International Nuclear Information System (INIS)
Moore, J.R.
1988-03-01
A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs
Medical applications of californium-252
International Nuclear Information System (INIS)
Oliver, G.D. Jr.
1975-01-01
Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)
Californium-252 progress, report No. 7, April 1971
Energy Technology Data Exchange (ETDEWEB)
1971-12-31
This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.
Radiography using californium-252 neutron sources
International Nuclear Information System (INIS)
Ray, J.W.
1975-01-01
The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)
Historical review of californium-252 discovery and development
International Nuclear Information System (INIS)
Stoddard, D.H.
1985-01-01
This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed
Californium-252 sales and loans at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
King, L.J.
1987-01-01
The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point
Fabrication of californium-252 sources in the United Kingdom
International Nuclear Information System (INIS)
Ainsworth, A.; Brady, M.W.; Thornett, W.H.
1975-01-01
The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)
Biomedical neutron research at the Californium User Facility for neutron science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1997-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy
Biomedical neutron research at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1998-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)
Californium Multiplier. Part I. Design for neutron radiography
International Nuclear Information System (INIS)
Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.
1982-01-01
The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX
Californium-252 radiotherapy sources for interstitial afterloading
International Nuclear Information System (INIS)
Permar, P.H.; Walker, V.W.
1976-01-01
Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute
Uranium standards for Californium Shuffler
International Nuclear Information System (INIS)
Gibbs, A.; Boynton, S.P.
1978-10-01
The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis
Californium-252: a remarkable versatile radioisotope
International Nuclear Information System (INIS)
Osborne-Lee, I.W.; Alexander, C.W.
1995-01-01
A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein
Californium-252: a remarkable versatile radioisotope
Energy Technology Data Exchange (ETDEWEB)
Osborne-Lee, I.W.; Alexander, C.W.
1995-10-10
A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.
International Nuclear Information System (INIS)
Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.
2011-01-01
Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)
Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
Martin, R.C.; Laxson, R.R.; Knauer, J.B.
1996-01-01
The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests
International Nuclear Information System (INIS)
1974-01-01
The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September
Production, Distribution, and Applications of Californium-252 Neutron Sources
International Nuclear Information System (INIS)
Balo, P.A.; Knauer, J.B.; Martin, R.C.
1999-01-01
The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations
International Nuclear Information System (INIS)
Taylor, G.N.
1985-01-01
Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline
International Nuclear Information System (INIS)
Wallace, C.R.
1995-01-01
In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather
International Nuclear Information System (INIS)
Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.
1983-01-01
Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed
International Nuclear Information System (INIS)
1975-01-01
This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)
X-ray-diffraction study of californium metal to 16 GPa
International Nuclear Information System (INIS)
Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.
1983-01-01
The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa
Study of the shielding for spontaneous fission sources of Californium-252
International Nuclear Information System (INIS)
Davila R, I.
1991-06-01
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
International Nuclear Information System (INIS)
Landolt, R.R.; Hem, S.L.
1983-01-01
A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well
Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis
International Nuclear Information System (INIS)
Zimmer, W.H.
1976-08-01
The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized
Californium oxygen system for 1.50 < O/Cf < 1.72
International Nuclear Information System (INIS)
Turcotte, R.P.; Haire, R.G.
1975-01-01
The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)
Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Assessment of the neutron component in a neutron-gamma field of a californium-252 source
International Nuclear Information System (INIS)
Tetteh, G.K.
1978-12-01
Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Measurements of integral cross sections in the californium-252 fission neutron spectrum
International Nuclear Information System (INIS)
Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.
1977-01-01
In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed
International Nuclear Information System (INIS)
Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.
1983-01-01
A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)
International Nuclear Information System (INIS)
Muhammad Fakhrurreza; Kusminanto; Y Sardjono
2014-01-01
In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)
Calibration of a Modified Californium Shuffler
International Nuclear Information System (INIS)
Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.
1995-01-01
A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers
International Nuclear Information System (INIS)
RASMUSSEN, O.R.
2000-01-01
This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies
Prompt neutron spectrum of the spontaneous fission of californium-252
International Nuclear Information System (INIS)
Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.
1976-01-01
The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references
International Nuclear Information System (INIS)
Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.
1980-01-01
An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations
Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.
1990-01-01
The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined
Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.
1990-01-01
Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined
Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102
International Nuclear Information System (INIS)
Sederburg, J.P.
1994-01-01
This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; HUBER HJ
2011-04-21
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
A californium-252 source for radiobiological studies at Hiroshima University
International Nuclear Information System (INIS)
Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo
1987-01-01
A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)
Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2014-09-04
This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Californium production at the transuranium processing plant
International Nuclear Information System (INIS)
King, L.J.
1976-01-01
The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material
International Nuclear Information System (INIS)
Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.
1991-01-01
A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab
Energy Technology Data Exchange (ETDEWEB)
Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)
1996-03-01
Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.
Acceptance test procedure, 241-SY-101/241-C-106 shot loading system
International Nuclear Information System (INIS)
Ostrom, M.J.
1994-01-01
This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations
Czech Academy of Sciences Publication Activity Database
Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.
2005-01-01
Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005
International Nuclear Information System (INIS)
Duncan, J.B.; Huber, H.J.
2011-01-01
This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using
Energy Technology Data Exchange (ETDEWEB)
Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)
2016-09-15
Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.
Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code
International Nuclear Information System (INIS)
Antoniak, Z.I.; Recknagle, K.P.
1995-07-01
The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations
24 CFR 241.1005 - Definitions.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...
Energy Technology Data Exchange (ETDEWEB)
Davila R, I
1991-06-15
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
Experimental studies on californium bioavailability to marine benthic invertebrates
International Nuclear Information System (INIS)
Fowler, S.W.; Carvalho, F.P.; Aston, S.R.
1986-01-01
252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)
International Nuclear Information System (INIS)
HILL, J.S.
2000-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...
International Nuclear Information System (INIS)
Mangeng, C.A.; Thayer, G.R.
1984-05-01
This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues
Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2
International Nuclear Information System (INIS)
Lee, Ki-Man; Kim, Eun-Hee
2015-01-01
The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV
International Nuclear Information System (INIS)
Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong
2011-01-01
Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.
Teratogenic effect of Californium-252 irradiation in rats
International Nuclear Information System (INIS)
Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro
1989-01-01
The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)
40 CFR 436.241 - Specialized definitions.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...
Energy Technology Data Exchange (ETDEWEB)
Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)
1965-10-15
The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author
International Nuclear Information System (INIS)
Ingle, S.J.
1996-03-01
This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility
Americium-241 in bile and feces
International Nuclear Information System (INIS)
LoSasso, T.; Cohen, N.; Wrenn, M.E.
1977-01-01
In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route
49 CFR 241.17 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...
10 CFR 600.241 - Financial reporting.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...
12 CFR 335.241 - Unlisted trading.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...
42 CFR 413.241 - Pharmacy arrangements.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...
24 CFR 241.1235 - Cross default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...
Am-241 buildup in nematode organisms
International Nuclear Information System (INIS)
Martyushov, V.Z.; Tarasov, O.V.
1990-01-01
The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped
Energy Technology Data Exchange (ETDEWEB)
Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G
1976-07-01
..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.
Determination of 241Am in reindeer bone
International Nuclear Information System (INIS)
Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.
1978-01-01
The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden
Biosorption of americium-241 by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali
2003-01-01
As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
International Nuclear Information System (INIS)
BLACKER, S.M.
2000-01-01
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented
Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107
Energy Technology Data Exchange (ETDEWEB)
BLACKER, S.M.
2000-04-13
This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.
Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K
2017-09-01
Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is
International Nuclear Information System (INIS)
Crawford, B.A.
1996-01-01
This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined
Biosorption of 241Am by Candida sp
International Nuclear Information System (INIS)
Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng
2003-01-01
The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm
Neutron activation analysis at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.
1997-12-01
The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis
Biosorption of americium-241 by immobilized Rhizopus arrihizus
International Nuclear Information System (INIS)
Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji
2004-01-01
Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3
Plant uptake and transport of 241Am
International Nuclear Information System (INIS)
Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.
1981-01-01
We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2014-01-01
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)
2014-01-08
This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Application of californium-252 neutron sources for analytical chemistry
International Nuclear Information System (INIS)
Ishii, Daido
1976-01-01
The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)
International Nuclear Information System (INIS)
Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.
1985-01-01
Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated
Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204
International Nuclear Information System (INIS)
Simpson, B.C.
1998-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center
Investigation of Tank 241-AN-101 Floating Solids
Energy Technology Data Exchange (ETDEWEB)
Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)
2017-10-30
Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.
24 CFR 241.1245 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.1245... Rights and Obligations § 241.1245 Insurance endorsement. (a) Endorsement. The Commissioner shall indicate his insurance of the equity loan or acquisition loan by endorsing the original credit instrument and...
24 CFR 241.570 - Insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.570... § 241.570 Insurance endorsement. (a) Initial endorsement. The Commissioner shall indicate his/her insurance of the mortgage by endorsing the original credit instrument and identifying the section of the Act...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
Determination of plutonium-241 half-life by mass spectrometric measurement
International Nuclear Information System (INIS)
Hiyama, Takashi; Wada, Yukio; Onishi, Koichi
1982-01-01
Much data for Pu-241 half-life have been reported, but these values range from 13.8 years to 15.1 years depending on investigators. In order to define the half-life of Pu-241, the half-life was calculated by analyzing the mass spectrometry data obtained in the author's laboratory over the past six years on Plutonium Isotopic Standard Reference Materials prepared at the National Bureau of Standards (NBS). The sample used for this work consisted of SRM-947 and SRM-948 prepared at NBS. Before mass spectrometric analysis, the plutonium aliquot was separated from its Am-241 daughter by anion exchange chromatography, since Am-241 is not distinguished from Pu-241 in the mass spectrometer. 241 Pu/ 239 Pu and 241 Pu/ 240 Pu ratios were calculated from the values of mass spectrometric measurement. From the relation of log N to time, the half-life of Pu-241 was determined, based on the slope using a least squares fit. The half-life of Pu-241 was estimated to be 14.29+-0.15 years. (Yoshitake, I.)
