic variation seen in the HNCO/SiO line ratio suggests that some of the chemical signatures of shocked gas are being erased in the presence of dominating central radiation fields (traced by C{sub 2}H and CN). High density molecular gas tracers (including HCN, HCO{sup +}, and CN) are detected at the base of the molecular outflow. We also detect hydrogen β recombination lines that, like their α counterparts, show compact, centrally peaked morphologies, distinct from the molecular gas tracers. A number of sulfur based species are mapped (CS, SO, NS, C{sub 2}S, H{sub 2}CS, and CH{sub 3}SH) and have morphologies similar to SiO.

  20. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.

    1984-01-01

    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  1. Biomass-burning during Holika at Varanasi (25.3 N, 83.0 E): Optical observations and Aerosol Radiative Forcing

    Science.gov (United States)

    Singh, A. K.; Singh, R. K.; Srivastava, M. K.; Mehrotra, B. J.; Murari, V.; Sharma, S. K., , Dr; Mandal, T. K., , Dr; Singh, R. S.; Banerjee, T.; Tiwari, S.

    2017-12-01

    All the anthropogenic activity, including various festivals, affect the environment. Impact of fireworks done during various festival are well documented in literature. In India, the festival of colors, Holi, is celebrated during spring season. During this festival, wood-log and other natural biomass are burned on the eve of the festival (Holika). Although the festival falls during a season with clear sky, that possibly can allow the pollutants to mix in the free troposphere, but observations made during Holika-2016 showed 2-3-times soot (or Black Carbon, BC) enhancement in nighttimes due to Holika, than the background levels. This observations motivated us to better understand the optical impact of Holika-2017. For this purpose, we planned first-time intensive-observation during Holika-2017 (March 13, 2017). Estimated 450 thousands kgs of wood and biomass is burnt during Holika-2017 in 2250 (± 5%) units of Holika at around 10 pm local time of March 12th, in the vicinity of Varanasi city (25.3N, 83.0E). Intensive observations are being done from 5th to 18th March, 2017. Extensive optical analyses have been done to understand the aerosol radiative impact of Holika burning on environment. The observed AOD was 0.336, 0.392 and 0.47 and daily average BC mass was 7137, 9942 and 8950 ng/m3 for Pre-Holika, Holika and Post-Holika. Top of the atmosphere, at the surface and in atmosphere are 2.53, -40.48 and 43.00 W/m2 for Pre-Holika, 6.45, -53.75 and 60.21 W/m2 for Holika and 8.91, -65.75 and 74.66 W/m2 for Post-Holika burning. Highest BC mass was observed around 0200 hrs on 13th March, just after few hours of Holika-2017. Preliminary results are shown in figure, depicting surface/ top-of-atmosphere/ atmospheric radiative forcing along with changes in heating rates from pre-holika to holika and post-holika days. Heating rates have enhanced 2-times for post-Holika than the background levels.

  2. Co-regulation analysis of closely linked genes identifies a highly recurrent gain on chromosome 17q25.3 in prostate cancer

    International Nuclear Information System (INIS)

    Bermudo, Raquel; Martínez-A, Carlos; Ortiz, Ángel R; Fernández, Pedro L; Thomson, Timothy M; Abia, David; Ferrer, Berta; Nayach, Iracema; Benguria, Alberto; Zaballos, Ángel; Rey, Javier del; Miró, Rosa; Campo, Elías

    2008-01-01

    Transcriptional profiling of prostate cancer (PC) has unveiled new markers of neoplasia and allowed insights into mechanisms underlying this disease. Genomewide analyses have also identified new chromosomal abnormalities associated with PC. The combination of both classes of data for the same sample cohort might provide better criteria for identifying relevant factors involved in neoplasia. Here we describe transcriptional signatures identifying distinct normal and tumoral prostate tissue compartments, and the inference and demonstration of a new, highly recurrent copy number gain on chromosome 17q25.3. We have applied transcriptional profiling to tumoral and non-tumoral prostate samples with relatively homogeneous epithelial representations as well as pure stromal tissue from peripheral prostate and cultured cell lines, followed by quantitative RT-PCR validations and immunohistochemical analysis. In addition, we have performed in silico colocalization analysis of co-regulated genes and validation by fluorescent in situ hybridization (FISH). The transcriptomic analysis has allowed us to identify signatures corresponding to non-tumoral luminal and tumoral epithelium, basal epithelial cells, and prostate stromal tissue. In addition, in silico analysis of co-regulated expression of physically linked genes has allowed us to predict the occurrence of a copy number gain at chromosomal region 17q25.3. This computational inference was validated by fluorescent in situ hybridization, which showed gains in this region in over 65% of primary and metastatic tumoral samples. Our approach permits to directly link gene copy number variations with transcript co-regulation in association with neoplastic states. Therefore, transcriptomic studies of carefully selected samples can unveil new diagnostic markers and transcriptional signatures highly specific of PC, and lead to the discovery of novel genomic abnormalities that may provide additional insights into the causes and mechanisms

  3. DETECTION OF GAMMA-RAY EMISSION FROM THE STARBURST GALAXIES M82 AND NGC 253 WITH THE LARGE AREA TELESCOPE ON FERMI

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.

  4. VizieR Online Data Catalog: NGC253 near-infrared H2 emission (Rosenberg+,

    Science.gov (United States)

    Rosenberg, M. J. F.; van der Werf, P. P.; Israel, F. P.

    2012-11-01

    All observations were made with SINFONI at the ESO VLT. We observed in the H, and K bands using a spatial pixel scale of 0.25" corresponding to a field of view of 8" by 8" per frame and a spectral resolution of 2000, 3000 and 4000 respectively, which corresponds to a velocity resolution of 149.8, 99.9 and 74.9km/s. All science observations were taken in the ABA'nodding mode (300s of object, 300s of sky, 300s of object), where A' is slightly offset from A. The object exposures are aligned and averaged during the reconstruction of the data cube. The observations of NGC 253 were made in visitor mode on August 28th, 2005. In order to capture the full extent of the H2 emission, consecutive frames were taken in the K band moving further away from the center, along the disk until H2 was no longer detected. This resulted in 6 separate pointings. Since there are also H2 transitions in the H band, a similar strategy was used, resulting in 4 separate pointings. We used the standard reduction techniques of the SINFONI pipeline on all observations, including corrections for flat field, dark current, nonlinearity of pixels, distortion, and wavelength calibration. We obtained the flux calibration and atmospheric corrections from observations of a standard star, namely HR 2058 in the H band and HD 20001 in the K band (2 data files).

  5. Novel metal-organic and supramolecular 3D frameworks constructed from flexible biphenyl-2,5,3‧-tricarboxylate blocks: Synthesis, structural features and properties

    Science.gov (United States)

    You, Ao; Li, Yu; Zhang, Ze-Min; Zou, Xun-Zhong; Gu, Jin-Zhong; Kirillov, Alexander M.; Chen, Jin-Wei; Chen, Yun-Bo

    2017-10-01

    Biphenyl-2,5,3‧-tricarboxylic acid (H3L) was selected as an unexplored tricarboxylate building block and applied for the hydrothermal synthesis of three novel coordination compounds, namely a 0D tetramer [Co4(HL)2(μ3-HL)2(phen)6(H2O)2]·3H2O (1) and two 3D metal-organic frameworks (MOFs) [Cd3(μ5-L)(μ6-L)(py)(μ-H2O)2(H2O)]n·H2O (2) and [Zn3(μ4-L)2(2,2‧-bpy)(μ-4,4‧-bpy)]n·2H2O (3). These products were easily generated in aqueous medium from the corresponding metal(II) chlorides, H3L, and various N-donor ancillary ligands, selected from 1,10-phenanthroline (phen), pyridine (py), 2,2‧-bipyridine (2,2‧-bpy), and 4,4‧-bipyridine (4,4‧-bpy). Compounds 1-3 were isolated as stable crystalline solids and were fully characterized by IR and UV-vis spectroscopy, elemental, thermogravimetric (TGA), powder (PXRD) and single-crystal X-ray diffraction analyses. Compound 1 possesses a discrete tetracobalt(II) structure, which is extended into a 3D H-bonded network with the pcu topology. In contrast, MOF 2 discloses a very complex trinodal 4,5,12-connected net with an undocumented topology, while MOF 3 features the nce/I topological framework. The magnetic (for 1) and luminescence (for 2 and 3) properties were also studied and discussed. The present study thus widens a still very limited family of metal-organic and supramolecular frameworks driven by flexible biphenyl-2,5,3‧-tricarboxylate building blocks.

  6. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  7. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  8. On the paleoenvironmental potential of 253 newly discovered pine stumps from Zurich, Switzerland

    Science.gov (United States)

    Reinig, Frederick; Nievergelt, Daniel; Esper, Jan; Friedrich, Michael; Helle, Gerhard; Hellmann, Lena; Kromer, Bernd; Morganti, Sandro; Pauly, Maren; Sookdeo, Adam; Tegel, Willy; Treydte, Kerstin; Wacker, Lukas; Büntgen, Ulf

    2017-04-01

    The transition from the last Ice Age to the early Holocene 15'000-10'000 BP represents a close natural analog to the ongoing and predicted rates of anthropogenic climate change. A reduced quality and quantity of high-resolution proxy archives during this period, however, limits our understanding of the magnitude and pace of Late Glacial (LG) environmental variability. Here, we present the world's best preserved, most replicated and oldest forest remains: A total of 253 subfossil pine stumps were recently discovered in Zurich. The combined approach of tree-ring and radiocarbon (14C) measurements results in an absolutely dated Preboreal Swiss tree-ring width chronology and eight floating chronologies. With tree ages ranging between 41 and 506 years, often including pith and bark, and a mean segment length of 163 years, this exceptional find is distributed over nearly 2'000 years between the Allerød and the Preboreal. Together with 200 previously collected LG pines from the greater Zurich region, this study sets a benchmark in terms of sample replication and dating precision for stable more dynamic climatic periods such as the Laacher See eruption, the Older and Younger Dryas. The paleoenvironmental significance would even increase when annually resolved 14C-measurements help fixing a major, Northern Hemispheric gap in the absolutely dated dendro time series during the Younger Dryas. While overcoming this interlude, our results further emphasize the importance of interdisciplinary research on these striking LG climatic shifts to better understand and assess their ecological and environmental impact.

  9. Correction to: Valuch, Tibor. “Following the Life Stories of Participants in the 1956 Hungarian Revolution.” Hungarian Cultural Studies. e-Journal of the American Hungarian Educators Association, Volume 9 (2016 DOI: 10.5195/ahea.2016.253

    Directory of Open Access Journals (Sweden)

    Tibor Valuch

    2017-09-01

    Full Text Available The dates next to the names of two interviewees, Imre Lázár and Zoltán Mervó, were shown incorrectly. The original article can be found via the DOI: http://dox.doi.org/10.5195/ahea.2016.253

  10. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  11. Definitive Brachytherapy for Kaposi's Sarcoma

    International Nuclear Information System (INIS)

    Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.

    1996-01-01

    Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness

  12. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  13. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  14. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium; Estudio de la oxidacion ciclica de los aceros inoxidables AISI 309 T 253 MA, con pequenas adiciones de Cerio

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)

    1998-12-31

    It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  15. Californium Cf-252 for pelvic radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J

    1978-01-01

    Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.

  16. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium

    International Nuclear Information System (INIS)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A.

    1998-01-01

    It has been detected that the addition of small amounts (<1%) of the so called 'reactive elements' such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  17. Neutron spectra from radionuclide sources for cardiac pacemakers

    International Nuclear Information System (INIS)

    Kluge, H.

    1975-01-01

    Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries

  18. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3.

    Science.gov (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C

    2015-11-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  20. Single-event burnout of power MOSFET devices for satellite application

    International Nuclear Information System (INIS)

    Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang

    2008-01-01

    Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)

  1. p.Ser252Trp and p.Pro253Arg mutations in FGFR2 gene causing Apert syndrome: the first clinical and molecular report of Indonesian patients.

    Science.gov (United States)

    Mundhofir, Farmaditya E P; Sistermans, Erik A; Faradz, Sultana M H; Hamel, Ben C J

    2013-03-01

    Apert syndrome (AS) is a rare autosomal dominant disorder characterised by craniosynostosis and limb malformations, and is associated with congenital heart disease and other systemic malformations, including intellectual disability. We report two Indonesian patients with AS, in whom molecular analysis detected p.Ser252Trp (c.755C>G) and p.Pro253Arg (c.758C>G) mutations in the fibroblast growth factor receptor 2 (FGFR2) gene, respectively. Although the syndrome has been frequently described, this is the first clinical report of AS confirmed by molecular analysis in Indonesia. The difference in severity of clinical features in the two patients may be consistent with a genotype-phenotype correlation of the FGFR2mutation. The management of individuals with AS is best achieved within a multidisciplinary setting. However, in most developing countries, early intervention may be delayed due to late diagnosis, a lack of facilities and financial constraints. This report underpins the benefits of early diagnosis for AS management.

  2. Radioactive materials production

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant

  3. Validation of the MCNP-DSP Monte Carlo code for calculating source-driven noise parameters of subcritical systems

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.

    1995-01-01

    This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code

  4. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.

    1984-01-01

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  5. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  6. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.

    1975-01-01

    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  7. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  8. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  9. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  10. Properties of neutron sources

    International Nuclear Information System (INIS)

    1987-03-01

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  11. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, S.M.; Stone, E.

    1976-01-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step

  12. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  13. Savannah River Plant californium-252 Shuffler electronics manual

    International Nuclear Information System (INIS)

    Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.

    1980-03-01

    Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included

  14. Savannah River Plant Californium-252 Shuffler software manual

    International Nuclear Information System (INIS)

    Johnson, S.S.; Crane, T.W.; Eccleston, G.W.

    1979-03-01

    A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined

  15. Acute kidney injury in a tropical country: a cohort study of 253 patients in an infectious diseases intensive care unit

    Directory of Open Access Journals (Sweden)

    Elizabeth De Fransceco Daher

    2014-01-01

    Full Text Available Introduction: Acute kidney injury (AKI is a frequent and potentially fatal complication in infectious diseases. The aim of this study was to investigate the clinical aspects of AKI associated with infectious diseases and the factors associated with mortality. Methods: This retrospective study was conducted in patients with AKI who were admitted to the intensive care unit (ICU of a tertiary infectious diseases hospital from January 2003 to January 2012. The major underlying diseases and clinical and laboratory findings were evaluated. Results: A total of 253 cases were included. The mean age was 46±16 years, and 72% of the patients were male. The main diseases were human immunodeficiency virus (HIV infection, HIV/acquired immunodeficiency syndrome (AIDS (30%, tuberculosis (12%, leptospirosis (11% and dengue (4%. Dialysis was performed in 70 cases (27.6%. The patients were classified as risk (4.4%, injury (63.6% or failure (32%. The time between AKI diagnosis and dialysis was 3.6±4.7 days. Oliguria was observed in 112 cases (45.7%. The Acute Physiology and Chronic Health Evaluation (APACHE II scores were higher in patients with HIV/AIDS (57±20, p-value=0.01 and dengue (68±11, p-value=0.01. Death occurred in 159 cases (62.8%. Mortality was higher in patients with HIV/AIDS (76.6%, p-value=0.02. A multivariate analysis identified the following independent risk factors for death: oliguria, metabolic acidosis, sepsis, hypovolemia, the need for vasoactive drugs, the need for mechanical ventilation and the APACHE II score. Conclusions: AKI is a common complication in infectious diseases, with high mortality. Mortality was higher in patients with HIV/AIDS, most likely due to the severity of immunosuppression and opportunistic diseases.

  16. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, C.M.; Stone, E.

    1976-06-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig

  17. Comparison of fluoroscopy-guided pull-type percutaneous radiological gastrostomy (pull-type-PRG) with conventional percutaneous radiological gastrostomy (push-type-PRG): clinical results in 253 patients

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B. [University Medical Center of the Johannes Gutenberg University Mainz, Department of Diagnostic and Interventional Radiology, Mainz (Germany)

    2011-11-15

    To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)

  18. Comparison of fluoroscopy-guided pull-type percutaneous radiological gastrostomy (pull-type-PRG) with conventional percutaneous radiological gastrostomy (push-type-PRG): clinical results in 253 patients

    International Nuclear Information System (INIS)

    Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B.

    2011-01-01

    To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)

  19. Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253

    Science.gov (United States)

    Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.; hide

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum

  20. The protective cell petrus for the production of californium 252; Cellule blindee petrus pour la production et l'etude du californium 252

    Energy Technology Data Exchange (ETDEWEB)

    Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)

  1. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    Provost-Grellier, A.

    1989-11-01

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr

  2. Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source

    Science.gov (United States)

    Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.

    2018-05-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.

  3. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  4. NWIS casting measurements taken during demonstrations to Russian visitors

    International Nuclear Information System (INIS)

    Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.

    1998-01-01

    This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)

  5. Health physics aspects of 252Cf

    International Nuclear Information System (INIS)

    Bhagwat, A.M.

    1974-01-01

    After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)

  6. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Permar, P.H.

    1975-01-01

    Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US

  7. Californium-252 interstitial implants in carcinoma of the tongue

    International Nuclear Information System (INIS)

    Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.

    1985-01-01

    A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy

  8. Undergraduate experiments using the neutron radiation from californium-252

    International Nuclear Information System (INIS)

    Rossel, J.; Golecki, I.