Distribution and Excretion of Am-241 in Rats
International Nuclear Information System (INIS)
Alatas, Z; Nurhayati, S; Rahardjo, T
1996-01-01
Determination of the activity content of Am-241 administered oral y in several organs and tissues of white rats including the excretion had been carried out. The observation of Am-241 activity was carried out through surgery and for the excretion of the radionuclide by collecting urine and faces. The surgeries were conducted on the 0 (6 hours), 1, 2, 3, 4, 5, 15 and 30th day post administration of 2.965 kBq Am-241, whereas the urine and faces collections were done every other day for 30 days using metabolism cage. The result indicated that the distribution of Am-241 which found in all tested organs/tissues with various fraction is considered as the initial distribution of Am-241 in rats. The content of americium in gastrointestinal tract and lung is relatively high within the first week post contamination. And, americium activities in other organs/tissues are various with time. The excretion of Am-241 is higher via feces than that of urin, i.e up to 20% in 30 days
Tank 241-C-103 headspace flammability
International Nuclear Information System (INIS)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report
Tank 241-C-103 headspace flammability
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1994-01-01
Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.
24 CFR 241.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 241.885 Section... § 241.885 Insurance benefits. (a) Method of payment. Payment of claims shall be made in the following... acceptable assignment of the note and security instrument to the Commissioner, the insurance benefits shall...
Sorption of 241Am by Aspergillus niger spore and hyphae
International Nuclear Information System (INIS)
Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao
2004-01-01
Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)
24 CFR 241.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 241.805 Section... Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
International Nuclear Information System (INIS)
Bringer, O.
2007-10-01
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)
International Nuclear Information System (INIS)
Sharma, S.
1986-01-01
A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields
Effect of americium-241 on luminous bacteria. Role of peroxides
Energy Technology Data Exchange (ETDEWEB)
Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)
2011-04-15
The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.
International Nuclear Information System (INIS)
King, C.M.; Bryan, S.A.
1999-01-01
This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
24 CFR 241.1070 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...
Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system
International Nuclear Information System (INIS)
Hill, L.F.
1997-01-01
This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors
Effect of gavaged chemical form of 241Am on its retention in mice
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1987-01-01
The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate
24 CFR 241.890 - Characteristics of debentures.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...
Vertical distribution of 241Pu in the southern Baltic Sea sediments
International Nuclear Information System (INIS)
Strumińska-Parulska, Dagmara I.
2014-01-01
Highlights: • The unique study on 241 Pu in sediments from the southern Baltic Sea was presented. • 241 Pu was determined using alpha spectrometry by indirect method. • The biggest amount of 241 Pu existed in the surface layers of all analyzed sediments. • The highest 241 Pu amount comes from the Chernobyl accident. - Abstract: The vertical distribution of plutonium 241 Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, 241 Pu/ 239+240 Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of 241 Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of 241 Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
International Nuclear Information System (INIS)
Doll, Stephanie R.; Bolling, Stacie D.
2016-01-01
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, ''Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.'' The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples
Energy Technology Data Exchange (ETDEWEB)
Doll, Stephanie R. [Washington River Protection Solutions, Richland, WA (United States); Bolling, Stacie D. [Washington River Protection Solutions, Richland, WA (United States)
2016-07-14
Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, “Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.” The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.
24 CFR 241.1030 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 241... Loans-Eligibility Requirements § 241.1030 Mortgage insurance premiums. The lender, upon endorsement of the note, shall pay the Commissioner a first mortgage insurance premium equal to 0.5 percent of the...
241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-25
This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.
24 CFR 241.830 - Definition of default.
2010-04-01
... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...
Energy Technology Data Exchange (ETDEWEB)
Bringer, O
2007-10-15
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)
24 CFR 241.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...
241-AY/AZ waste storage tanks: Supplemental gravity load analysis. Volume 1
International Nuclear Information System (INIS)
Baliga, R.
1994-01-01
An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AY/AZ tanks and therefore, an interim analysis of the 241AY/AZ tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AY and 241AZ tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AY/AZ tanks; and to evaluate the effect of additional dome load on the 241AY/AZ tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENTS's additional scope of work is to perform a qualitative evaluation of the 241AY/AZ tanks for seismic and thermal loadings (Vollert 1982 and Blume 1971). This qualitative evaluation does not include any detailed finite element analysis of the tanks. The following design-based gravity loading conditions are used in this interim analysis of the 241AY/AZ tanks to determine a baseline for the tank stresses or section loads
24 CFR 241.560 - Agreed interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1998-01-01
An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in
Speciation and bioavailability of Americium-241 in the fresh water environment
International Nuclear Information System (INIS)
Bierkens, J.
1986-01-01
Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics
Tank characterization data report: Tank 241-C-112
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.
Tank characterization data report: Tank 241-C-112
International Nuclear Information System (INIS)
Simpson, B.C.; Borsheim, G.L.; Jensen, L.
1993-09-01
Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable
24 CFR 241.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...
8 CFR 241.3 - Detention of aliens during removal period.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Detention of aliens during removal period. 241.3 Section 241.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.3 Detention of...
Energy Technology Data Exchange (ETDEWEB)
Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-07-01
This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.
International Nuclear Information System (INIS)
Vukanac, I.; Novkovic, D.; Djurasevic, M.; Obradovic, Z.; Kandi, A.
2006-01-01
The surface air samples collected in the first half of May 1986 at Vinca- Belgrade site were prepared and measured at the end of the 1991 and beginning of the 1992. year. Activity concentrations of the 137 Cs immediately after the Chernobyl accident were determined by means of gamma spectrometry, while the air activity concentration of 238 Pu and 239,240 Pu were determined by alpha spectrometry, after the plutonium radiochemical separation. The 236 Pu was used as a tracer. The same samples were remeasured after 13 years, during the 2004. The surface air activity concentrations of 241 Pu were estimated by a 241 Am in-growth method. The built up activities of 236 Pu progenies were determined from the recorded spectra and also calculated using the Bateman equations. The 241 Am activity in the remeasured samples, obtained by complex spectral analysis was confirmed by gamma spectrometry. The 241 Pu activity concentration in measured air samples ranged from 240 μBq/m3 to 7800 μBq/m3. The average activity concentration ratio 241 Pu/ 239,240 Pu originated from Chernobyl accident was approximately 100. (authors)
Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252
International Nuclear Information System (INIS)
Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.
1975-01-01
Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr
Hanford Single Shell Tank Leak Causes and Locations - 241-TX Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, C. L.; Harlow, D> G.
2014-07-22
This document identifies 241-TX Tank Farm (TX Farm) leak causes and locations for the 100 series leaking tanks (241-TX-107 and 241-TX-114) identified in RPP-RPT-50870, Rev. 0, Hanford 241-TX Farm Leak Inventory Assessment Report. This document satisfies the TX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
Shultz, M.V.
1999-01-01
Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
Placental transfer and distribution of 241Am in the rat
International Nuclear Information System (INIS)
Hisamatsu, S.; Takizawa, Y.
1983-01-01
The placental transfer and distribution of 241 Am in the feto-placental system were studied in pregnant rats. Rats were injected intravenously with 241 Am citrate at 15 or 18 days of gestation. Groups injected at 15 days of gestation were sacrificed 2, 24, 48, or 120 hr after injection, and the group injected at 18 days was sacrificed 24 hr after. The radioactivities of 241 Am in fetus, fetal membrane, and placenta were determined, and its distribution in the feto-placental system was investigated by high-speed autoradiography using a silver-activated zinc sulfide-coated membrane as an intensifying screen. The deposition of 241 Am in feto-placenta units increased with the number of days of gestation. Results of autoradiography revealed that major deposition sites of 241 Am in the fetus are the skeleton and liver. Heavy deposition of 241 Am in the yolksac splanchnopleure and its existence in the exocoelom strongly suggest that the yolk sac placenta plays an important role in the placental transfer of this nuclide
Determination of 241Pu by low level β-proportional counting
International Nuclear Information System (INIS)
Rosner, G.; Hoetzl, H.; Winkler, R.
1992-01-01
A chemical separation procedure is described which allows the direct determination of low 241 Pu activities in environmental samples with a windowless gas-flow proportional counter. While current separation schemes based on anion exchange yield counting sources of sufficient purity for subsequent α-spectrometry, for β-counting of 241 Pu additional purification steps are required. A combination of anion exchange from 9 mol/1 HCl, LaF 3 precipitation and TTA extraction was found to be suitable even for analysis of long-range Chernobyl fallout samples which contained interfering radionuclides with β-activities at least 3 to 4 orders of magnitude higher than usually encountered. No difference is detectable between the results of the present, direct procedure and the results of the conventional indirect method based on the build-up of 241 Am. Average 241 Pu/ 239+241 Pu ratios in air and deposition samples taken at Neuherberg near Munich were 70±6 with the present procedure and 66±9 from 241 Am build-up. (author) 29 refs.; 3 tabs
International Nuclear Information System (INIS)
Guilmette, R.A.; Cohen, N.; Wrenn, M.E.
1975-01-01
Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)
Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data
International Nuclear Information System (INIS)
Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.
2004-01-01
This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material
5 CFR 838.241 - Cost-of-living adjustments.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...
International Nuclear Information System (INIS)
Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.
1979-01-01
With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women
Multilevel resonance parameters of 241Pu
International Nuclear Information System (INIS)
Weston, L.W.; Todd, J.H.
1978-01-01
The data previously reported by the authors on the neutron fission and capture cross sections of 241 Pu were simultaneously fit with the Adler formalism to obtain multilevel resonance parameters. The neutron energy range of the fit was 0.01 to 100 eV. The 241 Pu cross sections in the resonance region of neutron energies are complex, and the Adler parameters present an efficient method of representing these cross sections, which are important for plutonium-fueled reactors. The parameters represent the data to an accuracy within the quoted experimental errors. 5 figures, 2 tables
Biosorption of radionuclide Americium-241 by A. niger spore and hyphae
International Nuclear Information System (INIS)
Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling
2002-01-01
The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident
40 CFR 51.241 - Nonattainment areas for carbon monoxide and ozone.
2010-07-01
... Intergovernmental Consultation Agency Designation § 51.241 Nonattainment areas for carbon monoxide and ozone. (a... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Nonattainment areas for carbon monoxide and ozone. 51.241 Section 51.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
Directory of Open Access Journals (Sweden)
Clayton Dickerson
2013-02-01
Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.
Tank 241-T-201, core 192 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-08-07
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.
Tank 241-T-204, core 188 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-07-24
TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.
Tank 241-T-201, core 192 analytical results for the final report
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report
8 CFR 241.9 - Notice to transportation line of alien's removal.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.9...
8 CFR 241.10 - Special care and attention of removable aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special care and attention of removable aliens. 241.10 Section 241.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.10...
Decorporation of 241Am in beagles by DTPA
International Nuclear Information System (INIS)
Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.
1975-01-01
Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-08-05
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
241-Z-361 Sludge Characterization Sampling and Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
BANNING, D.L.
1999-07-29
This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.
8 CFR 241.15 - Countries to which aliens may be removed.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Countries to which aliens may be removed. 241.15 Section 241.15 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.15 Countries to...
241-AY-101 Tank Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.
2013-08-26
This report provides the results of an extent of condition construction history review for tank 241-AY-101. The construction history of tank 241-AY-101 has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In tank 241-AY-101, the second double-shell tank constructed, similar issues as those with tank 241-AY-102 construction reoccurred. The overall extent of similary and affect on tank 241-AY-101 integrity is described herein.
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
International Nuclear Information System (INIS)
Conner, J.C.
1996-01-01
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices
Interim safety equipment list for 241-C-106 waste retrieval, project W-320
Energy Technology Data Exchange (ETDEWEB)
Conner, J.C.
1996-01-25
The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.
241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.
2013-11-19
This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.
International Nuclear Information System (INIS)
Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.
2012-12-01
This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)
Long-term effects of an intracavitary treatment with californium-252 on normal tissue
International Nuclear Information System (INIS)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra
National low-level waste management program radionuclide report series, Volume 14: Americium-241
International Nuclear Information System (INIS)
Winberg, M.R.; Garcia, R.S.
1995-09-01
This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ( 241 Am). This report also includes discussions about waste types and forms in which 241 Am can be found and 241 Am behavior in the environment and in the human body
Americium-241 in surface soil associated with the Hanford site and vicinity
International Nuclear Information System (INIS)
Price, K.R.; Gilbert, R.O.; Gano, K.A.
1981-05-01
Various kinds of surface soil samples were collected and analyzed for Americium-241 ( 241 Am) to examine the feasibility of improving soil sample data for the Hanford Surface Environmental Surveillance Program. Results do not indicate that a major improvement would occur if procedures were changed from the current practices. Conclusions from this study are somewhat tempered by the very low levels of 241 Am ( 241 Am in soil crust (0 to 1.0 cm deep) was greater than the corresponding subsurface layer (1.0 to 2.5 cm deep), and the average concentration of 241 Am in some onsite samples collected near the PUREX facility was greater than comparable samples collected 60 km upwind at an offsite location
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM
Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102
International Nuclear Information System (INIS)
SHULTZ, M.V.
1999-01-01
Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis
Tank 241-T-203, core 190 analytical results for the final report
International Nuclear Information System (INIS)
Steen, F.H.
1997-01-01
This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Geisy, J P; Paine, D
1978-01-01
Algae and bacteria are important factors in the transport and mobilization of elements in the biosphere. These factors may be involved in trophic biomagnification, resulting in a potential human hazard or environmental degradation. Although americium, one of the most toxic elements known, is not required for plant growth, it may be concentrated by algae and bacteria. Therefore, the availability of americium-241 to algae and bacteria was studied to determine their role in the ultimate fate of this element released into the environment. Both algae and bacteria concentrated americium-241 to a high degree, making them important parts of the biomagnification process. The ability to concentrate americium-241 makes algae and bacteria potentially significant factors in cycling this element in the water column. (4 graphs, numerous references, 3 tables)
Alpha spectrum analysis of 241Am in the urine
International Nuclear Information System (INIS)
Qiu Yongmei; Yang Yong
2006-10-01
With 241 Am as indicator, americium in the urine was concentrated by the method of codeposition, then it was purified by the method of anion exchange, at last, the americium was electroplated. 241 Am in the urine was analysed by six channel low level alpha measuring instrument and Alpha Spectrometer. The results show that the recovering ratio is beyond 60% under the condition that the indicator added to the urine is at the level of mBq. So, 241 Am in the urine can be quantitatively analysed by this method, uncertainty of the result is under 40%, detection limit of the instrument is under 10 -4 Bq. (authors)
Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-07-30
This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
Hanford Single-Shell Tank Leak Causes and Locations - 241-A Farm
Energy Technology Data Exchange (ETDEWEB)
Girardot, Crystal L.; Harlow, Donald G.
2013-09-10
This document identifies 241-A Tank Farm (A Farm) leak causes and locations for the 100 series leaking tanks (241-A-104 and 241-A-105) identified in RPP-ENV-37956, Hanford A and AX Farm Leak Assessment Report. This document satisfies the A Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.
20 CFR 404.241 - 1977 simplified old-start method.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false 1977 simplified old-start method. 404.241... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.241 1977 simplified old-start method. (a) Who is qualified. To qualify for the old...
Tank 241-Z-361 process and characterization history
International Nuclear Information System (INIS)
Jones, S.A.
1997-01-01
This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of 20 plus years ago. Records of transfers into the tank, past characterization efforts, and speculation will be used to estimate the current condition of Tank 241-Z-361 and its contents
Riser configuration, Tank 241-A-105, light duty utility arm
International Nuclear Information System (INIS)
Boucher, T.D.
1994-01-01
The light-duty utility arm (LDUA) is a seven-joint stainless steel robotic arm with a payload capacity of 75 lb. The robotic arm is deployed vertically with a maximum vertical reach of 63 ft. and a maximum horizontal reach of 13.5 ft. The functional requirements of the LDUA system are mapping and characterization of waste in Hanford single-shell tanks (SST) before and during waste retrieval. The LDUA system consists of a mobile deployment system (MDS), a vertical positioning mast (VPM), a tank riser interface confinement (TRIC), the LDUA, and a controller subsystem or support trailer. Currently, the system is in design and is subject to change; however, the LDUA or robotic arm will be deployed through a 12-in. riser above the tank dome. Field trips were performed to gather specifics for future deployment of the LDUA in Tank 241-A-105. The purpose of this report is to support two previous reports for the investigation of SSTs for deployment of the LDUA system. The first report identified the availability of risers while the second report identified the availability of Tanks 241-A-105, 241-A-S-109, 241-A-T-101, and 241-A-T-109 for deployment of the LDUA system. The second report also identified those 4- and 12-in. risers that could be used for deployment of the LDUA and camera system. This report addresses accessibility to the 241-A Tank Farm and the usability of the Tank 241-A-105 risers. The following information for assisting in the design and deployment of the LDUA will be discussed in this report: radiation survey; flange identification; high resolution video; computer simulated model; and field survey
241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-30
This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.
Vertical distribution of (241)Pu in the southern Baltic Sea sediments.
Strumińska-Parulska, Dagmara I
2014-12-15
The vertical distribution of plutonium (241)Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, (241)Pu/(239+240)Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of (241)Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of (241)Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident. Copyright © 2014 Elsevier Ltd. All rights reserved.
Comparison of effectiveness of four chelating agents in removing incorporated sup 241 Am
Energy Technology Data Exchange (ETDEWEB)
Mingyue, Lun; Yumin, Wang; Zhikang, Wei [Ministry of Nuclear Industry, Taiyuan, SX (China). Inst. of Radiation Protection; and others
1988-02-01
The effectiveness of four chelating agents (Ca-DTPA, Zn-DTPA, quinamic acid and H-73-10) in removing incorporated {sup 241}Am was studied on 200 rats. The results show that Ca-DTPA and Zn-DTPA are more effective than the others. They decreased the {sup 241}Am contents in the rat liver and skeleton down to only about 5 and 10 per cent of the control values, respectively. Quinamic acid has the same effectiveness in reducing the {sup 241}Am contents in the rat skeleton and liver as that of DTPA, but it leads to the cumulation of {sup 241}Am in the kidney, i. e., the {sup 241}Am content in the kidney is even higher than that in control rats. Although H-73-10 can remove {sup 241}Am from the rat organs, it is much less effective than DTPA.
Feasibility and market potential of protein determination of wheat using californium-252
International Nuclear Information System (INIS)
Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.
1976-01-01
To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit
Recovery of Americium-241 from lightning rod by the method of chemical treatment
International Nuclear Information System (INIS)
Cruz, W.H.
2013-01-01
About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)
Operational test report for the 241-A-701 air compressor upgrade
Energy Technology Data Exchange (ETDEWEB)
Meeuwsen, W.E.
1997-06-30
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.
International Nuclear Information System (INIS)
Biermans, Geert; Horemans, Nele; Vanhoudt, Nathalie; Vandenhove, Hildegarde; Saenen, Eline; Van Hees, May; Wannijn, Jean; Vangronsveld, Jaco; Cuypers, Ann
2015-01-01
Human activity has led to an increasing amount of radionuclides in the environment and subsequently to an increased risk of exposure of the biosphere to ionising radiation. Due to their high linear energy transfer, α-emitters form a threat to biota when absorbed or integrated in living tissue. Among these, 241 Am is of major concern due to high affinity for organic matter and high specific activity. This study examines the dose-dependent biological effects of α-radiation delivered by 241 Am at the morphological, physiological and molecular level in 14-day old seedlings of Arabidopsis thaliana after hydroponic exposure for 4 or 7 days. Our results show that 241 Am has high transfer to the roots but low translocation to the shoots. In the roots, we observed a transcriptional response of reactive oxygen species scavenging and DNA repair pathways. At the physiological and morphological level this resulted in a response which evolved from redox balance control and stable biomass at low dose rates to growth reduction, reduced transfer and redox balance decline at higher dose rates. This situation was also reflected in the shoots where, despite the absence of a transcriptional response, the control of photosynthesis performance and redox balance declined with increasing dose rate. The data further suggest that the effects in both organs were initiated in the roots, where the highest dose rates occurred, ultimately affecting photosynthesis performance and carbon assimilation. Though further detailed study of nutrient balance and 241 Am localisation is necessary, it is clear that radionuclide uptake and distribution is a major parameter in the global exposure effects on plant performance and health. - Highlights: • Arabidopsis thaliana was exposed hydroponically to a range of 241 Am concentrations. • Effects at molecular, morphological and physiological level were observed. • Effects were dependent on both dose rate and 241 Am distribution.
48 CFR 52.241-1 - Electric Service Territory Compliance Representation.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Electric Service Territory Compliance Representation. 52.241-1 Section 52.241-1 Federal Acquisition Regulations System FEDERAL... utility franchises or service territories established pursuant to State statute, State regulation, or...