    1976-01-01

    Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)

  9. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  10. 7 CFR 1924.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... structural defect. (d) Structural defect. A defect in the dwelling or unit, installation or set-up of a unit... of the dwelling or unit or site such as faulty wiring, or failure of sewage disposal or water supply systems located on the property securing the loan caused by faulty materials or improper installation. (3...

  11. 50 CFR 253.20 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... work or investigative study, designed to acquire knowledge of fisheries resources and their habitat... the apportionment formula, which is equal to the price paid at the first point of landing. Volume...

  12. 50 CFR 253.15 - Miscellaneous.

    Science.gov (United States)

    2010-10-01

    ... due diligence investigation of every application it accepts and determine if, in the Division's sole... guarantee life. These must be conducted by competent and impartial inspectors acceptable to the Division...

  13. 40 CFR 265.253 - Containment.

    Science.gov (United States)

    2010-07-01

    ... maintain a run-off management system to collect and control at least the water volume resulting from a 24...: If collected leachate or run-off is discharged through a point source to waters of the United States, it is subject to the requirements of section 402 of the Clean Water Act, as amended.] [45 FR 33232...

  14. 50 CFR 253.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... less overutilized species than before; applying new technology; improving safety or fuel efficiency..., growth, productivity, or any other business attribute. Demand means a noteholder's request that the.... Wise use means the wise use of fisheries resources and their development, advancement, management...

  15. 7 CFR 25.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... participation and commitment of local governments, tribal governments, state governments, private sector... same as or different from the lead managing entity. Baseline condition means a measurable condition or... Appropriations Act, 1999 (Public Law 105-277). Round III identifies designations of empowerment zones pursuant to...

  16. 7 CFR 1901.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE..., sites, buildings, structures, and objects, significant in American history, architecture, archeology... significance in American History, Architecture, Archeology, and the culture is present in districts, sites...

  17. Method for measuring multiple scattering corrections between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov

    2016-07-21

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  18. Nuclear assay of coal. Volume 1. Coal composition by prompt neutron activation analysis: basic experiments. Final report

    International Nuclear Information System (INIS)

    Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses

  19. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  20. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    Sontag, R.; Berger, R.

    1967-01-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr

  1. Archeological Excavations at Two Prehistoric Campsites Near Keystone Dam, El Paso, Texas.

    Science.gov (United States)

    1985-07-19

    Flotacion Microdebitate Analysis 246 Groundstone Artifacts 253 Slab Metates 253 Manos 253 PesLIes 253 Groundstone Fragments 263 Anvils 263 Polishing...important new information to our understanding of local prehistory. The bulk ot O’LaugnliLn’s (1980) work in the area was directed toward the excavation...contains or summarizes the bulk of L111 ptiiaisiitd( iaci on iitnic artiract frequenCies irom El Paso ’Ir’Ia Sites. fhese data, along with those from the

  2. Dicty_cDB: Contig-U09533-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5

  3. Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket And Transcription Activation Through Tyrosine Expulsion

    Energy Technology Data Exchange (ETDEWEB)

    Newberry, K.J.; Huffman, J.L.; Miller, M.C.; Vazquez-Laslop, N.; Neyfakh, A.A.; Brennan, R.G.

    2009-05-22

    BmrR is a member of the MerR family and a multidrug binding transcription factor that up-regulates the expression of the bmr multidrug efflux transporter gene in response to myriad lipophilic cationic compounds. The structural mechanism by which BmrR binds these chemically and structurally different drugs and subsequently activates transcription is poorly understood. Here, we describe the crystal structures of BmrR bound to rhodamine 6G (R6G) or berberine (Ber) and cognate DNA. These structures reveal each drug stacks against multiple aromatic residues with their positive charges most proximal to the carboxylate group of Glu-253 and that, unlike other multidrug binding pockets, that of BmrR is rigid. Substitution of Glu-253 with either alanine (E253A) or glutamine (E253Q) results in unpredictable binding affinities for R6G, Ber, and tetraphenylphosphonium. Moreover, these drug binding studies reveal that the negative charge of Glu-253 is not important for high affinity binding to Ber and tetraphenylphosphonium but plays a more significant, but unpredictable, role in R6G binding. In vitro transcription data show that E253A and E253Q are constitutively active, and structures of the drug-free E253A-DNA and E253Q-DNA complexes support a transcription activation mechanism requiring the expulsion of Tyr-152 from the multidrug binding pocket. In sum, these data delineate the mechanism by which BmrR binds lipophilic, monovalent cationic compounds and suggest the importance of the redundant negative electrostatic nature of this rigid drug binding pocket that can be used to discriminate against molecules that are not substrates of the Bmr multidrug efflux pump.

  4. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  5. Determination of the relative power density distribution in a heterogeneous reactor from the results of measurements of the reactivity effects and the neutron importance function

    International Nuclear Information System (INIS)

    Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.

    2012-01-01

    A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.

  6. 1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.

    Science.gov (United States)

    Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S

    2015-04-01

    Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. 50 CFR 253.11 - Guarantee policy.

    Science.gov (United States)

    2010-10-01

    ... inconsistent with wise use, but financing it may be. (2) Vessel refurbishing that materially increases an... financed (or otherwise paid). Refinancing this project cost is not inconsistent with wise use, but financing it may be. (3) Purchasing a used vessel or used fishery facility. The Program will neither finance...

  8. 33 CFR 117.253 - Anacostia River.

    Science.gov (United States)

    2010-07-01

    ... for public vessels of the United States, state and local government vessels, commercial vessels and... sensors, laser scanners, video cameras or marine-radio communications, In these situations, a bridge... condition two board gauges painted white with black figures not less than six inches high to indicate the...

  9. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... been towards focalization, subsidies on demand, decentralization and privatization. ... Each year, Moroccans use nearly 70% of their annual recoverable water supply ... Adapting fishing policies to address climate change in West Africa.

  10. 17 CFR 230.253 - Offering circular.

    Science.gov (United States)

    2010-04-01

    .... Repetition of information should be avoided; cross-referencing of information within the document is... COMPLETENESS OF ANY OFFERING CIRCULAR OR OTHER SELLING LITERATURE. THESE SECURITIES ARE OFFERED PURSUANT TO AN...

  11. 14 CFR 93.253 - Nonstop operations.

    Science.gov (United States)

    2010-01-01

    ... AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES Ronald Reagan Washington National Airport... between Ronald Reagan Washington National Airport and another airport that is more than 1,250 miles away from Ronald Reagan Washington National Airport. ...

  12. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... Metropolitan Council of Borno State, Nigeria. * A. Iliyasu, I. ... processing and determine the return on investment in groundnut processing in the study area. Structured ... It was recommended that large scale groundnut production should be encouraged .... increasing rate, increases at decreasing rate and.

  13. H:\\PMKER 25(3)\\HALA.xps

    African Journals Online (AJOL)

    AISA

    plus fréquemment utilisées contre les cochenilles appartiennent au groupe des organophosphorés. Le chlorpyrifos-éthyl a montré une bonne efficacité comparativement aux pyréthrinoïdes tels que la bifenthrine et la lamdacyhalothrine (Dembélé, 2001). Toutes les formulations à base de chlorpyriphos- éthyl (Dursban 4 E, ...

  14. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ... intermediate care services) under conditions similar to those described in section 1861(v)(1)(G) of the Act... agency determines appropriate, of payment rates. (f) Uniform cost reporting. The Medicaid agency must... Medicaid agency must provide for periodic audits of the financial and statistical records of participating...

  15. Spectrum-averaged cross-section measurement of /sup 103/Rh(n,n)/sup 103m/Rh in the /sup 252/Cf fission neutron spectrum

    International Nuclear Information System (INIS)

    Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.

    1988-01-01

    Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given

  16. Use of californium-252 sources in Hungary for teaching and research

    International Nuclear Information System (INIS)

    Csikai, J.

    1976-01-01

    An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)

  17. Format Guide for Scientific and Technical Reports.

    Science.gov (United States)

    1984-01-01

    supported by the discussion. Graphkic Services The Graphic Services Section (Code 2632) provides a variety of layout and design services. Camera-ready artwork...complex typography , elaborate graphic elements, extensive computer printouts, and other unusual materials that explain the project. With few exceptions...2630 Publications Branch Office 222/253 72379 S Publications Control Center 222/253 73508 Editorial 222/253 72782 Graphic Services 222/234 72756 73989

  18. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-01-01

    This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field

  19. Development of a transportable neutron radiography system for non-destructive tests application

    International Nuclear Information System (INIS)

    Silva, Ademir X. da; Crispim, Verginia R.

    1999-01-01

    This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)

  20. Neutron crosstalk between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov

    2015-09-11

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.

  1. Neutron crosstalk between liquid scintillators

    International Nuclear Information System (INIS)

    Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.

    2015-01-01

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction

  2. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  3. Determination of alpha activity and fissile mass content in solid waste by systems using neutron interrogation

    International Nuclear Information System (INIS)

    Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.

    1990-01-01

    The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)

  4. Beam test of a grid-less multi-harmonic buncher

    International Nuclear Information System (INIS)

    Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.

    2008-01-01

    The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.

  5. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  6. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  7. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  8. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  9. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    International Nuclear Information System (INIS)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.

    2013-01-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement

  10. Regulation of the Incorporation of Tissue Factor into Microparticles by Serine Phosphorylation of the Cytoplasmic Domain of Tissue Factor*

    Science.gov (United States)

    Collier, Mary E. W.; Ettelaie, Camille

    2011-01-01

    The mechanisms that regulate the incorporation and release of tissue factors (TFs) into cell-derived microparticles are as yet unidentified. In this study, we have explored the regulation of TF release into microparticles by the phosphorylation of serine residues within the cytoplasmic domain of TF. Wild-type and mutant forms of TF, containing alanine and aspartate substitutions at Ser253 and Ser258, were overexpressed in coronary artery and dermal microvascular endothelial cells and microparticle release stimulated with PAR2 agonist peptide (PAR2-AP). The release of TF antigen and activity was then monitored. In addition, the phosphorylation state of the two serine residues within the released microparticles and the cells was monitored for 150 min. The release of wild-type TF as procoagulant microparticles peaked at 90 min and declined thereafter in both cell types. The TF within these microparticles was phosphorylated at Ser253 but not at Ser258. Aspartate substitution of Ser253 resulted in rapid release of TF antigen but not activity, whereas TF release was reduced and delayed by alanine substitution of Ser253 or aspartate substitution of Ser258. Alanine substitution of Ser258 prolonged the release of TF following PAR2-AP activation. The release of TF was concurrent with phosphorylation of Ser253 and was followed by dephosphorylation at 120 min and phosphorylation of Ser258. We propose a sequential mechanism in which the phosphorylation of Ser253 through PAR2 activation results in the incorporation of TF into microparticles, simultaneously inducing Ser258 phosphorylation. Phosphorylation of Ser258 in turn promotes the dephosphorylation of Ser253 and suppresses the release of TF. PMID:21310953

  11. Active sites engineering of metal-organic frameworks for heterogeneous catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xinle [Iowa State Univ., Ames, IA (United States)

    2016-12-17

    In conclusion, we have for the first time developed a novel solid base catalyst, Ndoped MOF-253 derived porous carbons (Cz-MOF-253). Cz-MOF-253 is highly porous and exhibit high efficiency in Knoevenagel condensation reaction. Furthermore, Cz-MOF-253 is robust and can be reused up to five times. In comparison, the analogous nitrogen-free catalyst-Cz-DUT-5, and other nitrogen- MOFs derived carbon showed an inferior performance. Moreover, the high basicity and porous nature enable the design of bifunctional catalyst and facilitate tandem condensation-hydrogenation reactions. This work delineates the first attempt that demonstrates MOF-derived carbons as solid base catalyst and its potential application in tandem catalysis. Future work on exploring new catalytic reactions based on such porous Lewis basic MOF-derived carbons is currently underway.

  12. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  13. Alternative irradiation system for efficiency manganese bath determination

    Energy Technology Data Exchange (ETDEWEB)

    Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)

    2010-12-15

    An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.

  14. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Britt, H.C.

    1980-01-01

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  15. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  16. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-10-01

    The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field

  17. Vaginal Yeast Infections

    Science.gov (United States)

    ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ...

  18. H:\\PMKER 25(3)\\EGAH J..xps

    African Journals Online (AJOL)

    AISA

    de réponses ne favorisent que certaines variétés, laissant presqu'entière la question de la conservation de la biodiversité .... biodiversité de l'igname surtout que son système semencier en ...... framework for valuing on-farm genetic resources.

  19. 7 CFR 253.5 - State agency requirements.

    Science.gov (United States)

    2010-01-01

    ... Federal, State, or local laws, including, but not limited to, laws relating to taxation, welfare, and... advance of the meeting. FNS shall schedule and conduct the meeting and make a decision within 60 days of...

  20. 24 CFR 960.253 - Choice of rent.

    Science.gov (United States)

    2010-04-01

    ... section. Except for financial hardship cases as provided in paragraph (d) of this section, the family may... on the market rent charged for comparable units in the private unassisted rental market. It is equal... determine the flat rent, the PHA must consider: (i) The location, quality, size, unit type and age of the...

  1. H:\\PMKER 25(3)\\ZEZE A..xps

    African Journals Online (AJOL)

    AISA

    préalablement stérilisé à l'autoclave (110 °C,. 2 kg/cm2, 3h) et 150 g de sol de chaque échantillon servant d'inoculum (2 plants par pot). Après 75 jours de culture, 50 g de sols de chaque échantillon séché à l'air libre est utilisé pour extraire les spores selon la méthode de tamisage humide (Gerdemann et Nicolson,. 1963).

  2. 32 CFR 253.1 - Reissuance and purpose.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS ASSIGNMENT OF AMERICAN NATIONAL RED CROSS AND UNITED SERVICE ORGANIZATIONS, INC., EMPLOYEES TO...”) employees and United Service Organizations, Inc. (USO), staff for the purpose of determining the security acceptability of such personnel for assignment to duty with the Military Services. ...

  3. H:\\PMKER 25(3)\\TRAORE K..xps

    African Journals Online (AJOL)

    AISA

    Laboratoire de Phytopathologie de la Faculté d'Agronomie de l'Université de Parakou (Bénin) pour confirmer ou non la présence des trois virus responsables de maladies chez les Solanaceae à savoir le CMV, le PVMV et le PVYN. Des tampons ont été préparés conformément aux directives de Clarck et al. (1977), il s'agit.

  4. 7 CFR 253.7 - Certification of households.

    Science.gov (United States)

    2010-01-01

    ... savings accounts, savings certificates, stocks, or bonds, or other readily negotiable instruments exceeds... duration of the disqualification (that is, 12 months; 24 months; or permanent). The State agency must also... agency conference. (Approved by the Office of Management and Budget under control number 0584-0071) (44 U...

  5. 7 CFR 253.6 - Eligibility of households.

    Science.gov (United States)

    2010-01-01

    ... resources of a household, only cash on hand, money in checking or savings accounts, savings certificates..., such as a Keogh plan or an Individual Retirement Account (IRA), as long as the funds remain in the... course would be excluded. However, transportation, supplies, and textbook expenses are not uniformly...

  6. 40 CFR 98.253 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... (metric tons/year). NCD = Number of atmospheric crude oil distillation columns at the facility. NPU1... = Methane emission rate from blowdown systems (mt CH4/year). QRef = Quantity of crude oil plus the quantity...) For storage tanks other than those processing unstabilized crude oil, you must either calculate CH4...

  7. H:\\PMKER 25(3)\\BEUGRE F..xps

    African Journals Online (AJOL)

    AISA

    nodules and permitted the application of the herbicide, better development of soybean plants. Herbicide ... négative sur les micro-organismes du sol, en particulier, sur les .... différences significatives entre les traitements sont apparus à partir de 45e jour après le semis. (JAS), et ce, jusqu'au 90e JAS. En effet, pendant ...

  8. H:\\PMKER 25(3)\\NOUATIN G..xps

    African Journals Online (AJOL)

    AISA

    Les institutions de micro finance, de part leur importance dans la réduction de la pauvreté dans les pays en développement, sont de plus en plus au centre des préoccupations aussi bien des politiques que des scientifiques. Au Bénin on compte ... En effet, il existe relativement peu d'analyses d'impact de programmes de ...

  9. 40 CFR 25.3 - Policy and objectives.

    Science.gov (United States)

    2010-07-01

    ... governmental and educational associations. (b) Public participation is that part of the decision-making process... the decision-making process, seeking input from and conducting dialogue with the public, assimilating... considered by the decision-making official. Disagreement on significant issues is to be expected among...

  10. 42 CFR 403.253 - Calculation of benefits.

    Science.gov (United States)

    2010-10-01

    ... the gross premiums are computed to provide coverage. (iv) Reserve for future contingent benefits means... the loss ratio calculation period. (iii) Net premium means the level portion of the gross premium used... period, to— (B) The total policy reserve at the last day of the loss ratio calculation period: and (ii...

  11. H:\\PMKER 25(3)\\BRAHIM I..xps

    African Journals Online (AJOL)

    AISA

    ordinateur. Au cours de ces dictées d'enregistrement de compor- tement et pour chaque femelle, sept paramètres ont été relevés et enregistrés à l'ordinateur : - durée de marche sans balayage (en sec) : pendant laquelle la femelle se déplace sur les.

  12. 20 CFR 632.253 - Special operating provisions.

    Science.gov (United States)

    2010-04-01

    ...; (c) Provide labor market orientation to participants. This orientation may include, as appropriate: vocational exposure, counseling, testing, resume preparation, job interview preparation, providing labor... labor market orientation, skill training and remedial education, each grantee shall make maximum efforts...