{sup 241}Pu concentrations in water, plankton and fish from the southern Baltic Sea
Energy Technology Data Exchange (ETDEWEB)
Struminska-Parulska, D.I.; Skwarzec, B. [Gdansk, Univ. (Poland). Facuty of Chemistry
2013-08-01
The aim of the work was to determine {sup 241}Pu activities in different components (water, plankton and fish) of the southern Baltic Sea ecosystem. Measurement of {sup 241}Pu in the samples was done indirectly by determining the increment in {sup 241}Am from the decay of the {beta}-emitting {sup 241}Pu in samples collected 10-15 years after the Chernobyl accident. Enhanced levels of {sup 241}Pu were observed in all analyzed Baltic samples. The highest {sup 241}Pu concentrations in fish were found in Perciformes: benthic round goby (0.863 {+-} 0.066 mBq/g ww) and pelagic perch (0.666 {+-} 0.001 mBq/g ww). Plutonium is also non-uniformly distributed in the organs and tissues of the analyzed fish; especially pelagic herring and cod as well as benthic flounder. Most of {sup 241}Pu in flounder, herring and cod is located in soft tissues, especially digestive organs (stomach, intestine, liver). The annual individual effective doses calculated on the basis of {sup 241}Pu concentrations in fish indicated that the impact of the consumption of {sup 241}Pu containing Baltic fish on the annual effective dose for a statistical inhabitant of Poland was very small. (orig.)
Operational test report for the 241-A-701 air compressor upgrade
International Nuclear Information System (INIS)
Meeuwsen, W.E.
1997-01-01
A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis
International Nuclear Information System (INIS)
Cardoso, Antonio
1976-01-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
International Nuclear Information System (INIS)
Himes, D.A.
1998-01-01
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems
Energy Technology Data Exchange (ETDEWEB)
Himes, D.A.
1998-08-11
The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated
Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout
Energy Technology Data Exchange (ETDEWEB)
Ewalt, J.R.
1993-09-01
In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.
8 CFR 241.21 - Stay of deportation of excluded alien.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Stay of deportation of excluded alien. 241.21 Section 241.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings Commenced...
Estimation of cross talk between lungs and liver for 241Am using phoswich detector
International Nuclear Information System (INIS)
Mishra, Lokpati; Nadar, Minal Y.; Singh, I.S.; Sawant, P.D.
2018-01-01
241 Am is used as a tracer for in-vivo assessment of plutonium (Pu) in the lungs. Internal contamination of 241 Am is estimated by measuring its 59.5 keV photons then activity of Pu is estimated by applying Pu/ 241 Am ratio obtained from radiochemical analysis of fecal/workplace sample. According to ICRP systemic bio-kinetic model, for Type M compounds of 241 Am after 100 days post inhalation intake, 241 Am activity in liver exceeds 241 Am activity present in the lungs and goes on increasing even up to about ten years. In this work, cross talk (CT) between lungs and liver viz. CT (liver to lungs) and CT (lungs to liver) for the actinide monitoring system for 241 Am using realistic thorax Lawrence Livermore National Laboratory (LLNL) phantom were estimated. Also CT has been estimated using voxel phantom by carrying out Monte Carlo simulations in FLUKA code. This study will help in reporting the actual activity present in the individual organ (lungs, liver)
Effects of Organic Acids and Sylvite on Phytoextraction of 241Am Contaminated Soil.
Wang, Ping; Du, Liang; Tan, Zhaoyi; Su, Rongbo; Li, Taowen
2017-03-01
Contamination of soil with Americium ( 241 Am) at nuclear sites in China poses a serious problem. We screened six plants, from five families, for their 241 Am-enrichment potential. Europium (Eu), which is morphologically and chemically similar to the highly toxic 241 Am, was used in its place. Moreover, the effects of sylvite, citric acid (CA), malic acid (MA), and humic acid (HA) on the absorption of 241 Am by the plants, and its transport within them, were evaluated along with their effect on plant biomass and 241 Am extraction volume. Barley and cabbage showed relatively stronger Eu accumulation capacities. Citric acid promoted the absorption of 241 Am by barley roots and its transport within the plants. The effects of sylvite were not obvious and those of HA were the weakest in case of sunflower; HA, however, maximally increased the biomass of the plants. Our results could provide the basis for future radionuclide phytoremediation of contaminated soils.
Plutonium-241 processing: from impure oxide to high purity metal target disks
International Nuclear Information System (INIS)
Conner, W.V.; Baaso, D.L.
1975-01-01
The preparation of three plutonium-241 metal target disks, using a precision casting technique, is described. The disks were 0.625 inch in diameter and 0.125, 0.025, and 0.010 inch thick. All three disks were prepared simultaneously in a single casting. The variation in thickness of each disk was within +-1 percent of the disk's average thickness. The plutonium-241 was highly pure, and the finished disks contained a total of only 297 parts per million of detectable impurities. Purification of the plutonium oxide ( 241 PuO 2 ) and the conversion of the purified 241 PuO 2 to metal are also described. (U.S.)
Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102
International Nuclear Information System (INIS)
CONNER, J.M.
1999-01-01
High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)
Test report - 241-AN-274 Caustic Pump Control Building
International Nuclear Information System (INIS)
Paintner, G.P.
1995-05-01
This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met
System Description for Tank 241-AZ-101 Waste Retrieval Data Acquisition System
International Nuclear Information System (INIS)
ROMERO, S.G.
2000-01-01
The proposed activity provides the description of the Data Acquisition System for Tank 241-AZ-101. This description is documented in HNF-5572, Tank 241-AZ-101 Waste Retrieval Data Acquisition System (DAS). This activity supports the planned mixer pump tests for Tank 241-AZ-101. Tank 241-AZ-101 has been selected for the first full-scale demonstration of a mixer pump system. The tank currently holds over 960,000 gallons of neutralized current acid waste, including approximately 12.7 inches of settling solids (sludge) at the bottom of the tank. As described in Addendum 4 of the FSAR (LMHC 2000a), two 300 HP mixer pumps with associated measurement and monitoring equipment have been installed in Tank 241-AZ-101. The purpose of the Tank 241-AZ-101 retrieval system Data Acquisition System (DAS) is to provide monitoring and data acquisition of key parameters in order to confirm the effectiveness of the mixer pumps utilized for suspending solids in the tank. The suspension of solids in Tank 241-AZ-101 is necessary for pretreatment of the neutralized current acid waste and eventual disposal as glass via the Hanford Waste Vitrification Plant. HNF-5572 provides a basic description of the Tank 241-AZ-101 retrieval system DAS, including the field instrumentation and application software. The DAS is provided to fulfill requirements for data collection and monitoring. This document is not an operations procedure or is it intended to describe the mixing operation. This USQ screening provides evaluation of HNF-5572 (Revision 1) including the changes as documented on ECN 654001. The changes include (1) add information on historical trending and data backup, (2) modify DAS I/O list in Appendix E to reflect actual conditions in the field, and (3) delete IP address in Appendix F per Lockheed Martin Services, Inc. request
Energy Technology Data Exchange (ETDEWEB)
RIECK, C.A.
1999-02-25
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.
International Nuclear Information System (INIS)
RIECK, C.A.
1999-01-01
The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability
Experimental verification for standard analysis procedure of 241Am in food
International Nuclear Information System (INIS)
Liu Qingfen; Zhu Hongda; Liu Shutian; Pan Jingshun; Yang Dating
2005-01-01
Objective: The briefly experimental verification for 'determination of 241 Am in food' has been described. Methods: The overall recovery, the MDL of method and decontamination experiment has been done by standard analysis procedure. Results: The overall recovery is 76.26 ± 4.1%. The MDL is 3.4 x 10 -5 Bq/g ash, decontamination factor is higher than 10 3 for Po, 10 2 for U, Th, Pu and 60 for 237 Np. Conclusion: The results showed that the overall recovery is quite high and reliable, the MDL of method is able to meet examining 241 Am limited values in foods. the obtained decontamination factors of recommended procedure can meet analysis of 241 Am in food examination. Venifying results of the procedure are satisfied by using 243 Am spike and 241 Am standard reference material. (authors)
7 CFR 1951.241 - Special provision for interest rate change.
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Special provision for interest rate change. 1951.241... Community and Direct Business Programs Loans and Grants § 1951.241 Special provision for interest rate... interest rate charged by FmHA or its successor agency under Public Law 103-354 to water and waste disposal...
30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...
International Nuclear Information System (INIS)
Estey, S.D.
1997-01-01
This calculation note analyzes headspace concentrations of hydrogen dependent upon assumed ventilation flow rates provided for tanks 241-C-106 and 241-AY-102. The analyses are based on measured or estimated steady state hydrogen release rates. Tank 241-C-106 is analyzed prior to sluicing; tank 241-AY-102 is analyzed both prior to and after completion of sluicing. Specific analyses, using both best estimated and bounding hydrogen generation rates, include the minimum primary ventilation flow rates required in the tanks to ensure that the steady state hydrogen concentration in the respective tank headspace does not exceed 25% and 100% of the LFL. The headspace hydrogen concentration as a function of time as well as the time required to reach 25% and 100% of LFL upon complete loss of active ventilation, starting from the steady state hydrogen concentration based on a 200 CFM minimum flow rate in tank 241-C-106 and a 100 CFM minimum flow rate in tank241-AY-102. The headspace hydrogen concentration as a function of thee following partial loss of active ventilation (i.e., step changes to l60, l20, 80, and 40 CFM ventilation flow rates) in tank 241-C-106, staffing from a 200 CFM flow rate and the corresponding steady state hydrogen concentration based on the 200 CFM flow rate. The headspace hydrogen concentration as a function of the following partial loss of active ventilation i.e., step changes to 80, 60, 40, and 20 CFM ventilation flow rates) in tank 241-AY-102, starting from a 100 CFM flow rate and the corresponding steady state hydrogen concentration based on the 100 CFM flow rate
Tank characterization report for single-shell tank 241-T-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In August 1992, Single-Shell Tank 241-T-104 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code (Ecology, 1991). This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. The purpose of this report is to describe and characterize the waste in Single-Shall Tank 241-T-104 (hereafter, Tank 241-T-104) based on information given from various sources. This report summarizes the available information regarding the waste in Tank 241-T-104, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Tank characterization report for double-shell Tank 241-AP-107
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
The purpose of this tank characterization report is to describe and characterize the waste in Double-Shell Tank 241-AP-107 based on information gathered from various sources. This report summarizes the available information regarding the waste in Tank 241-AP-107, and arranges it in a useful format for making management and technical decisions concerning this particular waste tank. In addition, conclusion and recommendations based on safety and further characterization needs are given. Specific objectives reached by the sampling and characterization of the waste in Tank 241-AP-107 are: Contribute toward the fulfillment of the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-44-05 concerning the characterization of Hanford Site high-level radioactive waste tanks; Complete safety screening of the contents of Tank 241-AP-107 to meet the characterization requirements of the Defense Nuclear Facilities Safety board (DNFSB) Recommendation 93-5; and Provide tank waste characterization to the Tank Waste Remediation System (TWRS) Program Elements in accordance with the TWRS Tank Waste Analysis Plan
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis)
International Nuclear Information System (INIS)
Bolsunovsky, A.; Zotina, T.; Bondareva, L.