  13. Californium-252 neutron activation analysis of high-level processed nuclear tank waste

    International Nuclear Information System (INIS)

    Troyer, G.L.; Purcell, M.A.

    2000-01-01

    The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments

  14. Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas

    International Nuclear Information System (INIS)

    Maruyama, J.; Beach, J.L.; Nagell, J.R. van

    1984-01-01

    Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de

  15. MYT1L mutations cause intellectual disability and variable obesity by dysregulating gene expression and development of the neuroendocrine hypothalamus

    OpenAIRE

    Blanchet, P.; Bebin, M.; Bruet, S,; Cooper, G.M.; Thompson, M.L.; Duban-Bedu, B.; Gerard, B.; Piton, A.; Suckno, S.; Deshpande, C.; Clowes, V.; Vogt, J.; Turnpenny, P.; Williamson, M.P.; Alembik, Y.

    2017-01-01

    Deletions at chromosome 2p25.3 are associated with a syndrome consisting of intellectual disability and obesity. The smallest region of overlap for deletions at 2p25.3 contains PXDN and MYT1L. MYT1L is expressed only within the brain in humans. We hypothesized that single nucleotide variants (SNVs) in MYT1L would cause a phenotype resembling deletion at 2p25.3. To examine this we sought MYT1L SNVs in exome sequencing data from 4, 296 parent-child trios. Further variants were identified throug...

  16. Inflation expectations in the Czech interbank market

    Czech Academy of Sciences Publication Activity Database

    Fukač, Martin

    -, č. 253 (2005), s. 1-30 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : inflation expectations * nominal interest rate * Fisher rule Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp253.pdf

  17. 78 FR 1220 - Agency Information Collection Activities: Guarantee of Payment

    Science.gov (United States)

    2013-01-08

    .... Abstract: Section 253 of the Immigration and Nationality Act (INA) requires that an alien crewman found to... provided for by 8 CFR 253.1 and is accessible at: http://forms.cbp.gov/pdf/CBP_Form_i510.pdf . Action: CBP...

  18. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    Simmons, C.M.

    2000-01-01

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  19. Physical-chemical studies of transuranium elements: Progress report for the period April 1, 1985-March 31, 1988

    International Nuclear Information System (INIS)

    Peterson, J.R.

    1987-01-01

    New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides

  20. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.

    1982-01-01

    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  1. Fabrication of 50-mg 252Cf neutron sources for the FDA [Food and Drug Administration] activation analysis facility

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.

    1987-01-01

    The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing

  2. 4-Chloro-N-(3,4,5-trimethoxybenzylidene)aniline

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Asghari, J.; Fejfarová, Karla; Dušek, Michal

    2009-01-01

    Roč. 65, - (2009), o253-o253 ISSN 1600-5368 R&D Projects: GA ČR GC202/07/J008 Institutional research plan: CEZ:AV0Z10100521 Keywords : X-ray diffraction * Jana 2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.411, year: 2009

  3. Determination of the average number of neutrons per fission event for californium-252

    International Nuclear Information System (INIS)

    Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.

    1982-01-01

    By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)

  4. Chromatographic cation exchange separation of decigram quantities of californium and other transplutonium elements

    Energy Technology Data Exchange (ETDEWEB)

    Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.

    1980-01-01

    Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.

  5. A molecular line survey toward the nearby galaxies NGC 1068, NGC 253, and IC 342 at 3 mm with the Nobeyama 45 m radio telescope: Impact of an AGN on 1 kpc scale molecular abundances

    Science.gov (United States)

    Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric

    2018-01-01

    It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.

  6. p38α phosphorylates serine 258 within the cytoplasmic domain of tissue factor and prevents its incorporation into cell-derived microparticles.

    Science.gov (United States)

    Ettelaie, Camille; Elkeeb, Azza M; Maraveyas, Anthony; Collier, Mary Elizabeth W

    2013-03-01

    We previously showed that the phosphorylation of Ser253 within the cytoplasmic domain of human tissue factor (TF) initiates the incorporation and release of this protein into cell-derived microparticles. Furthermore, subsequent phosphorylation of Ser258 terminates this process. However, the identity of the kinase responsible for the phosphorylation of Ser258 and mode of action of this enzyme remain unknown. In this study, p38α was identified as the proline-directed kinase capable of phosphorylating Ser258 specifically, and without any detectable activity towards Ser253. Furthermore, using synthetic peptides, it was shown that the Km for the reaction decreased by approximately 10 fold on substitution of Ser253 with phospho-Ser253. Either inhibition of p38 using SB202190 or knockdown of p38α expression in coronary artery endothelial cells overexpressing wild-type TF, resulted in decreased phosphorylation of Ser258, following activation of cells with PAR2-agonist peptide (PAR2-AP). In agreement with our previous data, inhibition of phosphorylation of this residue maintained the release of TF. Activation of PAR2 in cells transfected to overexpress TF, resulted in two separate peaks of p38 activity at approximately 40 and 120 min post-activation. Furthermore, overexpression of Ala253-substituted TF enhanced the second p38 activation peak. However, the second peak was absent in cells devoid of TF or in cells overexpressing the Asp253-substituted TF. Our data clearly identifies p38α as a kinase capable of phosphorylating Ser258 within the cytoplasmic domain of TF. Moreover, it appears that the presence of TF within the cells regulates the late activation of p38 and consequently the termination of TF release into microparticles. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  8. 24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.

    Science.gov (United States)

    2010-04-01

    .... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...

  9. A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Masson

    Full Text Available Idiopathic chronic pancreatitis (ICP has traditionally been defined as chronic pancreatitis in the absence of any obvious precipitating factors (e.g. alcohol abuse and family history of the disease. Studies over the past 15 years have revealed that ICP has a highly complex genetic architecture involving multiple gene loci. Here, we have attempted to provide a conservative assessment of the major genetic causes of ICP in a sample of 253 young French ICP patients. For the first time, conventional types of mutation (comprising coding sequence variants and variants at intron/exon boundaries and gross genomic rearrangements were screened for in all four major pancreatitis genes, PRSS1, SPINK1, CTRC and CFTR. For the purposes of the study, synonymous, intronic and 5'- or 3'-untranslated region variants were excluded from the analysis except where there was persuasive evidence of functional consequences. The remaining sequence variants/genotypes were classified into causative, contributory or neutral categories by consideration of (i their allele frequencies in patient and normal control populations, (ii their presumed or experimentally confirmed functional effects, (iii the relative importance of their associated genes in the pathogenesis of chronic pancreatitis and (iv gene-gene interactions wherever applicable. Adoption of this strategy allowed us to assess the pathogenic relevance of specific variants/genotypes to their respective carriers to an unprecedented degree. The genetic cause of ICP could be assigned in 23.7% of individuals in the study group. A strong genetic susceptibility factor was also present in an additional 24.5% of cases. Taken together, up to 48.2% of the studied ICP patients were found to display evidence of a genetic basis for their pancreatitis. Whereas these particular proportions may not be extrapolable to all ICP patients, the approach employed should serve as a useful framework for acquiring a better understanding of the

  10. Dicty_cDB: CFG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  11. 40 CFR 180.253 - Methomyl; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., grain 1 Oat, hay 10 Oat, straw 10 Onion, green 3 Orange, sweet 2 Parsley, leaves 6 Pea 5 Pea, field...), kale, lettuce, mustard greens, parsley, spinach, Swiss chard, turnip, greens (tops), and watercress] 0...

  12. 7 CFR 765.253 - Ceasing to operate security.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-REGULAR Required Use and Operation of Agency Security § 765... reside in the immediate farming community for reasonable management and operation involvement; (2) The... reside in the immediate farming community for reasonable management and operation involvement; or (3) The...

  13. Dicty_cDB: SLA253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTATS*i*sknifyqvslq**f****yqkmilkipf fsl*fln*i*nk*kkkknl Translated Amino Acid s...GMPLQLGYGANGKNGDNGISVWLIYGYTIVDINCNIRPIITAA TIATTTAATTTATTTATTATTTATTTATS*i*sknifyqvslq**f****yqkmilkipf fsl

  14. Dicty_cDB: CHJ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dkeklakkaaeglknakntassyasgin askdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkf...igflalgv fglfawkfyegkkykeneqklikqkh*kk--- ---slyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyax ginaskdqlnsnfknike

  15. H:\\PMKER 25(3)\\NGORAN K. E..xps

    African Journals Online (AJOL)

    AISA

    'étable. Comparison of cowshed milk contamination respect with the months. GAM = Germes aérobies mésophiles, CT = Coliformes totaux, CF = Coliformes fécaux,. GAM = Aerobic mesophlile germ, CT = Total coliform, CF = fecal coliform.

  16. SDS-PAGE analysis of high molecular weight glutenin subunits in SP3 from spaceflight carried wheat

    International Nuclear Information System (INIS)

    Zhang Su'na; Lv Jinyin

    2009-01-01

    The compositions of high molecular weight glutenin subunits (HMW-GS) of the third generation (SP 3 ) of two wheat varieties spaceflight carried were analyzed by SDS-PAGE. The quality score of Glu-1 of each site was calculated according to the quality rating system. The results showed that the space flight carried could result in a higher frequency of HMW-GS gene mutation. The variance frequency of HMW-GS in SP 3 of Shaan253 and Xinong1043 were 27.08% and 27.45%, and the quality score in SP 3 of Shaan253 and Xinong1043 were 7 and 6, respectively. Shaan253 SP 3 generation mutants were considered as high-quality wheat. (authors)

  17. Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)

    1971-04-15

    Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps

  18. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    John, J.

    1979-01-01

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  19. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  20. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  1. Designing on-line analyzer for coal on belt conveyor using neutron activation technique

    International Nuclear Information System (INIS)

    Rony Djokorayono; Agus Cahyono

    2014-01-01

    Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)

  2. Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report

    International Nuclear Information System (INIS)

    Lagarias, J.; Irminger, P.; Dodson, W.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station

  3. Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix

    International Nuclear Information System (INIS)

    Zaborowski, Henrick.

    1981-11-01

    From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr

  4. The CARIBU EBIS control and synchronization system

    Energy Technology Data Exchange (ETDEWEB)

    Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  5. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  6. Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology

    International Nuclear Information System (INIS)

    Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry

    2012-01-01

    This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)

  7. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  8. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  9. Protein interactions with quaternized chitosan/heparin multilayers

    Czech Academy of Sciences Publication Activity Database

    Kumorek, Marta M.; Kubies, Dana; Riedel, Tomáš

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S253-S261 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : heparin * chitosan * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S253.pdf

  10. Musik som analogi og metafor

    DEFF Research Database (Denmark)

    Bonde, Lars Ole

    2014-01-01

    Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...

  11. 40 CFR 52.2370 - Identification of plan.

    Science.gov (United States)

    2010-07-01

    ... Radiation Docket and Information Center, Air Docket (Mail Code 6102T), Room B-108, 1301 Constitution Avenue... nuisance and odor 01/25/78 12/21/78, 43 FR 59496 Section 5-251 Control of nitrogen oxides emissions 01/04... FR 19825 Section 5-253.3 Bulk gasoline plants 10/29/92 04/22/98, 63 FR 19825 Section 5-253.4 Gasoline...

  12. 数字解读(英文)

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    253 Million Internet Users vs 46.4 Percent of Women Netizens China Internet Network Information Center(CNNIC) recently issued its 22nd Statistical Survey Report on Internet Development in China. The report indicated China had 253 million Internet users by the end of June 2008, up 56.2 percent over the previous year.For the first time in China's history,the Internet

  13. An Exponential Stability Result of a Timoshenko System with Thermoelasticity with Second Sound and in the Presence of Delay

    Energy Technology Data Exchange (ETDEWEB)

    Apalara, Tijani A., E-mail: tijani@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Affiliated Colleges at Hafr Al-Batin, General Science and Studies Unit-Mathematics (Saudi Arabia); Messaoudi, Salim A., E-mail: messaoud@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Department of Mathematics and Statistics (Saudi Arabia)

    2015-06-15

    In this paper, we consider a one-dimensional linear thermoelastic system of Timoshenko type with a delay, where the heat flux is given by Cattaneo’s law. We prove an exponential decay result under a smallness condition on the delay and a stability number introduced first in Santos et al. (J Diff Eqs 253:2715–2733, 2012), using a method different from that of Santos et al. (J Diff Eqs 253:2715–2733, 2012). We also reproduce the polynomial decay of Santos et al. (J Diff Eqs 253:2715–2733, 2012) using the multiplier method in the case of absence of delay. The polynomial decay issue in the presence of a small delay is an open question.

  14. Aiding and Abetting: The Responsibility of Business Leaders under the Rome Statute of the International Criminal Court

    Directory of Open Access Journals (Sweden)

    Caspar Plomp

    2014-08-01

    Full Text Available While no business leaders have yet been charged before the International Criminal Court (ICC, such future proceedings will typically be conducted with reference to the accessorial mode of liability of aiding and abetting, under Article 25(3(c of the Rome Statute of the ICC. There exist diverse and competing interpretations of Article 25(3(c. This paper aims to advocate the creation of a dominant interpretation of Article 25(3(c and, consequently, to the clarification of the potential responsibility of business leaders who aid or abet crimes under the jurisdiction of the Rome Statute, in two ways. First, it asks whether Article 25(3(c can be interpreted in harmony with the dominant practice on aiding and abetting in international criminal law generally. Second, it presents a case study on the provision of arms by the Russian corporation Rosoboronexport to the Syrian government, which is likely to have committed crimes against humanity since March 2011 and war crimes since mid-2012. The theoretical conclusions are applied to a discussion on the potential criminal responsibility of the Director General of Rosoboronexport for aiding and abetting the commission of international crimes by high-level Syrian officials.

  15. MASSIVE PROTOPLANETARY DISKS IN ORION BEYOND THE TRAPEZIUM CLUSTER

    International Nuclear Information System (INIS)

    Mann, Rita K.; Williams, Jonathan P.

    2009-01-01

    We present Submillimeter Array 1 The Submillimeter Array is a joint project between the Submillimeter Astrophysical Observatory and the Academica Sinica Institute of Astronomy and Astrophysics and is funded by the Smithsonian Institution and the Academica Sinica. observations of the 880 μm continuum emission from three circumstellar disks around young stars in Orion that lie several arcminutes (∼> 1 pc) north of the Trapezium cluster. Two of the three disks are in the binary system 253-1536. Silhouette disks 216-0939 and 253-1536a are found to be more massive than any previously observed Orion disks, with dust masses derived from their submillimeter emission of 0.045 M sun and 0.066 M sun , respectively. The existence of these massive disks reveals that the disk mass distribution in Orion does extend to high masses, and that the truncation observed in the central Trapezium cluster is a result of photoevaporation due to the proximity of O-stars. 253-1536b has a disk mass of 0.018 M sun , making the 253-1536 system the first optical binary in which each protoplanetary disk is massive enough to potentially form solar systems.

  16. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  17. Palladium complexes of pyrrole-2-aldehyde thiosemicarbazone ...

    Indian Academy of Sciences (India)

    Chem. Rev. 253 1384; (j) Lobana T S, Sharma. R, Bawa G and Khanna S 2009 Coord. Chem. Rev. 253. 977; (k) Quiroga A G and Ranninger C N 2004 Coord. Chem. Rev. 248 119; (l) Dilworth J R, Arnold P, Morales. D, Wong Y L and Zheng Y 2002 Modern Coord. Chem. 217; (m) West D X, Liberta A E, Padhye S B, Chikate.

  18. 1,25D3 differentially suppresses bladder cancer cell migration and invasion through the induction of miR-101-3p.

    Science.gov (United States)

    Ma, Yingyu; Luo, Wei; Bunch, Brittany L; Pratt, Rachel N; Trump, Donald L; Johnson, Candace S

    2017-09-01

    Metastasis is the major cause of bladder cancer death. 1,25D 3 , the active metabolite of vitamin D, has shown anti-metastasis activity in several cancer model systems. However, the role of 1,25D 3 in migration and invasion in bladder cancer is unknown. To investigate whether 1,25D 3 affects migration and invasion, four human bladder cell lines with different reported invasiveness were selected: low-invasive T24 and 253J cells and highly invasive 253J-BV and TCCSUP cells. All of the four bladder cancer cells express endogenous and inducible vitamin D receptor (VDR) as examined by immunoblot analysis. 1,25D 3 had no effect on the proliferation of bladder cancer cells as assessed by MTT assay. In contrast, 1,25D 3 suppressed migration and invasion in the more invasive 253J-BV and TCCSUP cells, but not in the low-invasive 253J and T24 cells using "wound" healing, chemotactic migration and Matrigel-based invasion assays. 1,25D 3 promoted the expression of miR-101-3p and miR-126-3p in 253J-BV cells as examined by qRT-PCR. miR-101-3p inhibitor partially abrogated and pre-miR-101-3p further suppressed the inhibition of 1,25D 3 on migration and invasion in 253J-BV cells. Further, 1,25D 3 enhanced VDR recruitment to the promoter region of miR-101-3p using ChIP-qPCR assay. 1,25D 3 enhanced the promoter activity of miR-101-3p as evaluated by luciferase reporter assay. Taken together, 1,25D 3 suppresses bladder cancer cell migration and invasion in two invasive/migration competent lines but not in two less invasive/motile lines, which is partially through the induction of miR-101-3p expression at the transcriptional level.

  19. Utilization of radiation facilities at TNRC for shielding researches and related topics

    Energy Technology Data Exchange (ETDEWEB)

    Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)

    1997-12-31

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.

  20. Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures

    International Nuclear Information System (INIS)

    Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.