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241 Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241 Am is accumulated by Elodea biomass: the activity concentration of 241 Am can reach 3280 ± 240 Bq/g, with the concentration factor for 241 Am 16 600 ± 2200 l/kg. Results of chemical fractionation have proved that in the course of 241 Am accumulation by Elodea biomass, 241 Am tightly bound to biomass increases from 11% to 27% of the total 241 Am in the biomass. Release of 241 Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241 Am activity and the rate of 241 Am release into the water environment reached 23 Bq/day
Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis).
Bolsunovsky, A; Zotina, T; Bondareva, L
2005-01-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241Am is accumulated by Elodea biomass: the activity concentration of 241Am can reach 3280+/-240 Bq/g, with the concentration factor for 241Am 16 600+/-2200l/kg. Results of chemical fractionation have proved that in the course of 241Am accumulation by Elodea biomass, 241Am tightly bound to biomass increases from 11% to 27% of the total 241Am in the biomass. Release of 241Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241Am activity and the rate of 241Am release into the water environment reached 23 Bq/day.
Pu241 cross-sections below 1 keV
International Nuclear Information System (INIS)
Doherty, G.
1966-12-01
Early in 1965 a new data file (DFN 40) for Pu241 covering the energy range 10 - 4 eV to 15 MeV was prepared for the UKAEA Nuclear Data Library. The data above 1 keV are described by Douglas (AWRE 0-101/64) and the data below 1 keV are set out in this report. During the past year a number of additional measurements have been reported for Pu241 and a brief summary of these measurements and their implications for the data on the file are given. (author)
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Determination of plutonium 241 in solutions of nuclear wastes
International Nuclear Information System (INIS)
Raymond, A.; Bilcot, J.B.; Poletiko, C.
1990-09-01
Determination of plutonium 241 in nuclear wastes is important because of long period and high energy of some daughter products. In this report are presented two quantitative analysis methods using both scintillation techniques: A complete method, in any case, by selective extraction of plutonium on an anionic resin allowing simultaneous determination of Pu 241 and the sum of other plutonium isotopes; a simplified method when alpha activity is higher than beta/gamma activity by liquid extraction with TTA. These methods are applied for analysis of 4 waste types: cement encapsulated wastes, bitumen encapsulated wastes, incineration ashes, leaching of encapsulated incineration ashes. In these 4 examples, Pu 241 activity is equal or higher than the sum of alpha plutonium isotope activity. Separation efficiency, measured from Pu 239 or with Pu 236 as tracer, is between 90 and 99% [fr
Tank 241-C-106 in-tank imaging system operational test report
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106
Energy Technology Data Exchange (ETDEWEB)
DEXTER, M.L.
1999-11-15
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.
International Nuclear Information System (INIS)
DEXTER, M.L.
1999-01-01
This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year
Tank 241-C-106 waste retrieval sluicing system process control plan
Energy Technology Data Exchange (ETDEWEB)
Carothers, K.G.
1998-07-25
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.
Tank 241-C-106 waste retrieval sluicing system process control plan
International Nuclear Information System (INIS)
Carothers, K.G.
1998-01-01
Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity
Behavior of 241Am in fast reactor systems - a safeguards perspective
International Nuclear Information System (INIS)
Beddingfield, David H.; Lafleur, Adrienne M.
2009-01-01
Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.
8 CFR 241.24 - Notice to transportation line of alien's exclusion.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's exclusion. 241.24 Section 241.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings...
Potentiostatic electro-deposition of 241Am using room temperature ionic liquids
International Nuclear Information System (INIS)
Sankhe, R.H.; Mirashi, N.N.; Arijit Sengupta; Murali, M.S.
2015-01-01
An attempt was made for the potentiostatic electrodeposition of 241 Am using six different room temperature ionic liquids (RTILs). Effect of electrodeposition time on the % of electrodeposition of 241 Am, pH change of the solution and the temperature change of the systems were investigated. It was observed that for water immiscible RTILs, the least viscous RTIL gave the best yield (when mixed with iso-propanol), while for water miscible RTILs, reverse trend was observed (when mixed with water). Out of all water immiscible RTILs under consideration for the present case, the octyl-methyl-pyrrolidinium bis(trifluoromethylsulfonyl)imide (C 8 mpyNTf 2 ) in isopropanol was found to yield almost quantitative (99.6 %) electrodeposition of 241 Am within 45 min whereas the most effective system was found to be C 8 mimBr with ∼90 % of 241 Am deposited on the electrode for water miscible RTILs. To the best of our knowledge, this is the first approach ever been reported in the literature. (author)
Tank 241-A-105 evaporation estimate, 1970 through 1978
International Nuclear Information System (INIS)
Allen, G.K.
1991-09-01
Tank 241-A-105 was subjected to a severe steam explosion in January 1965 that caused the metal liner on the bottom to bulge upward approximately 8 feet above its concrete foundation. Shortly after this event, radiation was detected in drywells around the tank and it was declared a leaker. Sluicing operations to remove material from the tank began in August 1968 and continued through August 1970. After sluicing was completed, a significant amount of heat generating material still remained in the tank. To keep tank temperatures below operating limits, the water level in the tank was maintained at an approximate depth of 1.5 feet. This practice was continued until January 1979 when it was believed that the contents had decayed sufficiently to discontinue the water addition and put the tank on a portable exhauster system. Recent concern has focused on what portion of this cooling water added to Tank 241-A-105 actually evaporated and how much leaked into the soil during the nine year time period. This report presents the results of a study that estimates the amount of water evaporated from Tank 241-A-105 between 1970 and 1979. The problem was completed in two parts. The first part involved development of a three dimensional heat transfer model which was used to establish the tank heat load. The results of this model were validated against thermocouple data from Tank 241-A-105. The heat removed from the tank by the ventilation air was then used as input to a second computer code, which calculated the water evaporation. Based upon these two models, the amount of water evaporated from Tank 241-A-105, between 1970 and 1979, was between 378,000 and 410,000 gallons. 9 refs., 17 figs., 7 tabs
Waste behavior analysis for tank 241-SY-103
International Nuclear Information System (INIS)
Wilkins, N.E.
1994-01-01
Tank 241-SY-103 is on the Flammable Gas Watch List. The waste in this tank behaves similarly to that in tank 241-Sy-101. Both show slurry growth and periodic surface level drops. However, the surface level drops are much smaller than those in tank 101-SY. A standard hydrogen monitoring system (SHMS) was recently installed in tank 103-SY, and waste auger samples were recently taken. This document covers the characterization results to date for the auger samples, and the behavior of the tank waste during both steady state periods and gas release events
Safety evaluation for the interim stabilization of Tank 241-C-103
Energy Technology Data Exchange (ETDEWEB)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.
Safety evaluation for the interim stabilization of Tank 241-C-103
International Nuclear Information System (INIS)
Geschke, G.R.
1995-03-01
This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed
Tank 241-AP-104 Grab Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L and H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104
Tank characterization report for double-shell tank 241-AP-105
International Nuclear Information System (INIS)
DeLorenzo, D.S.; Simpson, B.C.
1994-01-01
Double-Shell Tank 241-AP-105 is a radioactive waste tank most recently sampled in March of 1993. Sampling and characterization of the waste in Tank 241-AP-105 contributes toward the fulfillment of Milestone M-44-05 of the Hanford Federal Facility Agreement and Consent Order (Ecology, EPA, and DOE, 1993). Characterization is also needed tot evaluate the waste's fitness for safe processing through an evaporator as part of an overall waste volume reduction program. Tank 241-AP-105, located in the 200 East Area AP Tank Farm, was constructed and went into service in 1986 as a dilute waste receiver tank; Tank 241AP-1 05 was considered as a candidate tank for the Grout Treatment Facility. With the cancellation of the Grout Program, the final disposal of the waste in will be as high- and low-level glass fractions. The tank has an operational capacity of 1,140,000 gallons, and currently contains 821,000 gallons of double-shell slurry feed. The waste is heterogeneous, although distinct layers do not exist. Waste has been removed periodically for processing and concentration through the 242-A Evaporator. The tank is not classified as a Watch List tank and is considered to be sound. There are no Unreviewed Safety Questions associated with Tank 241-AP-105 at this time. The waste in Tank 241-AP-105 exists as an aqueous solution of metallic salts and radionuclides, with limited amounts of organic complexants. The most prevalent soluble analytes include aluminum, potassium, sodium, hydroxide, carbonate, nitrate, and nitrite. The calculated pH is greater than the Resource Conservation and Recovery Act established limit of 12.5 for corrosivity. In addition, cadmium, chromium, and lead concentrations were found at levels greater than their regulatory thresholds. The major radionuclide constituent is 137 Cs, while the few organic complexants present include glycolate and oxalate. Approximately 60% of the waste by weight is water
Environmental impact of a teratogenic actinide: a case study of americium-241
Energy Technology Data Exchange (ETDEWEB)
Wang, J.; Yang, J.Y.
1985-10-16
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs.
Environmental impact of a teratogenic actinide: a case study of americium-241
International Nuclear Information System (INIS)
Wang, J.; Yang, J.Y.
1985-01-01
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs
Measurement of contamination by 241Am
International Nuclear Information System (INIS)
Hemmingsen, L.B.S.
1991-08-01
In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)
Tank 241-S-102, Core 232 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1998-11-04
This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
Test plan for tank 241-AN-104 dilution studies
International Nuclear Information System (INIS)
Herting, D.L.
1998-01-01
Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List
The effect of dilution on the gas retention behavior of Tank 241-SY- 103 waste
International Nuclear Information System (INIS)
Bredt, P.R.; Tingey, S.M.