    2002-01-01

    Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character

  1. Transuranic biokinetic parameters for marine invertebrates--a review.

    Science.gov (United States)

    Ryan, T P

    2002-04-01

    A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.

  2. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  3. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Science.gov (United States)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.

    2016-02-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  4. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    Rabold, D.E.

    1996-01-01

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  5. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  6. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    Bringer, O.

    2007-10-01

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  7. Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field

    International Nuclear Information System (INIS)

    Mannhart, W.

    1979-01-01

    The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables

  8. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  9. DDN (Defence Data Network) Protocol Implementations and Vendors Guide

    Science.gov (United States)

    1988-08-01

    Artificial Intelligence Laboratory Room NE43-723 545 Technology Square Cambridge, MA 02139 (617) 253-8843 S John Wroclawski, (JTW@AI.AJ.MIT.EDU...Massachusetts Institute of Technology Artificial Intelligence Laboratory Room NE43-743 545 Technology Square 0 Cambridge, MA 02139 (617) 253-7885 ORDERING...TCP/IP Network Software for PC-DOS Systems CPU: IBM-PC/XT/AT/compatible in conjunction with EXOS 205 Inteligent Ethernet Controller for PCbus 0/s

  10. Complexes of membrane-associated gamma-tubulin with Fyn kinase and phosphoinositide 3-kinase in differentiating cells

    Czech Academy of Sciences Publication Activity Database

    Sulimenko, Vadym; Macůrek, Libor; Dráberová, Eduarda; Richterová, Věra; Sulimenko, Tetyana; Dráberová, Lubica; Marková, Vladimíra; Dráber, Pavel

    2009-01-01

    Roč. 276, č. 1 (2009), s. 253-253 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA MŠk 1M0506; GA MŠk LC545; GA ČR GA204/05/2375; GA ČR GA304/04/1273 Institutional research plan: CEZ:AV0Z50520514 Keywords : detergent -resistant membrane * Fyn * PI3K gamma-tubulin Subject RIV: EB - Genetics ; Molecular Biology

  11. Acute Cannabis Intoxication and the Brain's Response to Visual Erotica: An Fmri Study

    Czech Academy of Sciences Publication Activity Database

    Androvičová, R.; Horáček, J.; Tintěra, J.; Rydlo, J.; Ježová, D.; Balíková, M.; Hložek, T.; Mikšátková, P.; Kuchař, M.; Hlinka, Jaroslav; Roman, M.; Tomíček, P.; Viktorínová, M.; Tylš, F.; Páleníček, T.

    2017-01-01

    Roč. 14, č. 5 (2017), e253-e253 ISSN 1743-6095. [Congress of the World Association for Sexual Health /23./. 28.05.2017-31.05.2017, Prague] Grant - others:GA MV(CZ) VG20122015080; GA MZd NT13145; GA MŠk(CZ) LO1611 Institutional support: RVO:67985807 Keywords : fMRI * cannabis * sexuality Subject RIV: FH - Neurology http://www.jsm.jsexmed.org/article/S1743-6095(17)30689-6/pdf

  12. Speed of sound in saturated aliphatic alcohols (propan-2-ol, butan-2-ol, and 2-methylpropan-1-ol) and alkanediols (ethane-1,2-diol, propane-1,2- and -1,3-diol) at temperature between 253.15 K and 353.15 K and pressures up to 30 MPa

    International Nuclear Information System (INIS)

    Dávila, María J.; Gedanitz, Holger; Span, Roland

    2016-01-01

    Highlights: • Speed of sound measurements were made in aliphatic alcohols and alkanediols. • Speeds of sound were measured in a wide temperature and pressure range. • A pulse-echo method with a double path type sensor operating at 8 MHz was employed. • A double polynomial equation was used to fit the experimental speed of sound data. • The accurate results were compared with available literature sources. - Abstract: Speeds of sound have been measured in three saturated aliphatic alcohols (propan-2-ol, butan-2-ol, and 2-methylpropan-1-ol) and three alkanediols (ethane-1,2-diol, propane-1,2- and -1,3-diol) in the temperature range from (253.15 to 353.15) K and pressures up to 30 MPa by use of a pulse-echo method with a double path type sensor operating at 8 MHz. The expanded overall uncertainties (k = 2) in the speed of sound measurements are estimated to be 0.013% for propan-2-ol, 0.019% for butan-2-ol, 0.01% for 2-methylpropan-1-ol, 0.009% for ethane-1,2-diol, 0.02% for propane-1,2-diol, and 0.07% for propane-1,3-diol. Experimental speeds of sound data were correlated with the temperature and pressure with an empirical double polynomial equation. Our results were also compared with the available literature data and a satisfactory agreement was found.

  13. 37 CFR 253.7 - Recording rights, rates and terms.

    Science.gov (United States)

    2010-07-01

    ...-distributed program, the royalty fees shall be calculated by multiplying the following per-composition rates... royalty fee shall be calculated by multiplying the following per-composition rates by the number of... royalty fees shall be calculated by multiplying the following per-composition rates by the number of...

  14. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... basically four major types of unemployment; the cyclical, seasonal, frictional and structural. Cyclical unemployment is the type of joblessness that occurs as a result of lower rates of production, during recessions in business cycles resulting in massive layoffs of workers. Seasonal unemployment results from.

  15. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... The paper is an assessment of education, graduate unemployment and the ... acknowledged as a legitimized vehicle for self and societal advancement. The ... curriculum and pedagogical reforms, upgrading existing facilities to match ... It is against this background that the paper examines the issue of.

  16. 19 CFR 10.253 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... limited to, mechanical, quartz digital or quartz analog, if those watches or watch parts contain any... than fair market value, its cost or value will be determined by computing the sum of: (1) All expenses...

  17. All projects related to | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Markets in developing countries are often marked by anti-competitive behaviour, concentrated market power, and low access for newcomers. ... Adding a social science perspective to the field of health policy and systems research can help developing countries address health problems in a more comprehensive way.

  18. Strouhal number of bridge cables with ice accretion at low flow turbulence

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Tatara, M.; Marušić, Ante

    2016-01-01

    Roč. 22, č. 2 (2016), s. 253-272 ISSN 1226-6116 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GC13-34405J; GA ČR(CZ) GA14-12892S Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JM - Building Engineering Impact factor: 0.868, year: 2016 http://koreascience.or.kr/article/ArticleFullRecord.jsp?cn=KJKHCF_2016_v22n2_253

  19. Microscopic nature of inhomogeneous line broadening: Analysis of the excitation-line-narrowing spectra of Cf4+ in CeF4

    International Nuclear Information System (INIS)

    Liu, G.K.; Huang, J.; Beitz, J.V.

    1993-01-01

    Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system

  20. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  1. Operation manual for the INEL on-line mass-separator facility

    International Nuclear Information System (INIS)

    Anderl, R.A.

    1984-06-01

    This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables

  2. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  3. Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Hayet, Lucien; Petit, Pierre; Conche, Roger.

    1976-01-01

    Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr

  4. Dynamic temperature fields under Mars landing sites and implications for supporting microbial life.

    Science.gov (United States)

    Ulrich, Richard; Kral, Tim; Chevrier, Vincent; Pilgrim, Robert; Roe, Larry

    2010-01-01

    While average temperatures on Mars may be too low to support terrestrial life-forms or aqueous liquids, diurnal peak temperatures over most of the planet can be high enough to provide for both, down to a few centimeters beneath the surface for some fraction of the time. A thermal model was applied to the Viking 1, Viking 2, Pathfinder, Spirit, and Opportunity landing sites to demonstrate the dynamic temperature fields under the surface at these well-characterized locations. A benchmark temperature of 253 K was used as a lower limit for possible metabolic activity, which corresponds to the minimum found for specific terrestrial microorganisms. Aqueous solutions of salts known to exist on Mars can provide liquid solutions well below this temperature. Thermal modeling has shown that 253 K is reached beneath the surface at diurnal peak heating for at least some parts of the year at each of these landing sites. Within 40 degrees of the equator, 253 K beneath the surface should occur for at least some fraction of the year; and, within 20 degrees , it will be seen for most of the year. However, any life-form that requires this temperature to thrive must also endure daily excursions to far colder temperatures as well as periods of the year where 253 K is never reached at all.

  5. Gene Therapy for Fracture Repair

    Science.gov (United States)

    2007-05-01

    modulator-1; c-myc binding protein [ Homo sapiens ]. regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin...myc binding protein [ Homo sapiens ] Regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin (A2m) Protease...1-HIV LTR-MLV Promoter EG FP -C el l N um be r (M ea n) 10 ul Vector 50 ul Vector 7 Periosteal/Endosteal Cell Transduction 0 200 400 600 800

  6. Microstructures and Mechanical Properties of Inconel 718 Alloy at Ultralow Temperatures

    Science.gov (United States)

    Yao, C. G.; Lv, H. J.; Yi, D. Q.; Meng, S.; Xiao, L. R.; Wang, B.

    2018-05-01

    The microstructures and mechanical properties of powder metallurgy Inconel 718 alloy were investigated in the temperatures range between 25 and - 253 °C. Tensile strength increased with the decrease in temperature, while the ductility first increased and then decreased. There was no significant change in impact toughness. When the temperature was - 253 °C, a zigzag stress-strain curve was observed for the alloy, owing to the interaction of dislocation glide and twinning, which effectively maintained the relatively good ductility.

  7. Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105

    International Nuclear Information System (INIS)

    Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.

    1999-01-01

    The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified

  8. Multiplicity and correlated energy of gamma rays emitted in the spontaneous fission of Californium-252

    International Nuclear Information System (INIS)

    Brunson, G.S. Jr.

    1982-06-01

    An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented

  9. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin

  11. Postnatal brain and skull growth in an Apert syndrome mouse model

    Science.gov (United States)

    Hill, Cheryl A.; Martínez-Abadías, Neus; Motch, Susan M.; Austin, Jordan R.; Wang, Yingli; Jabs, Ethylin Wang; Richtsmeier, Joan T.; Aldridge, Kristina

    2012-01-01

    Craniofacial and neural tissues develop in concert throughout pre- and postnatal growth. FGFR-related craniosynostosis syndromes, such as Apert syndrome (AS), are associated with specific phenotypes involving both the skull and the brain. We analyzed the effects of the FGFR P253R mutation for Apert syndrome using the Fgfr2+/P253R mouse to evaluate the effects of this mutation on these two tissues over the course of development from day of birth (P0) to postnatal day 2 (P2). Three-dimensional magnetic resonance microscopy and computed tomography images were acquired from Fgfr2+/P253R mice and unaffected littermates at P0 (N=28) and P2 (N=23). 3D coordinate data for 23 skull and 15 brain landmarks were statistically compared between groups. Results demonstrate that the Fgfr2+/P253R mice show reduced growth in the facial skeleton and the cerebrum, while the height and width of the neurocranium and caudal regions of the brain show increased growth relative to unaffected littermates. This localized correspondence of differential growth patterns in skull and brain point to their continued interaction through development and suggest that both tissues display divergent postnatal growth patterns relative to unaffected littermates. However, the change in the skull-brain relationship from P0 to P2 implies that each tissue affected by the mutation retains a degree of independence, rather than one tissue directing the development of the other. PMID:23495236

  12. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available P 192 ... Query: 276 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 329 ... ... ... EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD Sbjct: 253 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 306

  13. The significance of chromosome deletions in atomic-bomb survivors

    International Nuclear Information System (INIS)

    Tanaka, Kimio; Shigeta, Chiharu; Oguma, Nobuo; Kamada, Nanao; Deng, Z.; Niimi, Masanobu; Aisaka, Tadaichi.

    1986-01-01

    In 39 A-bomb survivors 40 years after exposure at ≤ 1,000 m from ground zero, the frequency and features of chromosome deletions in peripheral lymphocytes were examined using a differential staining technique. Simultaneously, in vitro irradiation experiment with Cf-252 was made to infer chromosome aberrations occuring immediately after exposure. Californium-252 with 100 rad induced dicentric and ring chromosomes in 40 % of the cells and acentric fragments in 44 %. Among the A-bomb survivors, chromosome aberrations were observed in 651 (21 %) of the total 3,136 cells. There were 146 cells with deletions (22 % of abnormal cells; 5 % of the total cells), and 10 cells with acentric fragment (0.3 % of the total cells). The figure for deletions was far higher than that reported in the literature. A large number of deletions were seen in chromosomes no.4, no.21, and no.22, and a few deletions in chromosomes no.7 and no.20. Significance of chromosome deletions is discussed. (Namekawa, K.)

  14. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  15. Dynamic vortex dust structures in a nuclear-track plasma

    International Nuclear Information System (INIS)

    Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E

    2003-01-01

    Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure

  16. Monitoring taconite process streams with thermal neutron capture-gamma ray analysis. Report of investigations/1980

    International Nuclear Information System (INIS)

    Woodbury, F.B.W.

    1980-12-01

    The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed

  17. A survey of uses and users of 252Cf

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.

    1989-01-01

    Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL

  18. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  19. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  20. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  1. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    Crane, T.W.

    1981-03-01

    The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  2. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah

    2013-01-01

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  3. Results of the Elections to the Governing Board of the Pensions Fund

    CERN Multimedia

    2006-01-01

    Voting papers issued Ballot papers returned Ballot papers declared null 3'193 1'338 0 Total number of votes Blank votes Null votes Valid votes 1'338 24 61 1'253 Valid ballot papers cast as follows : 1'253 Michel GOOSSENS Henrik VESTERGARD 820 433 Votes cast (percentage) 41.90 % Thus Mr Michel GOOSSENS is elected member of the Governing Board, as from 1 January 2007 for three years.Mr Henrik VESTERGARD is elected alternate member of the Board as from 1 January 2007 for three years. F. Ranjard J. Lahaye

  4. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available us ... Length = 119 ... Query: 253 KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 312 ... ... ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN Sbjct: 1 ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 60 ...

  5. People and things. CERN Courier, Apr 1985, v.25(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July.

  6. People and things. CERN Courier, Apr 1985, v.25(3)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July

  7. Studies of the effects of ultraviolet radiation on the structural integrities of ribosomal RNA components of the Escherichia coli 50S ribosomal subunit

    International Nuclear Information System (INIS)

    Gorelic, L.; Parker, D.

    1978-01-01

    The effects of 254-nm radiation on the structural integrities of free and 50S ribosome-bound 5S and 23S ribosomal ribonucleic acids (rRNA) have been elucidated. Irradiation of aqueous solutions of Escherichia coli 50S ribosomes with 253.7-nm radiation results in the formation of single-strand breaks in double-stranded regions of the 23S rRNA component, but not in rRNA chain scission, and destabilization of the secondary structure of the 23S rRNA toward denaturation. The minimum doses of 253.7-nm radiation required for the first detection of the two effects are 7 x 10 19 quanta for the production of single-strand breaks in double-stranded regions of the 23S rRNA, and 19 quanta for destabilization of the 23S rRNA secondary structure. Free 23S rRNA is resistant toward photoinduced chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 and is much less sensitive toward destabilization of secondary structure than ribosome-bound 23S rRNA. In contrast to the photosensitivity of 50S ribosome-bound 23S rRNA toward chain breakage, 50S ribosome-bound 5S rRNA is resistant toward chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 quanta. Ribosome-bound 5S and 23S rRNA are also not photosensitive toward intermolecular 5S/23S rRNA cross-linkage

  8. Some Biological Activities of Malaysian Leech Saliva Extract

    Directory of Open Access Journals (Sweden)

    Abdualrahman M. Abdualkader

    2011-12-01

    Full Text Available Normal 0 21 false false false MS X-NONE AR-SA Leeches were fed on the phagostimulatory solution through parafilm membrane. The satiated leeches were forced to regurgitate the solution by soaking them in an ice-container. The anticoagulant activity was ascertained using thrombin time assay (TT. The result revealed that the saliva concentration which increases TT by 100% (IC100 is 43.205µg/ml plasma. The antimicrobial activity of the saliva was tested against several bacterial spp. (E.coli, P.aeruginosa, B.cereus, Sal.typhi and S.aureus  and fungi spp. (C.albicans and C.neoformans. It was found that saliva has an inhibition activity against Sal.typhi (minimal inhibitory concentration MIC 78.253µg/ml, S.aureus (MIC 78.253µg/ml and E.coli (MIC 121.256µg/ml.ABSTRAK: Pacat-pacat diberi makan larutan phagostimulatory menerusi membran parafilem. Pacat-pacat yang kekenyangan itu dipaksa memuntahkan larutan tersebut dengan direndam di dalam bekas berisi ais. Aktiviti antigumpal ditentukan menggunakan cerakin masa trombin (TT. Keputusan menunjukkan kepekatan air liur pacat menyebabkan pertambahan TT sebanyak 100% (IC100 iaitu 43.205µg/ml plasma. Aktiviti antimikrob air liur telah diuji dengan pelbagai jenis bakteria (E.coli, P.aeruginosa, B.cereus, Sal.typhi dan S.aureus dan pelbagai jenis kulat (C.albicans and C.neoformans. Didapati air liur menghasilkan aktiviti perencatan terhadap Sal.typhi (kepekatan perencat minima (Minimal inhibitory concentration - MIC 78.253µg/ml, S.aureus (MIC 78.253µg/ml dan E.coli (MIC 121.256µg/ml.

  9. MYT1L mutations cause intellectual disability and variable obesity by dysregulating gene expression and development of the neuroendocrine hypothalamus.

    Directory of Open Access Journals (Sweden)

    Patricia Blanchet

    2017-08-01

    Full Text Available Deletions at chromosome 2p25.3 are associated with a syndrome consisting of intellectual disability and obesity. The smallest region of overlap for deletions at 2p25.3 contains PXDN and MYT1L. MYT1L is expressed only within the brain in humans. We hypothesized that single nucleotide variants (SNVs in MYT1L would cause a phenotype resembling deletion at 2p25.3. To examine this we sought MYT1L SNVs in exome sequencing data from 4, 296 parent-child trios. Further variants were identified through a genematcher-facilitated collaboration. We report 9 patients with MYT1L SNVs (4 loss of function and 5 missense. The phenotype of SNV carriers overlapped with that of 2p25.3 deletion carriers. To identify the transcriptomic consequences of MYT1L loss of function we used CRISPR-Cas9 to create a knockout cell line. Gene Ontology analysis in knockout cells demonstrated altered expression of genes that regulate gene expression and that are localized to the nucleus. These differentially expressed genes were enriched for OMIM disease ontology terms "mental retardation". To study the developmental effects of MYT1L loss of function we created a zebrafish knockdown using morpholinos. Knockdown zebrafish manifested loss of oxytocin expression in the preoptic neuroendocrine area. This study demonstrates that MYT1L variants are associated with syndromic obesity in humans. The mechanism is related to dysregulated expression of neurodevelopmental genes and altered development of the neuroendocrine hypothalamus.

  10. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 312 ... ERNRKSIGIERTFNQNLFDENTALTKLR...SYSRELEKSLKERHFLANCVVLKVRDANFKTI Sbjct: 241 ERNRKSIGIERTFNQNLFDENTALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 300 ... ...ct: 121 PVRIAALLQERIYQRIGLTSSFGVSYNKFLAKMGSEYAKPFGRTVIKPEGARDFLAKQPI 180 ... Query: 253 ERNRKSIGIERTFNQNLFDEN

  11. ORF Alignment: NC_004193 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PVHFIQGDATEDDTIKKA Sbjct: 1 ... HFIFVGWNERTRQLMKLVLEYYPGRRIVVIDKTVNKLTYKEYPVHFIQGDATEDDTIKKA 60 ... Query: 236 TIIRSN...DFMSNLFFHELD 253 ... TIIRSNDFMSNLFFHELD Sbjct: 121 TIIRSNDFMSNLFFHELD 138

  12. Ring Chromosome 17 Not Involving the Miller-Dieker Region: A Case with Drug-Resistant Epilepsy.

    Science.gov (United States)

    Coppola, Antonietta; Morrogh, Deborah; Farrell, Fiona; Balestrini, Simona; Hernandez-Hernandez, Laura; Krithika, S; Sander, Josemir W; Waters, Jonathan J; Sisodiya, Sanjay M

    2017-12-01

    Chromosomal abnormalities are often identified in people with neurodevelopmental disorders including intellectual disability, autism, and epilepsy. Ring chromosomes, which usually involve gene copy number loss, are formed by fusion of subtelomeric or telomeric chromosomal regions. Some ring chromosomes, including ring 14, 17, and 20, are strongly associated with seizure disorders. We report an individual with a ring chromosome 17, r(17)(p13.3q25.3), with a terminal 17q25.3 deletion and no short arm copy number loss, and with a phenotype characterized by intellectual disability and drug-resistant epilepsy, including a propensity for nonconvulsive status epilepticus.

  13. Download this PDF file

    African Journals Online (AJOL)

    Adeyinka Odunsi

    leaves, 2, 3, 4 and 5 times per day were investigated in a 5x5 factorial arrangement fitted into a completely randomized ... maturity, variety, climate, season, exposure .... 2.79a-d. 2.53c-f. 2.59b-f 2.38ef 2.44. J1C1. 1.64h-j. 1.51ij. 1.68h-j. 1.76g-i 1.89gh 1.70. C1J2. 2.53c-f. 2.84ab. 3.00a. 2.98a. 2.81a-c 2.83. Mean. 1.98. 2.46.

  14. Area Handbook for Guinea. Second Edition

    Science.gov (United States)

    1975-01-01

    227. 283; and defense assistance, 320, 341 I Eisenhower. Dwight D.: 194 [elders me almt social system): 79. fS. 103; j council« of. 81, 85; and... almt eiectricity): 6. ! 41, 46. 55. 2«t. 291; dams. 289; Konkourp i pn>ject. 223; potential, 273, 277. 28» | lie de Goree: 17. 20 | lies de...375 Prui. 8S tivMtwk itre almt emk-, hc-niing. nu-mt »upplyi; !«»-10l. 245. 253. 2S4, 30*26»; fhM-krt». IS*: fcncm». H»-I«i; «wit*. 1», 253. 3

  15. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  16. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  17. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available esorhizobium ... loti MAFF303099] ... Length = 291 ... Query: 194 YTFATLVDPHEELPPSEISSLRYWAKIAEKM...GVEIEPITRKDLAKLANYDALFIRETTSI 253 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIE...PITRKDLAKLANYDALFIRETTSI Sbjct: 1 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIEPITRKDLAKLANYDALFIRETTSI 60 ... Query:

  18. Generation of corneal epithelial cells from induced pluripotent stem cells derived from human dermal fibroblast and corneal limbal epithelium.

    Directory of Open Access Journals (Sweden)

    Ryuhei Hayashi

    Full Text Available Induced pluripotent stem (iPS cells can be established from somatic cells. However, there is currently no established strategy to generate corneal epithelial cells from iPS cells. In this study, we investigated whether corneal epithelial cells could be differentiated from iPS cells. We tested 2 distinct sources: human adult dermal fibroblast (HDF-derived iPS cells (253G1 and human adult corneal limbal epithelial cells (HLEC-derived iPS cells (L1B41. We first established iPS cells from HLEC by introducing the Yamanaka 4 factors. Corneal epithelial cells were successfully induced from the iPS cells by the stromal cell-derived inducing activity (SDIA differentiation method, as Pax6(+/K12(+ corneal epithelial colonies were observed after prolonged differentiation culture (12 weeks or later in both the L1B41 and 253G1 iPS cells following retinal pigment epithelial and lens cell induction. Interestingly, the corneal epithelial differentiation efficiency was higher in L1B41 than in 253G1. DNA methylation analysis revealed that a small proportion of differentially methylated regions still existed between L1B41 and 253G1 iPS cells even though no significant difference in methylation status was detected in the specific corneal epithelium-related genes such as K12, K3, and Pax6. The present study is the first to demonstrate a strategy for corneal epithelial cell differentiation from human iPS cells, and further suggests that the epigenomic status is associated with the propensity of iPS cells to differentiate into corneal epithelial cells.

  19. Genetic Testing for Wolfram Syndrome Mutations in a Sample of 71 Patients with Hereditary Optic Neuropathy and Negative Genetic Test Results for OPA1/OPA3/LHON.

    Science.gov (United States)

    Galvez-Ruiz, Alberto; Galindo-Ferreiro, Alicia; Schatz, Patrik

    2018-04-01

    In this study, the authors present a sample of 71 patients with hereditary optic neuropathy and negative genetic test results for OPA1/OPA3/LHON. All of these patients later underwent genetic testing to rule out WFS. As a result, 53 patients (74.7%) were negative and 18 patients (25.3%) were positive for some type of mutation or variation in the WFS gene. The authors believe that this study is interesting because it shows that a sizeable percentage (25.3%) of patients with hereditary optic 25 neuropathy and negative genetic test results for OPA1/OPA3/LHON had WFS mutations or variants.

  20. Sud du Sahara | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

  1. 253 some biochemical effects of a mainly fruit diet in man

    African Journals Online (AJOL)

    -carbohydrate diet. Conn" made similar observations. Insulin Secretion. The fruit diet produced a statistically significant reduc- tion in the plasma insulin response after glucose intake in some Bantu while in some Whites there was an inex-.

  2. Radiative and mechanical feedback into the molecular gas of NGC 253

    NARCIS (Netherlands)

    Rosenberg, M. J. F.; Kazandjian, M. V.; van der Werf, P. P.; Israel, F. P.; Meijerink, R.; Weiß, A.; Requena-Torres, M. A.; Güsten, R.

    Starburst galaxies are galaxies or regions of galaxies undergoing intense periods of star formation. Understanding the heating and cooling mechanisms in these galaxies can give us insight to the driving mechanisms that fuel the starburst. Molecular emission lines play a crucial role in the cooling

  3. : tous les projets | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Sahel, la sécheresse et la piètre fertilité des sols limitent grandement le rendement des cultures. Date de début : 1 mars 2011. End Date: 1 septembre 2014. Sujet: FOOD CROPS, SOIL FERTILITY, FERTILIZERS, FERTILIZING, RAIN FED FARMING, WATER MANAGEMENT, CROP YIELD, Food security. Région: Burkina ...

  4. In-situ elemental analysis of coal by neutron activation

    International Nuclear Information System (INIS)

    Mikesell, J.L.; Senftle, F.E.; Tanner, A.B.

    1986-01-01

    The U.S. Geological Survey (USGS) has worked to develop neutron techniques for the borehole measurement of the elemental composition of ores since 1969, and first demonstrated a borehole ultimate analysis of coal in 1977. Borehole measurements such as these permit real-time evaluation of coal quality without the expense of coring or the delays associated with laboratory analyses. Two technological innovations make such measurements possible: the availability, from Savannah River Operations Office, DOE, of small californium-252 (/sup 252/Cf) fission neutron sources, and the development, by USGS and Princeton Gamma-Techn, of the melting-cryogen-cooled high-purity germanium borehole gamma-ray detector. A technique of relating mass fractions to measured gamma-ray intensities, which eliminates the need for detailed knowledge of the geometry of the neutron distribution, is used to calculate elemental compositions without resorting to the test pits or computer borehole modeling. In coal, all of the major constituents (C, H, N, S, Si, Al, Fe, Ti) except oxygen can be determined quantitatively by thermal neutron capture gamma-ray spectroscopy

  5. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  6. Time-of-flight mass spectrometry with desorption-ionization multiprobes (UV photons and KeV and MeV particles). Cluster atoms are used as projectiles

    International Nuclear Information System (INIS)

    Brunelle, A.

    1990-09-01

    A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets [fr

  7. Peculiarities of extraction of carbonate complexes of trivalent transplutonium elements by alkylpyrocatechins

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.

    1987-01-01

    Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated

  8. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  9. [Fast neutron cross section measurements]: Progress report

    International Nuclear Information System (INIS)

    1988-01-01

    As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs

  10. Estimation of the sub-criticality of the sodium-cooled fast reactor Monju using the modified neutron source multiplication method

    International Nuclear Information System (INIS)

    Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.

    2012-01-01

    The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)

  11. Measurement of neutron dose and spectra at light-water reactors

    International Nuclear Information System (INIS)

    Soldat, K.L.; Endres, G.W.R.; Cummings, F.M.

    1982-08-01

    In choosing one dosimeter over another, both sensitivity and precision must be addressed. It has been determined that dosimeters employing NTA film lack adequate sensitivity for use inside containment of nuclear plants. From this study, it is apparent that CR-39 and polycarbonate track etch films used without radiators are also inadequate. The rest of the dosimeters tested displayed adequate sensitivity. The two general types of dosimeters which comprise that group are: (1) TLDs and (2) the polycarbonate track etch which was used in conjunction with (n, α) radiators. The precision of the TLD dosimeter depends on the calibration technique and response correction technique. TLD dosimeters calibrated to D 2 O-moderated californium-252 or corrected based on 9- to 3-in. sphere response rates seemed to function best inside reactor containment. Polycarbonate track etch film with (n, α) radiators was found to be sensitive enough for use inside reactor containment; however, the standard deviation for the results was roughly twice the value of the most precise TLD albedo dosimeters. Also, several of the polycarbonate dosimeters saturated, rendering any evaluation impossible

  12. Development of an analytical theory to describe the PNAR and CIPN nondestructive assay techniques

    International Nuclear Information System (INIS)

    Bolind, Alan Michael

    2014-01-01

    Highlights: • Neutron albedo is modeled by a discrete and iterative reflection process. • The theory enables the PNAR and CIPN NDA techniques to be compared quantitatively. • Improvements to the data analysis and to the CIPN instrument design are suggested. • A correction to translate real no-reflection PNAR data into ideal data is provided. - Abstract: This paper develops an analytical theory to describe how neutron albedo (reflection) increases the multiplication of neutrons by a used fuel assembly. With this theory, the two nondestructive assay (NDA) techniques of Passive Neutron Albedo Reactivity (PNAR) and Californium-252 Interrogation with Prompt Neutron Detection (CIPN) can be compared directly. Specifically, the theory derives expressions for the PNAR and CIPN metrics in terms of the physical properties of the used fuel assembly, such as the neutron multiplications and fate probabilities. The theory thus clarifies the interpretation of these two NDA techniques and suggests ways to improve both the design of the NDA instruments and the algorithms for analyzing the measurement results

  13. Robotics at Savannah River site: activity report

    International Nuclear Information System (INIS)

    Byrd, J.S.

    1984-09-01

    The objectives of the Robotics Technology Group at the Savannah River Laboratory are to employ modern industrial robots and to develop unique automation and robotic systems to enhance process operations at the Savannah River site (SRP and SRL). The incentives are to improve safety, reduce personnel radiation exposure, improve product quality and productivity, and to reduce operating costs. During the past year robotic systems have been installed to fill chemical dilution vials in a SRP laboratory at 772-F and remove radioactive waste materials in the SRL Californium Production Facility at 773-A. A robotic system to lubricate an extrusion press has been developed and demonstrated in the SRL robotics laboratory and is scheduled for installation at the 321-M fuel fabrication area. A mobile robot was employed by SRP for a radiation monitoring task at a waste tank top in H-Area. Several other robots are installed in the SRL robotics laboratories and application development programs are underway. The status of these applications is presented in this report

  14. Efficiency of interaction between various radiation and chemicals

    International Nuclear Information System (INIS)

    Kim, Jin Kyu; Song, H. S.; Kim, J. S.; Chun, K. J.; Lee, Y. K.; Lee, B. H.; Shin, H. S.; Lee, K. H.; Petin, Vladislav G.

    2002-01-01

    KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland

  15. Separation of Am-Cm from Al(NO3)3 waste solutions by in-canyon-tank precipitation as oxalates

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Wilson, T.W.; McKibben, J.M.; Bibler, N.E.; Holtzscheiter, E.W.; Campbell, T.G.

    1982-04-01

    A process for recovery of Am-Cm residues from high-activity waste concentrates has been developed specifically for application in Savannah River Plant (SRP) canyon tanks. The Am-Cm residues were collected from a campaign to produce plutonium containing high isotopic concentrations of 242 Pu. The separation of Am-Cm from the high-activity waste stream, containing about 2M Al(NO 3 ) 3 , is necessary to produce an acceptable feed solution for a later pressurized cation exchange chromatography separation and purification step. The new process includes formic acid denitration, adjustment of contaminating cations by evaporation and water dilution, and oxalate precipitation of the actinides and lanthanides. After washing, the precipitate was dissolved in 8M nitric acid and the oxalate was destroyed by nitric acid oxidation that was catalyzed by manganous ions. This new process generates about one-fourth the waste of the californium solvent extraction process, which it replaced. The new process also produces a cleaner feed solution for the pressurized cation exchange chromatography separation and purification step

  16. Fabrication of intense neutron sources for medical applications

    International Nuclear Information System (INIS)

    Boulogne, A.R.; Walker, V.W.

    1975-01-01

    Simulated sources containing 252 Cf equivalents of 0.1 to 1.0 milligrams were prepared. Samarium was used as the simulant in a modified chemical plating technique similar to that used to prepare palladium-californium oxide cermet for industrial applications. The length of the platinum-10 percent iridium doubly encapsulated source with its protective sheath is 0.545 in. (14.1 mm). Outside dia of the source, including its sheath, is 0.109 in. (2.8 mm). Existing ''Brachytrons'' can accommodate this source form. This capsule system will withstand internal gas pressures from helium due to alpha decay and fission gases from a 1 mg 252 Cf source after ten years if the source is subjected to a maximum temperature of 800 0 C, the theoretical temperature of an accidental fire. Under these conditions the safety factor is 3. The capsule system is being tested with tracer amounts of 252 Cf to ensure that it will withstand adverse service conditions as well as tests specified for Special Form Materials. (auth)

  17. 4π-spectrometer technique for measurements of secondary neutron average number in nuclear fission by 252Cf neutrons

    International Nuclear Information System (INIS)

    Vasil'ev, Yu.A.; Barashkov, Yu.A.; Golovanov, O.A.; Sidorov, L.V.

    1977-01-01

    A method for determining the average number of secondary neutrons anti ν produced in nuclear fission by the neutrons of the 252 Cf fission spectra by means of a 4π time-of-flight spectrometer is described. Layers of 252 Cf and an isotope studied are placed close to each other; if the isotope layer density is 1 mg/cm 2 probability of its fission is about 10 -5 per one spontaneous fission of californium. Fission fragments of 252 Cf and the isotope investigated have been detected by two surface-barrier counters with an efficiency close to 100%. The layers and the counters are situated in a measuring chamber placed in the center of the 4π time-of-flight spectrometer. The latter is utilized as a neutron counter because of its fast response. The method has been verified by carrying out measurements for 235 U and 239 Pu. A comparison of the experimental and calculated results shows that the method suggested can apply to determine the number of secondary neutrons in fission of isotopes that have not been investigated yet

  18. B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model

    International Nuclear Information System (INIS)

    Nayak, R.C.; Pattnaik, S.