1996-01-01
Twenty-five of the 177 underground waste storage tanks on the Hanford Site have been placed on the Flammable Gas watch list. These 25 tanks, containing high-level waste generated during plutonium and uranium processing, have been identified as potentially capable of accumulating flammable gases above the lower flammability limit (Babad et al. 1991). In the case of Tanks 241-SY-101 and 241-SY-103, it has been proposed that diluting the tank waste may mitigate this hazard (Hudson et al. 1995; Stewart et al. 1994). The effect of dilution on the ability of waste from Tank 241-SY-103 to accumulate gas was studied at Pacific Northwest National Laboratory. A similar study has been completed for waste from Tank 241-SY-101 (Bredt et al. 1995). Because of the additional waste-storage volume available in Tank 241-SY-103 and because the waste is assumed to be similar to that currently in Tank 241-SY-101, Tank 241-SY-103 became the target for a demonstration of passive mitigation through in-tank dilution. In 1994, plans for the in-tank dilution demonstration were deferred pending a decision on whether to pursue dilution as a mitigation strategy. However, because Tank 241-SY-103 is an early retrieval target, determination of how waste properties vary with dilution will still be required
Recovery of americium-241 from aged plutonium metal
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.
1980-12-01
About 5 kg of ingrown 241 Am was recovered from 850 kg of aged plutonium using a process developed specifically for Savannah River Plant application. The aged plutonium metal was first dissolved in sulfamic acid. Sodium nitrite was added to oxidize the plutonium to Pu(IV) and the residual sulfamate ion was oxidized to nitrogen gas and sulfate. The plutonium and americium were separated by one cycle of solvent extraction. The recovered products were subsequently purified by cation exchange chromatography, precipitated as oxalates, and calcined to the oxides. Plutonium processng was routine. Before cation exchange purification, the aqueous americium solution from solvent extraction was concentrated and stripped of nitric acid. More than 98% of the 241 Am was then recovered from the cation exchange column where it was effectively decontaminated from all major impurities except nickel and chromium. This partially purified product solution was concentrated further by evaporation and then denitrated by reaction with formic acid. Individual batches of americium oxalate were then precipitated, filtered, washed, and calcined. About 98.5% of the americium was recovered. The final product purity averaged 98% 241 AmO 2 ; residual impurities were primarily lead and nickel
Uptake of americium-241 by algae and bacteria
Energy Technology Data Exchange (ETDEWEB)
Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)
1978-01-01
The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.
International Nuclear Information System (INIS)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G.
2004-01-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including 241 Am). 241 Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of 241 Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of 241 Am from the biomass. The content of 241 Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of 241 Am in the plants were in inverse proportion to their biomass. We obtained new data on release of 241 Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial 241 Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of 241 Am and retain americium for long periods of time in biomass. (author)
Accumulation and release of {sup 241}Am by a macrophyte of the Yenisei River (Elodea canadensis)
Energy Technology Data Exchange (ETDEWEB)
Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)]. E-mail: radecol@ibp.ru; Zotina, T. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation); Bondareva, L. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)
2005-07-01
The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of {sup 241}Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that {sup 241}Am is accumulated by Elodea biomass: the activity concentration of {sup 241}Am can reach 3280 {+-} 240 Bq/g, with the concentration factor for {sup 241}Am 16 600 {+-} 2200 l/kg. Results of chemical fractionation have proved that in the course of {sup 241}Am accumulation by Elodea biomass, {sup 241}Am tightly bound to biomass increases from 11% to 27% of the total {sup 241}Am in the biomass. Release of {sup 241}Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial {sup 241}Am activity and the rate of {sup 241}Am release into the water environment reached 23 Bq/day.
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
Characterization of strong (241)Am sources.
Vesterlund, Anna; Chernikova, Dina; Cartemo, Petty; Axell, Kåre; Nordlund, Anders; Skarnemark, Gunnar; Ekberg, Christian; Ramebäck, Henrik
2015-05-01
Gamma ray spectra of strong (241)Am sources may reveal information about the source composition as there may be other radioactive nuclides such as progeny and radioactive impurities present. In this work the possibility to use gamma spectrometry to identify inherent signatures in (241)Am sources in order to differentiate sources from each other, is investigated. The studied signatures are age, i.e. time passed since last chemical separation, and presence of impurities. The spectra of some sources show a number of Doppler broadened peaks in the spectrum which indicate the presence of nuclear reactions on light elements within the sources. The results show that the investigated sources can be differentiated between by age and/or presence of impurities. These spectral features would be useful information in a national nuclear forensics library (NNFL) in cases when the visual information on the source, e.g. the source number, is unavailable. Copyright © 2015 Elsevier Ltd. All rights reserved.
Tank characterization report for single-shell tank 241-S-104
International Nuclear Information System (INIS)
DiCenso, A.T.; Simpson, B.C.
1994-01-01
In July and August 1992, Single-Shell Tank 241-S-104 was sampled as part of the overall characterization effort directed by the Hanford Federal Facility Agreement and Consent Order. Sampling was also performed to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also presents expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background historical and surveillance tank information. Finally, this report makes recommendations and conclusions regarding operational safety. The purpose of this report is to describe the characteristics the waste in Single-Shell Tank 241-S-104 (hereafter, Tank 241-S-104) based on information obtained from a variety of sources. This report summarizes the available information regarding the chemical and physical properties of the waste in Tank 241-S-104, and using the historical information to place the analytical data in context, arranges this information in a format useful for making management and technical decisions concerning waste tank safety and disposal issues. In addition, conclusions and recommendations are presented based on safety issues and further characterization needs
Tank 241-AP-104 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-11-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Double-Shell Tank (DST) 241-AP-104
Test plan for Tank 241-AW-101 solubility screening tests
International Nuclear Information System (INIS)
Person, J.C.
1998-01-01
Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan
Acceptance Test Report for the 241-AN-107 Enraf Advanced Technology Gauges
International Nuclear Information System (INIS)
Dowell, J.L.; Enderlin, V.R.
1995-06-01
This Acceptance Test Report covers the results of the execution of the Acceptance Test Procedure for the 241-AN-107 Enraf Advanced Technology Gauges. The test verified the proper operation of the gauges to measure waste density and level in the 241-AN-107 tank
Associated risk factors for chronic kidney disease of unknown etiologies in 241 patients.
Xing, Xuexue; Lu, Jing; Wang, Zheng
2015-04-01
Apart from the well-known etiologies, there are still a high proportion of patients with chronic kidney disease of unknown etiology (CKDu), which has rarely been reported on. In this study, we explored the potential associated risk factors for CKDu and identified those that occur in childhood. 700 patients with CKD we were selected randomly from 4 hospitals in Chengdu and 241 were screened for CKDu. The following clinical information was analyzed: demographic data, life style, personal and family history, nephrotoxic drugs, exposure to poison, allergies, and recurrent respiratory infections in childhood. Among 700 CKD patients, 34.43% (241/700) were CKDu. Of the 241 patients, there were 67.63% (163/241) with at least 1 associated risk factor and 56.44% (92/163) with more than 1. Patients with a personal history of an associated risk factor represented the largest proportion (31.95%, 77/241), while 28.63% (69/241) of the CKDu patients had risk factors appearing in childhood. Logistic regression analysis supported the results. The study demonstrated that most so-called CKDu patients do have an identifiable etiology, and that several associated risk factors contribute to it. Of all the risk factors, age >60 years, nephrotoxic drugs, exposure to poison, and alcohol consumption were the independent significant factors for CKDu. Furthermore, many risk factors that caused kidney injury started in childhood.
Operability test procedure for 241-U compressed air system and heat pump
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The supply piping to the 241-U Tank Farm is not included in the modification. Modifications to the 241-U-701 compressed air system include installation of a 15 HP Reciprocating Air Compressor, Ingersoll-Rand Model 10T3NLM-E15; an air dryer, Hankinson, Model DH-45; and miscellaneous system equipment and piping (valves, filters, etc.) to meet the design. A newly installed heat pump allows the compressor to operate within an enclosed relatively dust free atmosphere and keeps the compressor room within a standard acceptable temperature range, which makes possible efficient compressor operation, reduces maintenance, and maximizes compressor operating life. This document is an Operability Test Procedure (OTP) which will further verify (in addition to the Acceptance Test Procedure) that the 241-U-701 compressed air system and heat pump operate within their intended design parameters. The activities defined in this OTP will be performed to ensure the performance of the new compressed air system will be adequate, reliable and efficient. Completion of this OTP and sign off of the OTP Acceptance of Test Results is necessary for turnover of the compressed air system from Engineering to Operations
Acceptance test report for the Tank 241-C-106 in-tank imaging system
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing
Energy Technology Data Exchange (ETDEWEB)
Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)
2004-07-01
Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)
International Nuclear Information System (INIS)
Bondareva, L.; Vlasova, I.; Mogilnaya, O.; Bolsunovsky, A.; Kalmykov, S.
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide 241 Am among different components of the plant. The total amount of 241 Am added to the experimental system was 1850 ± 31 Bq/L. The total amount of 241 Am accumulated by the plants was 182 Bq per sample, or 758,333 ± 385 Bq/kg dry mass. It has been found that the major portion of 241 Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of 241 Am within different components of the submerged plant E. canadensis was not uniform. 241 Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Bondareva, L; Vlasova, I; Mogilnaya, O; Bolsunovsky, A; Kalmykov, S
2010-01-01
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide (241)Am among different components of the plant. The total amount of (241)Am added to the experimental system was 1850+/-31 Bq/L. The total amount of (241)Am accumulated by the plants was 182 Bq per sample, or 758,333+/-385 Bq/kg dry mass. It has been found that the major portion of (241)Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of (241)Am within different components of the submerged plant E. canadensis was not uniform. (241)Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm
International Nuclear Information System (INIS)
Girardot, Crystal L.; Harlow, Donald G.
2013-01-01
This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F
241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure
Status of tank 241-SY-101 data analyses
International Nuclear Information System (INIS)
Anantatmula, R.P.
1992-09-01
The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question
In-vivo counting of 241Am in human lungs and tracheobronchial lymph nodes
International Nuclear Information System (INIS)
Northcutt, A.R.; Binney, S.E.; Palmer, H.E.
1988-01-01
A study was conducted of a human male who had inhaled a mixture of 241 Am and Pu. To distinguish 241 Am deposited in the subject's lungs from translocated activity deposited in the tracheobronchial lymph nodes (TBLN), two intrinsic Ge detectors were collimated with 0.3-cm Pb sheeting. A tissue-equivalent phantom containing either 22.9 kBq (620 nCi) of 241 Am in the lungs or a 81.4 kBq (2200 nCi) 241 Am point source in the TBLN was measured. Calibration curves observed from lateral differential scans on the phantom were compared to data obtained by the same detection system for a human male with a measured lung deposition of 89 Bq (2.4 nCi) of 241 Am. Comparison of the human data to the calibration curves indicated the activity was restricted primarily to the lungs. The calibration curves demonstrate that this method is useful in determining the distribution of inhaled radioactivity between the lungs and TBLN. The measured activity from the male subject generally supported the ICRP Publication 30 model translocation prediction for class Y compounds
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
International Nuclear Information System (INIS)
Hays, C.B.