    2015-01-01

    We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2 + state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)

  19. Reprocessing of nuclear fuels at the Savannah River Plant

    International Nuclear Information System (INIS)

    Gray, L.W.

    1986-01-01

    For more than 30 years, the Savannah River Plant (SRP) has been a major supplier of nuclear materials such as plutonium-239 and tritium-3 for nuclear and thermonuclear weapons, plutonium-238 for space exploration, and isotopes of americium, curium, and californium for use in the nuclear research community. SRP is a complete nuclear park, providing most of the processes in the nuclear fuel cycle. Key processes involve fabrication and cladding of the nuclear fuel, target, and control assemblies; rework of heavy water for use as reactor moderator; reactor loading, operation, and unloading; chemical recovery of the reactor transmutation products and spent fuels; and management of the gaseous, liquid, and solid nuclear and chemical wastes; plus a host of support operations. The site's history and the key processes from fabrication of reactor fuels and targets to finishing of virgin plutonium for use in the nuclear weapons complex are reviewed. Emphasis has been given to the chemistry of the recovery and purification of weapons grade plutonium from irradiated reactor targets

  20. Test and evaluation of infrared detectors and arrays; Proceedings of the Meeting, Orlando, FL, Mar. 27-29, 1989

    Science.gov (United States)

    Hoke, Forney M.

    Papers on the testing and evaluation of IR detectors and arrays are presented, covering topics such as a short wavelength IR test system, pulse height analysis, the use of an expert system for IR detector testing, low-background IR focal plane testing, electron beam testing, high performance silicide Schottky photodiodes, the SDI organization focal plane test program, the absorption cross section of arsenic in silicon, and long wavelength IR hybrids. Other topics include low background radiometric detector measurements, an ultralow background dewar for IR detector characterization studies, a computer assisted mosaic array test station, a configurable detector array test station, automated detector material characterization capabilities, and a test system for mercury cadmium telluride photoconductor arrays. Additional topics include ionization dosimetry measurements inside a dewar for linac electron and californium-252 neutron environments, a radiation test facility using a variable-flux electron beam source, automated visual inspection of IR focal plane arrays, a titanium cryostat for low temperature radiation effects studies, a low dose rate gamma test facility, and the test and evaluation of stability in IR staring focal plane arrays after nonuniformity correction.

  1. Branching ratios of α-decay to ground and excited states of Fm, Cf, Cm and Pu

    Science.gov (United States)

    Hassanabadi, H.; Hosseini, S. S.

    2018-06-01

    We use the well-known Wentzel-Kramers-Brillouin (WKB) barrier penetration probability to calculate α-decay branching ratios for ground and excited states of heavy even-even nuclei of Fermium (248-254Fm), Californium (244-252Cf), Curium (238-248Cm) and Plutonium (234-244Pu) with 94 ≤Zp ≤100. We obtained the branching ratios for the excited states of daughter nucleus by the α-decay energy (Qα), the angular momentum of α-particle (ℓα), and the excitation probability of the daughter nucleus with the excitation energy of state ℓ in the daughter nucleus (i.e. Eℓ*). α-Decay half-lives have been evaluated by using the proximity potential model for the heavy even-even nuclei. We have reported the half-lives and compared the results with the experimental data. The theoretical branching ratios of α-transitions in our calculation are found to agree with the available experimental data well for 0+→ 0+, 0+→ 2+, 0+→ 4+, 0+→ 6+ and 0+ → 8+α-transitions.

  2. Dust vortices, clouds, and jets in nuclear-induced plasmas

    International Nuclear Information System (INIS)

    Vladimirov, V.I.; Deputatova, L.V.; Nefedov, A.P.; Fortov, V.E.; Rykov, V.A.; Khudyakov, A.V.

    2001-01-01

    The collective movement of dust particles in a plasma formed during deceleration of decay products of californium nuclei in neon is investigated experimentally. For the first time, compact vortex structures containing a large number of coagulating dust particles and dense dust clouds evolving in time are observed. Dust formations have clearly defined boundaries and particles in them form ordered liquid-type structures. Under steady-state conditions, dust structures exist from several minutes to hours. An increase in the voltage applied to the high-voltage electrode leads to the formation of dust particle jets. A change in the electric field configuration transforms the structures from one type to another. A strong recombination of electrons and ions at dust particles is observed. The momentum transfer from ions drifting in an external field to gas molecules is studied using the Monte Carlo method. It is shown that the transferred momentum is so large that it may cause a gas flow. The characteristic features of vortex flow in neon and in air are explained

  3. Glasses impregnated with lead for radiation shielding

    International Nuclear Information System (INIS)

    Abd El Monem, A.M.; Kansouh, W.A.; Megahid, R.M.; Ismail, A.L.; Awad, E.M.

    2005-01-01

    The attenuation properties of glasses with different concentration of lead have been investigated for the attenuation of gamma-rays from cesium-137 and for total gamma rays using a beam of neutrons and gamma rays emitted from californium-252 source. Measurements have been performed using a gamma-ray spectrometer with Nal(T1) detector for gamma-rays emitted from 137 Cs and a neutron/gamma spectrometer with stilbene scintillator for measurement of total gamma-rays from 252 Cf neutron source. The latter applied the pulse shape discrimination technique to distinguish between recoil proton and recoil electron pulses. The obtained results given the form displayed pulse height spectra and attenuation relations which were used to derive the linear attenuation coefficient (μ), and the mass attenuation coefficient (mu/p) of the investigated glasses. In addition, calculations were performed to determine the attenuation properties of glass shields under investigation using XCOM code given by the others. A comparison of the shielding properties of these glasses with some standard shielding materials indicated that, the investigated glasses process the shielding advantages required for different nuclear technology applications

  4. Calibration techniques and results for the Portsmouth Cf shuffler

    International Nuclear Information System (INIS)

    Gross, J.C.; Wines, K.M.

    1993-01-01

    As environmental concerns over radioactive waste disposal continue to rise, the importance of Californium shufflers as a versatile waste monitoring and segregation instrument also continue to increase. The extent to which different amounts and types of materials can be measured by the shuffler is directly related to the extent of its calibration. As shufflers become more common place and their waste management uses also rise, the importance of a wide ranging and thorough calibration becomes critical. This paper presents the techniques used at the Portsmouth Gaseous Diffusion Plant for calibrating the shuffler to detect levels of U-235 in radioactive waste. While the calibration techniques are similar to those used by Los Alamos, the standards that were used were constructed somewhat differently so that geometric effects are maximized. Also presented are shuffler transmission measurements that are used to determine the matrix type and the corresponding calibration. A discussion of the calibration data is given. This discussion includes specific aspects of the calibration such as overall range, high end limits, and poly shielding range and usefulness

  5. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1977

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1977-12-01

    During the period January 1, 1977, through June 30, 1977, the following amounts of transuranium elements were recovered from 12 irradiated HFIR targets: 0.1g 243 Am, 21g 244 Cm, 29.5 mg 249 Bk, 288 mg 252 Cf, 1.48 mg 253 Es, and 0.7 pg 257 Fm. One batch of high-purity 248 Cm (approximately 50 mg) was separated from 252 Cf. Twenty-three shipments were made from TRU during the period; recipients and the amounts of nuclides are tabulated. Five HFIR targets, each containing 8 to 9 g of curium, were fabricated. During the next 18 months, we expect to obtain totals of 92 mg of 249 Bk, 910 mg of 252 Cf, 3.8 mg of 253 Es (in a mixture of isotopes), 615 μg of high-purity 253 Es, and 1.6 pg of 257 Fm; we also expect to make available 250 mg of high-purity 248 Cm. No process or equipment changes were made during this report period. Five neutron sources were fabricated during this report period, bringing the total fabricated to date to 97. Two sources that had previously been returned to TRU were reassigned. Special projects included the following: (1) the enrichment of the 244 Pu concentration in 100 mg of plutonium by irradiation to burn out the lighter isotopes, (2) the separation of 245 pg of 254 Cf from 39-hr /sup 254m/Es that was produced by irradiation of 5 μg of 253 Es, and (3) an experimental separation of cerium from the other rare-earth elements in a TRU process waste solution. The values that we are currently using for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  6. Inhibition of inducible heat shock protein-70 (hsp72 enhances bortezomib-induced cell death in human bladder cancer cells.

    Directory of Open Access Journals (Sweden)

    Wei Qi

    Full Text Available The proteasome inhibitor bortezomib (Velcade is a promising new agent for bladder cancer therapy, but inducible cytoprotective mechanisms may limit its potential efficacy. We used whole genome mRNA expression profiling to study the effects of bortezomib on stress-induced gene expression in a panel of human bladder cancer cell lines. Bortezomib induced strong upregulation of the inducible HSP70 isoforms HSPA1A and HSPA1B isoforms of Hsp72 in 253J B-V and SW780 (HSPA1A(high cells, but only induced the HSPA1B isoform in UM-UC10 and UM-UC13 (HSPA1A(low cells. Bortezomib stimulated the binding of heat shock factor-1 (HSF1 to the HSPA1A promoter in 253JB-V but not in UM-UC13 cells. Methylation-specific PCR revealed that the HSPA1A promoter was methylated in the HSPA1A(low cell lines (UM-UC10 and UM-UC13, and exposure to the chromatin demethylating agent 5-aza-2'-deoxycytidine restored HSPA1A expression. Overexpression of Hsp72 promoted bortezomib resistance in the UM-UC10 and UM-UC13 cells, whereas transient knockdown of HSPA1B further sensitized these cells to bortezomib, and exposure to the chemical HSF1 inhibitor KNK-437 promoted bortezomib sensitivity in the 253J B-V cells. Finally, shRNA-mediated stable knockdown of Hsp72 in 253J B-V promoted sensitivity to bortezomib in vitro and in tumor xenografts in vivo. Together, our results provide proof-of-concept for using Hsp72 inhibitors to promote bortezomib sensitivity in bladder cancers and suggest that selective targeting of HSPA1B could produce synthetic lethality in tumors that display HSPA1A promoter methylation.

  7. Male Specific Gene Expression in Dioecious Phoenix Dactylifera (Date Palm) Tree at Flowering Stage

    International Nuclear Information System (INIS)

    Al-Ameri, A. A.; Al-Qurainy, F.; Gaafar, A. R. Z.; Khan, S.; Nadeem, M.

    2016-01-01

    Date palm is a long-living and evergreen important tree in the semiarid regions. Its fruit is rich in carbohydrate and fibres. Transcriptional profiling was compared among male and female trees of dioecious date palm at flowering stage. Male specific genes are expressed at flowering stage which was studied using the cDNA-SCoT marker. We developed sequence characterized amplified region (SCAR) markers of size 253 bp from male tree based on cDNA-SCoT fingerprinting. Further, developed SCAR marker was validated on the independently collected samples of both types of trees at flowering stage. The unique and specific band (253 bp) was amplified from male samples only whereas it was absent from female samples. (author)

  8. VizieR Online Data Catalog: DIB 661.3nm in Cepheid spectra (Kashuba+, 2016)

    Science.gov (United States)

    Kashuba, S. V.; Andrievsky, S. M.; Chekhonadskikh, F. A.; Luck, R. E.; Kovtyukh, V. V.; Korotin, S. A.; Krelowski, J.; Galazutdinov, G. A.

    2017-11-01

    We used spectra of Northern hemisphere Cepheids obtained by REL - one of the co-authors of this paper, with the High Resolution Spectrograph of the Hobby-Eberly Telescope at the McDonald Observatory of the University of Texas at Austin (Texas, USA) with the resolving power of 30000, a typical signal-to-noise ratio of about 100, and wavelength range of 435-780nm. A total of 253 Cepheid spectra were used in the research. We performed an investigation of the 661.356 nm DIB profile in 253 spectra of 176 Cepheids. After removal of the blending YII line the EW of each DIB was calculated for each spectrum. (1 data file).

  9. In situ x-ray fluorescence and californium-252 neutron activation analysis for marine and terrestrial mineral exploration

    International Nuclear Information System (INIS)

    Wogman, N.A.

    1976-12-01

    Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables

  10. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  11. Biotechnology Process Engineering Center at MIT - Overview

    Science.gov (United States)

    | Facsimile (617) 253-2400 | e-mail: bpec-www@mit.edu THERAPEUTIC GENE BIOTECHNOLOGY INDUSTRIAL CONSORTIUM Board (ICAB) in Therapeutic Gene Biotechnology. ICAB Member Representatives review our research progress

  12. 76 FR 46300 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2011-08-02

    ... 62366:2007. engineering to medical devices. D. General Hospital/General Plastic Surgery: 6-253 Hoists... CLSI H59-A. Thromboembolic Disease; Approved Guideline. F. Nanotechnology: 18-2 Standard Guide for...

  13. 75 FR 5925 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-02-05

    ... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...

  14. Stemcell Information: SKIP001176 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001176 ... Normal 253F5 253F5 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob

  15. Stemcell Information: SKIP001173 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001173 ... Normal 253F2 253F2 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob

  16. Stemcell Information: SKIP001175 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001175 ... Normal 253F4 253F4 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob

  17. 9 CFR 3.107 - Sanitation.

    Science.gov (United States)

    2010-01-01

    ... in food preparation must be cleaned and sanitized after each use. Kitchens and other food handling... marine mammals except when deemed essential by an attending veterinarian. [66 FR 253, Jan. 3, 2001] ...

  18. Structure and ecology of freshwater benthic diatom communities from Byers Peninsula, Livingston Island, South Shetland Islands

    Czech Academy of Sciences Publication Activity Database

    Kopalová, Kateřina; Van de Vijver, B.

    2013-01-01

    Roč. 25, č. 2 (2013), s. 239-253 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Bacillariophyta * lakes * Maritime Antarctic Region Subject RIV: EF - Botanics Impact factor: 1.417, year: 2013

  19. Geochemical background in polluted river sediments: How to separate the effects of sediment provenance and grain size with statistical rigour?

    Czech Academy of Sciences Publication Activity Database

    Bábek, O.; Matys Grygar, Tomáš; Faměra, M.; Hron, K.; Nováková, Tereza; Sedláček, J.

    2015-01-01

    Roč. 135, DEC (2015), s. 240-253 ISSN 0341-8162 Institutional support: RVO:61388980 Keywords : Anthropogenic contamination * Geochemical background * Fluvial sediments Subject RIV: DD - Geochemistry Impact factor: 2.612, year: 2015

  20. Konsolidation und Stoffaustrag von Aufbereitungsrueckstaendendes Uranerzbergbaus

    Czech Academy of Sciences Publication Activity Database

    Beyer, K. D.; Herrmann, R.; Ohlendorf, F.; Sembdner, T.; von Wolffersdorff, P. A.; Herle, Ivo; Kolymbas, D.

    2001-01-01

    Roč. 24, č. 4 (2001), s. 253-262 ISSN 0172-6145 Institutional research plan: CEZ:AV0Z2071913 Keywords : consolidation, solute transport, uranium mill tailings. Subject RIV: JM - Building Engineering

  1. Krajina jako prostředí k rekreaci - na příkladu Šuamvy

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2001-01-01

    Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography

  2. Anthropological perspectives on democratic citizenship education and globalization

    Czech Academy of Sciences Publication Activity Database

    Červinková, Hana

    2013-01-01

    Roč. 2013, č. 27 (2013), s. 253-262 ISSN 1233-6688 Institutional support: RVO:68378076 Keywords : citizenship education * anthropology of education * action research * youth * participation * globalization Subject RIV: AC - Archeology, Anthropology, Ethnology

  3. Knocking down expression of the auxin-amidohydrolase IAR3 alters defense responses in Solanaceae family plants

    Czech Academy of Sciences Publication Activity Database

    D'Ippolito, S.; Vaňková, Radomíra; Joosten, M.H.A.J.; Casalongue, C.A.; Fiol, D.F.

    2016-01-01

    Roč. 253, DEC (2016), s. 31-39 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : Auxin * Biotic stress * Cladosporium fulvum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.437, year: 2016

  4. Aviation security : TSA is increasing procurement and deployment of the advanced imaging technology, but challenges to this effort and other areas of aviation security remain : testimony before the Subcommittee on Transportation Security and Infrastructur

    Science.gov (United States)

    2010-03-17

    The attempted bombing of Northwest flight 253 highlighted the importance of detecting improvised explosive devices on passengers. This testimony focuses on (1) the Transportation Security Administrations (TSA) efforts to procure and deploy advance...

  5. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  6. Status of Radiotherapy around the World: Sub-Saharan Africa. Chapter 25.3

    International Nuclear Information System (INIS)

    Kigula Mugambe, J.B.; Kavuma, A.

    2017-01-01

    Sub-Saharan Africa is faced with numerous socioeconomic and political challenges. These significantly influence the delivery of health services, including radiotherapy. The availability of radiotherapy service in a country does not necessarily mean that its population can access that service. Financial constraints, lack of awareness and poor road infrastructure influence accessibility. For example, the Democratic Republic of the Congo is a vast country with only one centre in Kinshasa, and it is very difficult for people in the eastern part of the country to access it. Late presentation of patients for cancer management is another formidable challenge, aggravated by the issues mentioned above. The countries in this region have to address the problem of increasing cancer burden and the increasingly important role of radiotherapy in cancer management. There is an urgent need for the establishment of radiotherapy centres that are distributed widely across the region, accompanied by the training of more personnel. On the positive side, several countries in this region, e.g. Eritrea, Malawi and Niger, are in the process of establishing radiotherapy facilities in cooperation with the IAEA. Others, such as Ghana, Nigeria and the United Republic of Tanzania, are in the process of expanding the existing services. The countries in this region should address the late presentation problem by increasing awareness and establishing effective prevention and early detection programmes as part of their national cancer control strategies. They should also develop appropriate cancer policies with the continued support of international organizations such as the IAEA and the World Health Organization (WHO).

  7. 7 CFR 1710.253 - Engineering and cost studies-addition of generation capacity.

    Science.gov (United States)

    2010-01-01

    ... must include comprehensive economic present-value analyses of the costs and revenues of the available... assessments of service reliability and financing requirements and risks. Requirements for analyzing purchased... costs; (2) Financing requirements and risks; (3) System reliability; (4) Alternative unit sizes; (5...

  8. A CLUSTER IN THE MAKING: ALMA REVEALS THE INITIAL CONDITIONS FOR HIGH-MASS CLUSTER FORMATION

    International Nuclear Information System (INIS)

    Rathborne, J. M.; Contreras, Y.; Longmore, S. N.; Bastian, N.; Jackson, J. M.; Alves, J. F.; Bally, J.; Foster, J. B.; Garay, G.; Kruijssen, J. M. D.; Testi, L.; Walsh, A. J.

    2015-01-01

    G0.253+0.016 is a molecular clump that appears to be on the verge of forming a high-mass cluster: its extremely low dust temperature, high mass, and high density, combined with its lack of prevalent star formation, make it an excellent candidate for an Arches-like cluster in a very early stage of formation. Here we present new Atacama Large Millimeter/Sub-millimeter Array observations of its small-scale (∼0.07 pc) 3 mm dust continuum and molecular line emission from 17 different species that probe a range of distinct physical and chemical conditions. The data reveal a complex network of emission features with a complicated velocity structure: there is emission on all spatial scales, the morphology of which ranges from small, compact regions to extended, filamentary structures that are seen in both emission and absorption. The dust column density is well traced by molecules with higher excitation energies and critical densities, consistent with a clump that has a denser interior. A statistical analysis supports the idea that turbulence shapes the observed gas structure within G0.253+0.016. We find a clear break in the turbulent power spectrum derived from the optically thin dust continuum emission at a spatial scale of ∼0.1 pc, which may correspond to the spatial scale at which gravity has overcome the thermal pressure. We suggest that G0.253+0.016 is on the verge of forming a cluster from hierarchical, filamentary structures that arise from a highly turbulent medium. Although the stellar distribution within high-mass Arches-like clusters is compact, centrally condensed, and smooth, the observed gas distribution within G0.253+0.016 is extended, with no high-mass central concentration, and has a complex, hierarchical structure. If this clump gives rise to a high-mass cluster and its stars are formed from this initially hierarchical gas structure, then the resulting cluster must evolve into a centrally condensed structure via a dynamical process

  9. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de-binding protein [Periplaneta americana] ... pir||JQ0708 lipopolysaccharide-binding protein precurs... NT_033778 gi|24762680 >1qddA 8 141 113 253 1e-15 ... dbj|BAA00616.1| lipopolysacchari

  10. TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development

    Czech Academy of Sciences Publication Activity Database

    Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.

    2008-01-01

    Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008

  11. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Predictors of risky sexual behaviour among young people in the era ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    people's practicing risky sexual behaviour in the era of HIV/AIDS. Data used in ... pregnancies, unsafe induced abortion and HIV .... additional selection criteria. ...... India. International. Family. Planning. Perspectives 1999; 25(3): 139-146. 18.

  13. Personal neutron dosemeter of the Czech Republic: Review of basic properties, results of recent tests

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Spurný, František; Plichta, J.

    2006-01-01

    Roč. 14, 7/8 (2006), s. 246-253 ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality

  14. Psychosocial risk and protective factors associated with perpetration ...

    African Journals Online (AJOL)

    and gender violence need to address male depression, anxiety and ... health problems cause difficulties with emotion regulation, and some men may use GBV ..... Student. 253 (56.5). *Two participants reported volunteering full time and.

  15. Características agronômicas e o estado nutricional de cultivares de girassol irrigado Agronomic characteristics and nutritional status of irrigated sunflower cultivars

    Directory of Open Access Journals (Sweden)

    Leonardo A. de Aquino

    2013-05-01

    Full Text Available Objetivou-se, neste trabalho, avaliar o estado nutricional, caracteres agronômicos e a produtividade de cultivares de girassol sob irrigação. Os cultivares Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, Dow Agroscience M 734 e MG 02, foram semeados em blocos ao acaso, com quatro repetições. O número de folhas por planta no florescimento foi maior nos híbridos Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02, em relação aos cultivares de polinização aberta Embrapa 122 V-2000 e IAC Iarama. Os teores foliares de N, P, K, Ca, Mg e S foram 40,91; 3,51; 35,91; 33,91; 6,23 e 7,88 g kg-1, respectivamente. Os cultivares Embrapa 122 V-2000 e IAC-Iarama apresentaram teor de P na folha índice menor que os demais cultivares. Os teores foliares de Zn, Cu, Fe e o Mn foram 75,15; 24,11; 98,39 e 348,10 mg kg-1, respectivamente. O teor médio de B na folha índice nos híbridos e nas variedades de polinização aberta foi de 119,25 e 140,35 mg kg-1, respectivamente. Os cultivares Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02 apresentaram maior produtividade que o Embrapa 122 V-2000 e o IAC Iarama.This work aimed to assess nutritional status, agronomic characteristics, and productivity of sunflower cultivars under irrigation. Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, and Dow Agroscience M 734 and MG 02 cultivars were sown in randomized block design with four replications. The number of leaves per plant in full bloom was higher in hybrid Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360 and Dow Agroscience MG 734 and M 02 related to open-pollinated cultivars Embrapa 122 V-2000 and IAC Iarama. Foliar contents of N, P, K, Ca, Mg, and S were 40.91, 3.51, 35.91, 33.91, 6.23, and 7.88 g kg-1, respectively. Embrapa 122 V-2000 and IAC-Iarama cultivars showed an average

  16. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  17. Éva Katalin Vámos (1950-2015)

    Czech Academy of Sciences Publication Activity Database

    Štrbáňová, Soňa

    2015-01-01

    Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History

  18. Microsporidia and ‘The Art of Living Together’

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Lukeš, Julius

    2013-01-01

    Roč. 82, č. 2013 (2013), s. 253-319 ISSN 0065-308X Institutional support: RVO:60077344 Keywords : Microsporidia * polar tube protein * ribosomal RNA Subject RIV: EE - Microbiology, Virology Impact factor: 4.360, year: 2013

  19. 77 FR 65899 - Agency Information Collection Activities: Guarantee of Payment

    Science.gov (United States)

    2012-10-31

    ... Payment. OMB Number: 1651-00127. Form Number: Form I-510. Abstract: Section 253 of the Immigration and....gov/pdf/CBP_Form_i510.pdf Action: CBP proposes to extend the expiration date of this information...

  20. Taking notes as an interactive process

    OpenAIRE

    Hornig, Wolfgang

    1984-01-01

    Taking notes as an interactive process : how to improve students´ notes / Hornig W. ; Nowak, J. - In: Nowak, Johann: Textverstehen und Textrekonstruktion in Vorlesungen. - Augsburg : HDZ, 1984. - S. 227-253. - (Augsburger Studien zur Hochschuldidaktik ; 12)

  1. File list: Unc.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Neu.05.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.05.AllAg.Hypothalamus.bed ...

  2. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry, E-mail: alby@anl.gov [Argonne National Laboratory, Lemont, IL (United States); Dulla, Sandra; Ravetto, Piero [Politecnico di Torino (Italy)

    2011-07-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  3. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Yousry; Dulla, Sandra; Ravetto, Piero

    2011-01-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  4. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    Directory of Open Access Journals (Sweden)

    Yudakov Aleksandr A.

    2015-01-01

    Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.

  5. A technique for combining neutron and gamma-ray data into a single assay value

    International Nuclear Information System (INIS)

    Pickrell, M.M.; Mercer, D.; Sharpe, T.J.

    1998-01-01

    The authors explored the potentials of using both neutron and gamma-ray measurements on a single item and combining these data into a single assay value. The purpose was to improve assay capability for sample matrices that are difficult to measure. They chose an empirical approach because they wanted to address difficult-to-measure items for which the assay problem is complex. They used the tomographic gamma scanner; a passive, high-efficiency neutron counter with add-a-source and multiplicity; and an active neutron, californium shuffler to obtain measurements. Twenty-four 200-L drums were measured with various matrices using all three machines. The matrices were chosen specifically to spain the difficult-to-measure assay problems for some or all of the instruments. For example, the authors measured a drum filled with concrete and another filled with metal. The data from these measurements were analyzed using the alternating conditional expectation algorithm, which is one of a class of generalized additive models. Other data fusion algorithms are also possible and are being explored. The intent was to find ways to combine the data that would reduce the matrix-induced measurement error

  6. Activation analysis of stainless steel flux monitors using 252Cf neutron sources

    International Nuclear Information System (INIS)

    Williams, J.G.; Newton, T.H. Jr.; Cogburn, C.O.

    1984-01-01

    Activation analysis was performed on stainless steel beads from a chain which is used in reactor pressure vessel surveillance experiments at the Arkansas Power and Light Company reactors. The beads allow monitoring of two fast and three thermal neutron induced reactions: 58 Ni(n,p) 58 Co, 54 Fe(n,p) 54 Mn, 58 Fe(n,γ) 59 Fe, 59 Co(n,γ) 60 Co and 50 Cr(n,γ) 51 Cr. The analysis was performed using 12 beads from various positions along 5 different batches of chain and standard materials in an H 2 O moderator tank using two intense californium sources which had a total neutron emission rate of 3.97 x 10 10 /s. Semiconductor gamma spectrometers were used to count the products of the above reactions in the specimens. The percentage by weight of the iron, chromium and cobalt in the beads were found to be 62.1%, 20.2% and 0.120%, respectively. The excellent uniformity found in the bead compositions demonstrates the reproducibility of the experimental techniques and enhances considerably the value of the beads as neutron flux montitors

  7. Interface detection by neutron scattering

    International Nuclear Information System (INIS)

    De Monchy, A.R.; Kok, C.A.; Dorrepaal, J.

    1979-01-01

    A method and apparatus for detecting an interface of materials having different hydrogen content present in a metal vessel or pipe eg. made of steel, are described. Steel walls of columns, reactors, pipelines etc can be monitored. It is very suitable for detection of liquid water or hydrocarbons present in gas pipelines and also for the detection of a liquid hydrocarbon in a vessel or column. A series of measurements of the hydrogen density of the contents of a vessel or pipe are made using at least one californium-252 neutron source located near the outer side of the pipe. Neutrons are emitted and are scattered by the contents of the pipe. At least one neutron detector is located near the outer side of the metal wall. The detectors have a higher sensitivity for scattered neutrons (from the light hydrogen nuclei present in water or hydrocarbons). A source of 0.1 - 1 micrograms produces enough neutrons for most technical applications so the handling is relatively safe although shielding is advocated. The detectors contain helium-3 at a pressure of about 10 bar. Current pulses from the detector are counted. (U.K.)

  8. MinT: Middleware for Cooperative Interaction of Things.

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-06-20

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  9. Design of active-neutron fuel rod scanner

    International Nuclear Information System (INIS)

    Griffith, G.W.; Menlove, H.O.

    1996-01-01

    An active-neutron fuel rod scanner has been designed for the assay of fissile materials in mixed oxide fuel rods. A 252 Cf source is located at the center of the scanner very near the through hole for the fuel rods. Spontaneous fission neutrons from the californium are moderated and induce fissions within the passing fuel rod. The rod continues past a combined gamma-ray and neutron shield where delayed gamma rays above 1 MeV are detected. We used the Monte Carlo code MCNP to design the scanner and review optimum materials and geometries. An inhomogeneous beryllium, graphite, and polyethylene moderator has been designed that uses source neutrons much more efficiently than assay systems using polyethylene moderators. Layers of borated polyethylene and tungsten are used to shield the detectors. Large NaI(Tl) detectors were selected to measure the delayed gamma rays. The enrichment zones of a thermal reactor fuel pin could be measured to within 1% counting statistics for practical rod speeds. Applications of the rod scanner include accountability of fissile material for safeguards applications, quality control of the fissile content in a fuel rod, and the verification of reactivity potential for mixed oxide fuels. (orig.)

  10. Sources of Radioactive Isotopes for Dirty Bombs

    Science.gov (United States)

    Lubenau, Joel

    2004-05-01

    From the security perspective, radioisotopes and radioactive sources are not created equal. Of the many radioisotopes used in industrial applications, medical treatments, and scientific research, only eight, when present in relatively large amounts in radioactive sources, pose high security risks primarily because of their prevalence and physical properties. These isotopes are americium-241, californium-252, cesium-137, cobalt-60, iridium-192, radium-226, plutonium-238, and strontium-90. Except for the naturally occurring radium-226, nuclear reactors produce the other seven in bulk commercial quantities. Half of these isotopes emit alpha radiation and would, thus, primarily pose internal threats to health; the others are mainly high-energy gamma emitters and would present both external and internal health hazards. Therefore, the response to a "dirty bomb" event depends on what type of radioisotope is chosen and how it is employed. While only a handful of major corporations produce the reactor-generated radioisotopes, they market these materials to thousands of smaller companies and users throughout the world. Improving the security of the high-risk radioactive sources will require, among other efforts, cooperation among source suppliers and regulatory agencies.

  11. Product ion distributions for the reactions of NO+ with some physiologically significant volatile organosulfur and organoselenium compounds obtained using a selective reagent ionization time-of-flight mass spectrometer

    Czech Academy of Sciences Publication Activity Database

    Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.

    2014-01-01

    Roč. 28, č. 15 (2014), s. 1683-1690 ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : TRACE GAS-ANALYSIS * ORGANIC-COMPOUNDS * EXHALED-BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  12. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  13. Quenching of photoluminescence of Rhodamine 6G molecules on functionalized graphene

    Czech Academy of Sciences Publication Activity Database

    Valeš, Václav; Kovaříček, Petr; Ji, X.; Ling, X.; Kong, J.; Dresselhaus, M. S.; Kalbáč, Martin

    2016-01-01

    Roč. 253, č. 12 (2016), s. 2347-2350 ISSN 0370-1972 Institutional support: RVO:61388955 Keywords : atomic force microscopy * functionalized graphene * photoluminiscence quenching Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.674, year: 2016

  14. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Separation of yttrium from strontium in the aqueous phase of the water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 171-172 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : stroncium * yttrium * separation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  16. Separation of microamounts of yttrium from strontium in the two-phase water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Vaňura, P.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 153-155 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : separation * stroncium * yttrium Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  17. Effects of the Size of Cosmological N-body Simulations on Physical ...

    Indian Academy of Sciences (India)

    Apart from N-body simulations, an analytical prescription given by Press & ...... Little, B., Weinberg, D. H., Park, C. 1991, MNRAS, 253, 295. Ma, C.-P. ... Padmanabhan, T. 1993, Structure Formation in the Universe, Cambridge University Press.

  18. Synthesis of C3-symmetric tri(alkylamino) guests and their interaction with cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Bednaříková, T.; Tošner, Z.; Horský, Jiří; Jindřich, J.

    2015-01-01

    Roč. 81, 1-2 (2015), s. 141-152 ISSN 0923-0750 Institutional support: RVO:61389013 Keywords : cyclodextrin * supramolecular interactions * C3-symmetric guests Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.253, year: 2015

  19. Gentegreerde woordeboekgebruik van vakwoordeboeke vir ...

    African Journals Online (AJOL)

    Riette Ruthven

    word bespreek asook daardie vakwoordeboeke wat op aanleerders van sowel 'n taal as die vak gerig is. ... Abstract: Integrated Dictionary Use of Specialised Dictionaries for Learn- ers. ...... Applied Language Studies 25(3): 319-331. Gouws ...

  20. Apoptosis and necrosis during the circadian cycle in the centipede midgut

    Czech Academy of Sciences Publication Activity Database

    Rost-Roszkowska, M.M.; Chajec, Ł.; Vilímová, J.; Tajovský, Karel

    2016-01-01

    Roč. 253, č. 4 (2016), s. 1051-1061 ISSN 0033-183X Institutional support: RVO:60077344 Keywords : cell death * centipede * digestive cells * midgut epithelium * ultrastructure Subject RIV: EG - Zoology Impact factor: 2.870, year: 2016

  1. The Prevalence and Outcome of Asymptomatic Chlamydial Infection ...

    African Journals Online (AJOL)

    Annals of Medical and Health Sciences Research | Mar-Apr 2014 | Vol 4 | Issue 2 |. 253. Address for .... effect may further compromise the reproductive chance of such women .... easy evaluation and this exercise has been encouraged. Some.

  2. 5 original article pcr detection of entamoeba histolytica

    African Journals Online (AJOL)

    boaz

    STOOL SAMPLES OF HOSPITAL PATIENTS IN SOROTI, EASTERN UGANDA. Ekou1, 3*, J. ... Department of Wildlife and Animal resources management, Makerere University. P.O Box ... In Mexico, E.histolytica prevalence of. 25.3% in the ...

  3. Use of [SbF.sub.6./sub.] .sup.-./sup. to isolate cationic copper and silver adducts with more than one ethylene on the metal center

    Czech Academy of Sciences Publication Activity Database

    Fianchini, M.; Campana, C.F.; Chilukuri, B.; Cundari, T.R.; Petříček, Václav; Dias, H.V.