1998-01-01
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Nonradioactive air emissions notice of construction, Project W-320, 241-C-106 tank sluicing
Energy Technology Data Exchange (ETDEWEB)
Hays, C.B.
1998-01-28
This document serves as a Notice of Construction for the Phase 2 activities of Project W-320, 241-C-106 Tank Sluicing, pursuant to the requirements of Washington Administrative Codes (WAC) 173-400 and 173-460. Phased permitting for Project W-320 was discussed with the Washington State Department of Ecology (Ecology) on November 2, 1993. In April 1994, it was deemed unnecessary because the Phase 1 activities did not constitute a new source of emissions and therefore did not require approval from Ecology. The 241-C-106 tank is a 2-million liter capacity, single-shell tank (SST) used for radioactive waste storage since 1947. Between mid-1963 and mid-1969, 241-C-106 tank received high-heat waste, PUREX (plutonium-uranium extraction) Facility high-level waste, and strontium-bearing solids from the strontium and cesium recovery activities. In 1971, temperatures exceeding 99 C were observed in the tank, and therefore, a ventilation system was installed to cool the tank. In addition, approximately 22,712 liters of cooling water are added to the tank each month to prevent the sludge from drying out and overheating. Excessive drying of the sludge could result in possible structural damage. The current radiolytic heat generation rate has been calculated at 32 kilowatts (kW) plus or minus 6 kW. The 241-C-106 tank was withdrawn from service in 1979 and currently is categorized as not leaking. The heat generation in 241-C-106 tank has been identified as a key safety issue on the Hanford Site. The evaporative cooling provided by the added water during operation and/or sluicing maintains the 241-C-106 tank within its specified operating temperature limits. Project W-320, 241-C-106 Tank Sluicing, will mobilize and remove the heat-generating sludge, allowing the water additions to cease. Following sludge removal, the 241-C-106 tank could be placed in a safe, interim stabilized condition. Tank-to-tank sluicing, an existing, proven technology, will provide the earliest possible
Final results of double-shell tank 241-AZ-101 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AZ-101. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AZ-101 primary tank wall and welds. The inspection found one reportable indication of thinning and no reportable pitting, corrosion, or cracking
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Analysis and characterization of double shell tank 241-AP-108
International Nuclear Information System (INIS)
Miller, G.L.
1994-01-01
This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank
Treatment of selected primary gynecologic and pelvic malignancies with 241Americium
International Nuclear Information System (INIS)
Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn
1995-01-01
Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were
Final report for tank 241-BX-109, push mode cores 84 and 85
International Nuclear Information System (INIS)
Schreiber, R.D.
1996-01-01
This document summarizes the sampling activities for tank 241-BX-109. This report contains tables of the analytical results on total organic compounds and total inorganic compounds in the radioactive wastes. Tank 241-BX-109 has not been on a Watch List
International Nuclear Information System (INIS)
Brown, G.N.; Bontha, J.R.; Carlson, C.D.
1995-09-01
Pacific Northwest Laboratory (PNL), in conjunction with the Process Chemistry and Statistics Section of Westinghouse Hanford Company (WHC), conducted this study as part of the Supernatant Treatment Development Task for the Initial Pretreatment Module (IPM) Applied Engineering Project. The study assesses the performance of the CS-100 ion exchange material for removing cesium from simulated and actual alkaline supernate from Hanford tanks 241-SY-101 and 241-SY-103. The objective of these experiments is to compare the cesium ion exchange loading and elution profiles of actual and simulated wastes. Specific experimental objectives include (1) demonstration of decontamination factors (DF) for cesium removal, 92) verification of simulant performance, (3) investigation of waste/exchanger chemistry, and (4) determination of the radionuclide content of the regenerated CS-100 resin prior to disposal
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
Final results of double-shell tank 241-AY-102 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AY-102. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AY-102 primary tank wall and welds. The inspection found some indication of insignificant general and local wall thinning with no cracks detected
Final results of double-shell tank 241-AN-105 ultrasonic inspection
International Nuclear Information System (INIS)
JENSEN, C.E.
1999-01-01
This document presents the results and documentation of the nondestructive ultrasonic examination of tank 241-AN-105. A tank inspection supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to scan a limited area of double-shell tank 241-AN-105 primary tank wall primary knuckle, and secondary tank bottom. The inspection found some indication of general and local wall thinning with no cracks detected
Reference: 241 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 241 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i Calderon-V...development of Arabidopsis thaliana. 9 2473-85 16024589 2005 Sep The Plant cell Bevan Mike|Calderon-Villalobos Luz I A|Dohmann Esther M N|Kuhnle Carola|Li Hanbing|Schwechheimer Claus
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-10-28
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data
International Nuclear Information System (INIS)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2004-01-01
This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy
Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations
Energy Technology Data Exchange (ETDEWEB)
Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-01-30
The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241
Energy Technology Data Exchange (ETDEWEB)
Bondareva, L., E-mail: lydiabondareva@gmail.co [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Vlasova, I. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation); Mogilnaya, O.; Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of Russian Academy of Sciences, 50 Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Kalmykov, S. [Chemistry Department Lomonosov Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation)
2010-01-15
A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide {sup 241}Am among different components of the plant. The total amount of {sup 241}Am added to the experimental system was 1850 +- 31 Bq/L. The total amount of {sup 241}Am accumulated by the plants was 182 Bq per sample, or 758,333 +- 385 Bq/kg dry mass. It has been found that the major portion of {sup 241}Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of {sup 241}Am within different components of the submerged plant E. canadensis was not uniform. {sup 241}Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.
Strumińska-Parulska, Dagmara I; Skwarzec, Bogdan
2015-05-01
The paper presents unique data of plutonium (241)Pu study in seabirds from northern Eurasia, permanently or temporally living at the southern Baltic Sea coast. Together, ten marine birds species were examined, as follows: three species that permanently reside at the southern Baltic, four species of wintering birds, and three species of migrating birds; 366 samples were analyzed. The obtained results indicated plutonium was non-uniformly distributed in organs and tissues of analyzed seabirds. The highest (241)Pu content was found in the digestion organs and feathers, the lowest in muscles. Also, the internal radiation doses from (241)Pu were evaluated.
Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums
International Nuclear Information System (INIS)
Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi
2011-01-01
This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137
Energy Technology Data Exchange (ETDEWEB)
Pereira, Tatiane Rocha
2009-07-01
In this work the mechanisms involved in the sorption of {sup 241}Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m{sup -2} and 4 kg m{sup -2}) were artificially contaminated by radioactive solution water, which contained {sup 241}Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of {sup 241}Am in radish's roots was measured. The main results show that {sup 241}Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for {sup 241}Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
International Nuclear Information System (INIS)
Wilson, T.R.; Hanson, C.
1994-01-01
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103
Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan
Energy Technology Data Exchange (ETDEWEB)
Wilson, T.R.; Hanson, C.
1994-10-03
The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.
Operational Test Report for the 241-AZ-101 Suspended Solids Profiler
International Nuclear Information System (INIS)
STENKAMP, D.M.
2000-01-01
This document comprises the Operational Test Report for the 241-AZ-101 Suspended Solids Profiler. This document presents the results of Operational Testing of the 241-AZ-101 Suspended Solids Profiler (SSP). Testing of the SSP was performed in accordance with OTP-260-005, ''SUSPENDED SOLIDS PROFILER OPERATIONAL TEST PROCEDURE''. The objective of the testing was to verify that all equipment and components functioned as designed, following construction completion and turnover to operations
Operational test procedure for Bldg 241-A-701 air compressor
International Nuclear Information System (INIS)
Desantis, G.N.
1995-01-01
This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators
Process Control Plan for Tank 241-SY-101 Surface Level Rise Remediation
International Nuclear Information System (INIS)
ESTEY, S.D.
1999-01-01
The tank 241-SY-101 transfer system was conceived and designed to address the immediate needs presented by rapidly changing waste conditions in tank 241-SY-101. Within the last year or so, the waste in this tank has exhibited unexpected behavior (Rassat et al. 1999) in the form of rapidly increasing crust growth. This growth has been brought about by a rapidly increasing rate of gas entrapment within the crust. It has been conceived that the lack of crust agitation beginning upon the advent of mixer pump operations may have set-up a more consolidated, gas impermeable barrier when compared to a crust regularly broken up by the prior buoyant displacement events within the tank. As a result, a series of level-growth remediation activities have been developed for tank 241-SY-101. The initial activities are also known as near-term crust mitigation. The first activity of near-term mitigation is to perform the small transfer of convective waste from tank 241-SY-101 into tank 241-SY-102. A 100 kgal transfer represents about a 10% volume reduction allowing a 10% water in-tank dilution. Current thinking holds that this should be enough to dissolve nitrite solids in the crust and perhaps largely eliminate gas retention problem in the crust (Raymond 1999). Additional mitigation activities are also planned on less constrained schedules. The net affect of the small transfer and follow-on mitigation activities for tank 241-SY-101 is strongly believed to be the remediation of tank 241-SY-101 as a flammable gas safety concern. The process for remediating the tank will require two or more transfer/dilution cycles. In-tank dilution will begin shortly after the initial transfer and the total dilution required to reach the final state is estimated to be between 250 to 400K gallons. The final state of the waste will not require any active measures to safely store the waste and operation of the mixer pump will no longer be necessary. The remediation activities are centered on a purpose
Energy Technology Data Exchange (ETDEWEB)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.
48 CFR 52.241-5 - Contractor's Facilities.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Facilities....241-5 Contractor's Facilities. As prescribed in 41.501(c)(4), insert a clause substantially the same as the following: Contractor's Facilities (FEB 1995) (a) The Contractor, at its expense, unless...