    2013-01-01

    Roč. 32, č. 10 (2013), s. 3034-3041 ISSN 0276-7333 Institutional support: RVO:68378271 Keywords : organometallic compounds * X-ray structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.253, year: 2013

  4. Puerto Lápice eucrite fall: Strewn field, physical description, probable fireball trajectory, and orbit

    Czech Academy of Sciences Publication Activity Database

    Trigo-Rodríguez, J.M.; Borovička, Jiří; Llorca, J.; Madiedo, J.M.; Zamorano, J.; Izquierdo, J.

    2009-01-01

    Roč. 44, č. 2 (2009), s. 175-186 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  5. Oxidative Addition of Diphenyldichalcogenides PhEEPh (E = S, Se, Te) to Low-Valent CN- and NCN-Chelated Organoantimony and Organobismuth Compounds

    Czech Academy of Sciences Publication Activity Database

    Šimon, Petr; Jambor, R.; Růžička, A.; Dostál, I.

    2013-01-01

    Roč. 32, č. 1 (2013), s. 239-248 ISSN 0276-7333 Institutional support: RVO:61388971 Keywords : MAIN-GROUP ELEMENTS * BOND COVALENT RADII * CRYSTAL-STRUCTURES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013

  6. File list: ALL.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.05.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.05.AllAg.Hypothalamus.bed ...

  7. Griechische Tragödie als Medium der Erfahrung

    Czech Academy of Sciences Publication Activity Database

    Kouba, Petr

    2013-01-01

    Roč. 22, 84-85 (2013), s. 235-253 ISSN 1318-3362 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : tragedy * destiny * exteriority * event Subject RIV: AA - Philosophy ; Religion

  8. 75 FR 57396 - List of Nonconforming Vehicles Decided To Be Eligible for Importation

    Science.gov (United States)

    2010-09-21

    ... 150 ...... ...... Chevrolet Astro Van 1997 298 ...... ...... Chevrolet Blazer 1986 405... (MC) FX, FL, XL Series..... 1998 253 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 1999 281 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 2000 321 ...... ...... Harley Davidson...

  9. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

  10. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius

    2010-01-01

    Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  11. Sources of hydrocarbons in sediments of the Mandovi estuary and the Marmugoa harbour, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Harji, R.R.; Yvenat, A.; Bhosle, N.B.

    anthropogenic hydrocarbon inputs. Mar Environ Res 1992;33:223-253. Stout SA, Uhler AD, McCarthy KJ, Emsbo-Mattingly S. Chemical fingerprinting of hydrocarbons. In: Murphy BL, Morrison R (Eds.), Introduction to Environmental Forensics. Academic Press, Boston...

  12. Survey of Water and Ammonia in Nearby Galaxies (SWAN): Resolved Ammonia Thermometry and Water and Methanol Masers in IC 342, NGC 6946, and NGC 2146

    Science.gov (United States)

    Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva

    2018-04-01

    The Survey of Water and Ammonia in Nearby galaxies (SWAN) studies atomic and molecular species across the nuclei of four star-forming galaxies: NGC 253, IC 342, NGC 6946, and NGC 2146. As part of this survey, we present Karl G. Jansky Very Large Array molecular line observations of three galaxies: IC 342, NGC 6946, and NGC 2146. NGC 253 is covered in a previous paper. These galaxies were chosen to span an order of magnitude in star formation rates and to select a variety of galaxy types. We target the metastable transitions of ammonia NH3(1, 1) to (5, 5), the 22 GHz water (H2O) (616–523) transition, and the 36.1 GHz methanol (CH3OH) (4‑1–30) transition. We use the NH3 metastable lines to perform thermometry of the dense molecular gas. We show evidence for uniform heating across the central kiloparsec of IC 342 with two temperature components for the molecular gas, similar to NGC 253, of 27 and 308 K, and that the dense molecular gas in NGC 2146 has a temperature 36 GHz CH3OH masers in IC 342 and NGC 6946. For the four external galaxies the total CH3OH luminosity in each galaxy suggests a correlation with galactic star formation rate, whereas the morphology of the emission is similar to that of HNCO, a weak shock tracer.

  13. Growth and Physiological Performance of Aerobic and Lowland Rice as Affected by Water Stress at Selected Growth Stages

    Directory of Open Access Journals (Sweden)

    Nadzariah Kamarul Zaman

    2018-03-01

    Full Text Available Aerobic rice technology is still new in Malaysia, and information regarding MARDI Aerob 1 (MA1, the first local aerobic rice variety, is still lacking. Therefore, comparative studies were carried out to determine the physiological performance of aerobic rice variety MA1 and lowland rice variety MR253 under water stress given at the panicle initiation, flowering and ripening stages. This experiment was arranged in a randomized complete block design. Stomatal conductance (gs, chlorophyll a fluorescence (Fv/Fm, leaf relative water content (leaf RWC, and soil moisture content (SMC as well as yield component parameters such as panicle number, grain yield and 100-grain weight were measured. Results revealed that gs and leaf RWC for both varieties decreased with depletion of SMC. The correlation study between the physiological parameters and SMC indicated that Fv/Fm was not affected by water stress, regardless of varieties. The yield components (panicle number, grain yield and 100-grain weight for both varieties greatly decreased when water stress was imposed at the panicle initiation stage. This study showed that the panicle initiation period was the most sensitive stage to water stress that contributed to a substantial reduction in yield for both varieties. Under the aerobic condition (control, MR253 produced higher panicle number, 100-grain weight and yield than MA1. Although MR253 is bred for lowland, it is well adapted to aerobic condition.

  14. TGF-β1 targets a microRNA network that regulates cellular adhesion and migration in renal cancer.

    Science.gov (United States)

    Bogusławska, Joanna; Rodzik, Katarzyna; Popławski, Piotr; Kędzierska, Hanna; Rybicka, Beata; Sokół, Elżbieta; Tański, Zbigniew; Piekiełko-Witkowska, Agnieszka

    2018-01-01

    In our previous study we found altered expression of 19 adhesion-related genes in renal tumors. In this study we hypothesized that disturbed expression of adhesion-related genes could be caused by microRNAs: short, non-coding RNAs that regulate gene expression. Here, we found that expression of 24 microRNAs predicted to target adhesion-related genes was disturbed in renal tumors and correlated with expression of their predicted targets. miR-25-3p, miR-30a-5p, miR-328 and miR-363-3p directly targeted adhesion-related genes, including COL5A1, COL11A1, ITGA5, MMP16 and THBS2. miR-363-3p and miR-328 inhibited proliferation of renal cancer cells, while miR-25-3p inhibited adhesion, promoted proliferation and migration of renal cancer cells. TGF-β1 influenced the expression of miR-25-3p, miR-30a-5p, and miR-328. The analyzed microRNAs, their target genes and TGF-β1 formed a network of strong correlations in tissue samples from renal cancer patients. The expression signature of microRNAs linked with TGF-β1 levels correlated with poor survival of renal cancer patients. The results of our study suggest that TGF-β1 coordinates the expression of microRNA network that regulates cellular adhesion in cancer. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Differential effects of FGFR2 mutations on syndactyly and cleft palate in Apert syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Slaney, S.F.; Oldridge, M.; Wilkie, A.O.M. [Univ. of Oxford (United Kingdom)] [and others

    1996-05-01

    Apert syndrome is a distinctive human malformation characterized by craniosynostosis and severe syndactyly of the hands and feet. It is caused by specific missense substitutions involving adjacent amino acids (Ser252Trp or Pro253Arg) in the linker between the second and third extracellular immunoglobulin domains of fibroblast growth factor receptor 2 (FGFR2). We have developed a simple PCR assay for these mutations in genomic DNA, based on the creation of novel SfiI and BstUI restriction sites. Analysis of DNA from 70 unrelated patients with Apert syndrome showed that 45 had the Ser252Trp mutation and 25 had the Pro253Arg mutation. Phenotypic differences between these two groups of patients were investigated. Significant differences were found for severity of syndactyly and presence of cleft palate. The syndactyly was more severe with the Pro253Arg mutation, for both the hands and the feet. In contrast, cleft palate was significantly more common in the Ser252Trp patients. No convincing differences were found in the prevalence of other malformations associated with Apert syndrome. We conclude that, although the phenotype attributable to the two mutations is very similar, there are subtle differences. The opposite trends for severity of syndactyly and cleft palate in relation to the two mutations may relate to the varying patterns of temporal and tissue-specific expression of different fibroblast growth factors, the ligands for FGFR2. 54 refs., 5 figs., 3 tabs.

  16. Integrated system for recommending fertilization rates in pineapple (Ananas comosus (L. Merr. crop

    Directory of Open Access Journals (Sweden)

    Sergio Salgado García

    2017-10-01

    Full Text Available In recent years much attention has focused on the impacts of agriculture on climate change, due to this stage specialists in plant nutrition and soil fertility have achieved the task of generating adequate fertilization doses for pineapple to reduce effects on environment. A methodology for Integrated System for Recommending Fertilizer Dose (ISRFD was used. As a result, seven Thiessen polygons of the average annual rainfall, where rainfall ranged from 1640 to 2841 mm was correlated. Therefore, three major soil groups were defined and classified as subunit level. Likewise, eight doses of fertilizers were generated as follows: N, P2O5 and K2O, with a fertilizer dose, a map is generated according to the cultivar: 230-138-300 for Creole pineapple in Acrisol Cutanic (Chromic, Ferric; 460-161-480 for Cayenne and MD2 in Acrisol Cutanic (Endoclayic, Ferric; 345-161-450 for Cayenne and MD2, 253-138-450 for Creole in Acrisol Cutanic (Endoclayic, Hyperdystric, Ferric; 391-161-450 for Cayenne and MD2 in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric and Acrisol Umbric Cutanic (Endoclayic, Hyperdystric, Ferric; 207-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric; 253-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic,Hyperdystric, Ferric; 253-138-360 for Creole in Acrisol Umbric Gleyic (Hyperdystric, Ferric; and 391-161-360 in Cambisol Endogleyic (Clayic, Eutric. These fertilizer doses were supplemented with micronutrients to obtain the expected results.

  17. Energy levels and radiative rates for transitions in Ti VI

    International Nuclear Information System (INIS)

    Aggarwal, K M; Keenan, F P; Msezane, A Z

    2013-01-01

    We report on calculations of energy levels, radiative rates, oscillator strengths and line strengths for transitions among the lowest 253 levels of the (1s 2 2s 2 2p 6 ) 3s 2 3p 5 , 3s3p 6 , 3s 2 3p 4 3d, 3s3p 5 3d, 3s 2 3p 3 3d 2 , 3s 2 3p 4 4s, 3s 2 3p 4 4p and 3s 2 3p 4 4d configurations of Ti VI. The general-purpose relativistic atomic structure package and flexible atomic code are adopted for the calculations. Radiative rates, oscillator strengths and line strengths are reported for all electric dipole (E1), magnetic dipole (M1), electric quadrupole (E2) and magnetic quadrupole (M2) transitions among the 253 levels, although calculations have been performed for a much larger number of levels. Comparisons are made with existing available results and the accuracy of the data is assessed. Additionally, lifetimes for all 253 levels are listed, although comparisons with other theoretical results are limited to only 88 levels. Our energy levels are estimated to be accurate to better than 1% (within 0.03 Ryd), whereas results for other parameters are probably accurate to better than 20%. A reassessment of the energy level data on the National Institute of Standards and Technology website for Ti VI is suggested. (paper)

  18. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  19. Fragmentation model of meteoroid motion, mass loss, and radiation in the atmosphere

    Czech Academy of Sciences Publication Activity Database

    Ceplecha, Zdeněk; ReVelle, D.O.

    2005-01-01

    Roč. 40, č. 1 (2005), s. 35-54 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : luminous efficiency * innisfree meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.253, year: 2005

  20. a study of parallel proverbs in akan (twi)

    African Journals Online (AJOL)

    conceptual/semantic similarity in terms of core meaning with regard to behavior towards palm-wine ..... populations and the evolution of human mitochondrial DNA.” Science 253 ..... NEG-REL-have sleep 2SG-NEG-know bedbugs wake. 3SG.

  1. 75 FR 26301 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-11

    ... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  2. 75 FR 25895 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of a Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  3. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    2014-01-01

    Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  4. PLASMA SPRAYING OF REFRACTORY CERMETS BY THE WATER-STABILIZED SPRAY (WSP®) SYSTEM

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Brožek, V.; Cheong, D.-I.; Chráska, Pavel

    2009-01-01

    Roč. 54, č. 3 (2009), s. 241-253 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20430508 Keywords : Plasma spraying * cermet coatings * microhardness * zirconium carbide * tungsten Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  5. Distribution of the common hamster in the Czech Republic after 2000: retreating to optimum lowland habitats

    Czech Academy of Sciences Publication Activity Database

    Tkadlec, Emil; Heroldová, Marta; Víšková, V.; Bednář, M.; Zejda, Jan

    2012-01-01

    Roč. 61, 3-4 (2012), s. 246-253 ISSN 0139-7893 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Cricetus cricetus * questionnaire * Rodentia Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  6. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

  7. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  8. Combat Neurosis in the Battered Teacher.

    Science.gov (United States)

    Science News, 1978

    1978-01-01

    Investigates the effect of school violence on classroom teachers. The study of 253 Los Angeles inner city classroom teachers reveals that many of them have developed conditions similar to the combat neurosis found in soldiers at war. (HM)

  9. Koolera paneb Haiti valmiduse proovile / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Haitis puhkenud koolerapuhang on nõudnud juba 253 inimelu, nakatunute arv ületab 3100 piiri, bakter võib sealsete ebahügieeniliste olude tõttu kaasa tuua teise humanitaarkatastroofi pärast 12. jaanuari maavärinat. Kaart

  10. Gas hydrate contribution to Late Permian global warming

    Czech Academy of Sciences Publication Activity Database

    Majorowicz, J.; Grasby, S. E.; Šafanda, Jan; Beauchamp, B.

    2014-01-01

    Roč. 393, May (2014), s. 243-253 ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Latest Permian extinction * gas hydrates * carbon isotope shift Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  11. Nova espécie de Bronia Gray, 1845, do Estado do Tocantins, Brasil (Squamata: Amphisbaenidae

    Directory of Open Access Journals (Sweden)

    Carolina Castro-Mello

    2003-01-01

    Full Text Available Bronia saxosa, sp. n., localidade tipo UHE Luis Eduardo Magalhães, Estado do Tocantins, difere das demais espécies de Bronia Gray, 1865, principalmente por possuir nasais pequenas separadas pela rostral. A nova espécie possui 4 poros, 253-272 anéis corporais, 17-21 anéis caudais, 18-24/1621 segmentos em um anel no meio do corpo.Bronia saxosa, sp. n. from the state of Tocantins, Brasil, (Hydroelectric Dam Luis Eduardo Magalhães, 09°45'S, 48°21'W, a cerrado area, differs from the remainining species of the genus mainly by having small nasals scutes separated by the rostral. It has (82 specimens 4 preanal pores, 253-272 body annuli, 17-21 tail annuli and 18-24/16-21 segments to a midbody annulus.

  12. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  13. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    ... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...

  14. Large-Scale Systems Control Design via LMI Optimization

    Czech Academy of Sciences Publication Activity Database

    Rehák, Branislav

    2015-01-01

    Roč. 44, č. 3 (2015), s. 247-253 ISSN 1392-124X Institutional support: RVO:67985556 Keywords : Combinatorial linear matrix inequalities * large-scale system * decentralized control Subject RIV: BC - Control Systems Theory Impact factor: 0.633, year: 2015

  15. Instructional Support for Novice Law Students: Reducing Search Processes and Explaining Concepts in Cases

    NARCIS (Netherlands)

    Nievelstein, Fleurie; Van Gog, Tamara; Van Dijck, Gijs; Boshuizen, Els

    2010-01-01

    Nievelstein, F., Van Gog, T., Van Dijck, C., & Boshuizen, H. P. A. (2011). Instructional support for novice law students: Reducing search processes and explaining concepts in cases. Applied Cognitive Psychology, 25(3), 408-413. doi:10.1002/acp.1707

  16. Gender differences in Parkinson's disease

    NARCIS (Netherlands)

    Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.

    Objective: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). Methods: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists ( disease duration Results: Age at onset

  17. Gender differences in Parkinson's disease.

    NARCIS (Netherlands)

    Haaxma, C.A.; Bloem, B.R.; Borm, G.F.; Oyen, W.J.G.; Leenders, K.L.; Eshuis, S.; Booij, J.; Dluzen, D.E.; Horstink, M.W.I.M.

    2007-01-01

    OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We

  18. Gender differences in Parkinson's disease

    NARCIS (Netherlands)

    Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.

    2007-01-01

    OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We

  19. Characterization of 6 Bacillus subtilis β-mannanases and their genes

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-15

    Sep 15, 2009 ... seeds of Lactuca sativa (Nascimento et al., 2004), ..... 25(3): 25-32. Mao S (2000). Application of β-mannanase in production of animals [J]. ... endo-β-mannanase activity during lettuce seed germination at high temperature[J].

  20. Fossil mega- and microflora from the Březno Beds s.s. (Bohemian Cretaceous Basin, Coniacian)

    Czech Academy of Sciences Publication Activity Database

    Halamski, A. T.; Kvaček, J.; Svobodová, Marcela

    2018-01-01

    Roč. 253, June 2018 (2018), s. 123-138 ISSN 0034-6667 Institutional support: RVO:67985831 Keywords : fossil plant * Cretaceous * taxonomy * paleobotany * Coniacian * Czech Republic Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.817, year: 2016