Yu, Xiaoli; Tang, Junli; Wang, Qunqing; Ye, Wenwu; Tao, Kai; Duan, Shuyi; Lu, Chenchen; Yang, Xinyu; Dong, Suomeng; Zheng, Xiaobo; Wang, Yuanchao
2012-10-01
• The Phytophthora sojae genome encodes hundreds of RxLR effectors predicted to manipulate various plant defense responses, but the molecular mechanisms involved are largely unknown. Here we have characterized in detail the P. sojae RxLR effector Avh241. • To determine the function and localization of Avh241, we transiently expressed it on different plants. Silencing of Avh241 in P. sojae, we determined its virulence during infection. Through the assay of promoting infection by Phytophthora capsici to Nicotiana benthamiana, we further confirmed this virulence role. • Avh241 induced cell death in several different plants and localized to the plant plasma membrane. An N-terminal motif within Avh241 was important for membrane localization and cell death-inducing activity. Two mitogen-activated protein kinases, NbMEK2 and NbWIPK, were required for the cell death triggered by Avh241 in N. benthamiana. Avh241 was important for the pathogen's full virulence on soybean. Avh241 could also promote infection by P. capsici and the membrane localization motif was not required to promote infection. • This work suggests that Avh241 interacts with the plant immune system via at least two different mechanisms, one recognized by plants dependent on subcellular localization and one promoting infection independent on membrane localization. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.
International Nuclear Information System (INIS)
Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.
2015-01-01
The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz
Review of 241 Pu resonance parameters
International Nuclear Information System (INIS)
Derrien, H.
1981-10-01
The status of 241 Pu resonance parameters is reviewed. The most important recent results are compared in some energy ranges, both from single level and multilevel point of view. It appears that an accurate set of resonance parameters is not still obtained for a general description of the cross-sections in the resonance region. Some recommendations are given for further experiments or evaluations
Influence of organic fertilization on the sorption mechanisms of 241 Am in tropical soils
International Nuclear Information System (INIS)
Pereira, Tatiane Rocha
2009-01-01
In this work the mechanisms involved in the sorption of 241 Am were investigated depending on the physicochemical properties of some Brazilian soils and on alterations promoted by organic amendment. This experimental study was conducted in a controlled area, where pots containing different kinds of soils (histisol, ferralsol and nitisol), with different organic amendment doses (without amendment; 2 kg m -2 and 4 kg m -2 ) were artificially contaminated by radioactive solution water, which contained 241 Am. Migration studies, distribution (or partition) coefficient (KJ), bioavailability and organic matter were carried out in these soils, with ar without organic amendment. In order to evaluate the effective bioavailability of radionuclides, radish (Raphanus sativus L.) was cultivated in these pots, and later the concentration of 241 Am in radish's roots was measured. The main results show that 241 Am tends to be strongly attached to organic matter and that organic amendment in tropical soils minimizes the radionuclide studied desorption. Also, distribution (or partition) coefficient values for 241 Am were generated and these values are smaller than those ones determined for soils from temperate zones. Physical and chemical fractioning of organic matter were carried out. (author)
Spatial statistical analysis of contamination level of 241Am and 239Pu, Thule, North-West Greenland
Energy Technology Data Exchange (ETDEWEB)
Strodl Andersen, J. (JSA EnviroStat (Denmark))
2011-10-15
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241Am and 239,240Pu on land. Maximum observed level of 241Am is 2.8x105 Bq m-2. Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241Am is 1.9-104 Bq m-2. Prediction of the overall amount of 241Am and 239,240Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241Am is 45 GBq and the predicted total amount of 239,240Pu is 270 GBq. (Author)
24 CFR 241.865 - Election by the lender.
2010-04-01
... Without a HUD-Insured or HUD-Held Mortgage Rights and Duties of Lender Under the Contract of Insurance § 241.865 Election by the lender. Where a real estate mortgage, or other security instrument has been...
Tank 241-C-101 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-101
Tank 241-U-111 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-111
Tank 241-C-105 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-105
Tank 241-BY-106 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106
Tank 241-BX-104 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-BX-104
Tank 241-AP-107 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107
Tank 241-AX-104 tank characterization plan
International Nuclear Information System (INIS)
Sathyanarayana, P.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-104
Tank 241-AX-102 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-102
Tank 241-U-103 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-103
Tank 241-TX-118 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-118
Tank 241-T-111 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-111
Tank 241-TY-101 Tank Characterization Plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TY-101
Tank 241-T-107 tank characterization plan
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-107
Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad
2014-03-01
In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.
Photon interaction studies using 241Am γ-rays
Indian Academy of Sciences (India)
rays from a 241Am source. These include attenuation studies as well as photoelectric absorption studies in various samples. The attenuation studies have been made using leaf and wood samples, samples like sand, sugar etc., which ...
International Nuclear Information System (INIS)
Rapko, Brian M.; Geeting, John GH; Sinkov, Sergei I.; Vienna, John D.
2006-01-01
This report describes work designed to evaluate the effectiveness of alkaline permanganate contacts at selectively removing chromium from the Hanford tank sludges 241-SY-102 and 241-SX-101. The key variables examined in this study, as compared to contact with the standard conditions of stoichiometric permanganate in 3 M hydroxide at elevated temperature, were: (a) excess permanganate and hydroxide at elevated temperature, (b) the separation of an elevated temperature 3 M hydroxide leach with either a room temperature permanganate contact or an elevated temperature permanganate contact at 0.25 M hydroxide. It was determined that sequential permanganate and caustic leaching can provide as effective removal of Cr as the combined high hydroxide permanganate contact at elevated temperature while minimizing concomitant Pu dissolution
Tank characterization report for double-shell tank 241-AP-101. Revision 1
International Nuclear Information System (INIS)
Conner, J.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes m support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for double-shell tank 241-AP-101. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-AP-101 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 provides the best-basis inventory estimate, and Section 4.0 makes recommendations about safety status and additional sampling needs. The appendixes contain supporting data and information. This report supported the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-05. The characterization information in this report originated from sample analyses and known historical sources. Appendix A provides historical information for tank 241-AP-101 including surveillance, information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a model based upon process knowledge. Appendix B summarizes recent sampling events and historical sampling information. Tank 241-AP-101 was grab sampled in November 1995, when the tank contained 2,790 kL (737 kgal) of waste. An addition1034al 1,438 kL (380 kgal) of waste was received from tank 241-AW-106 in transfers on March 1996 and January 1997. This waste was the product of the 242-A Evaporator Campaign 95-1. Characterization information for the additional 1,438 kL (380 kgal) was obtained using grab sampling data from tank 241-AW-106 and a slurry sample from the evaporator. Appendix C reports on the statistical analysis and numerical manipulation of data used in
Treatment of selected primary gynecologic and pelvic malignancies with {sup 241}Americium
Energy Technology Data Exchange (ETDEWEB)
Chung, Joyce Y; Peschel, Richard E; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E; Wilson, Lynn
1995-07-01
Purpose: To evaluate the efficacy of encapsulated {sup 241}Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated {sup 241}Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with {sup 241}Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of {sup 241}Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with {sup 241}Am. Median surface dose of {sup 241}Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S
2010-04-01
..., update, or cancel your registration? 1.241 Section 1.241 Food and Drugs FOOD AND DRUG ADMINISTRATION... Facilities Additional Provisions § 1.241 What are the consequences of failing to register, update, or cancel... to cancel its registration in accordance with the requirements of this subpart is a prohibited act...
Spatial statistical analysis of contamination level of 241Am and 239Pu Thule, North-West Greenland
International Nuclear Information System (INIS)
Strodl Andersen, J.
2011-10-01
A spatial analysis of data on radioactive pollution on land at Thule, North-West Greenland is presented. The data comprises levels of 241 Am and 239,240 Pu on land. Maximum observed level of 241 Am is 2.8x10 5 Bq m -2 . Highest levels were observed near Narsaarsuk. This area was also sampled most intensively. In Groennedal the maximum observed level of 241 Am is 1.9Oe10 4 Bq m -2 . Prediction of the overall amount of 241 Am and 239,240 Pu is based on grid points within the range from the nearest measurement location. The overall amount is therefore highly dependent on the model. Under the optimal spatial model for Narsaarsuk, within the area of prediction, the predicted total amount of 241 Am is 45 GBq and the predicted total amount of 239,240 Pu is 270 GBq. (Author)
Tank 241-AZ-101 Mixer Pump Test Vapor Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of mixer pumps in tank 241-AZ-101. The primary purpose of the mixer pump test (MPT) is to demonstrate that the two 300 horsepower mixer pumps installed in tank 241-AZ-101 can mobilize the settled sludge so that it can be retrieved for treatment and vitrification. Sampling will be performed in accordance with Tank 241-AZ-101 Mixer Pump Test Data Quality Objective (Banning 1999) and Data Quality Objectives for Regulatory Requirements for Hazardous and Radioactive Air Emissions Sampling and Analysis (Mulkey 1999). The sampling will verify if current air emission estimates used in the permit application are correct and provide information for future air permit applications
Tank 241-TX-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-105 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Engineering test plan for Tank 241-SY-101 in situ viscometer
International Nuclear Information System (INIS)
Sobocinski, R.G.; Stokes, T.I.; Pearce, K.L.
1994-11-01
To obtain in situ measurements of the rheological properties within tank 241-SY-101, this document will implement the test strategy defined in PNLMIT-041994, acquisition and Reduction of Data Obtained in Tank SY-101 with the Ball Rheometer. Instructions for all sequences are defined within the procedure. All safety requirements as defined in LA-UR-92-3196, A Safety Assessment for Proposed Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-101-SY have been implemented into this procedure
Tank 241-BY-107 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issuesclose quotes. Tank 241-BY-107 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolutionclose quotes
Tank 241-BY-111 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-111 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-111 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in Program Plan for the Resolution of Tank Vapor Issues (Osborne and Huckaby 1994). Tank 241-C-108 was vapor sampled in accordance with Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution (Osborne et al., 1994)
Tank 241-TX-118 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-TX-118 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-TX-118 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-112 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-112 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-112 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-C-104 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-104 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-104 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-103 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-103 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-103 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-U-107 vapor sampling and analysis tank characterization report
Energy Technology Data Exchange (ETDEWEB)
Huckaby, J.L.
1995-05-31
Tank 241-U-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in {open_quotes}Program Plan for the Resolution of Tank Vapor Issues.{close_quotes} Tank 241-U-107 was vapor sampled in accordance with {open_quotes}Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.{close_quotes}
Determination of 241Pu in nuclear waste slurries: a comparative study using LSC and ICP-MS.
Jäggi, M; Röllin, S; Alvarado, J A Corcho; Eikenberg, J
2012-02-01
(241)Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the (241)Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for (241)Pu, the methods were further validated using the (241)Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. Copyright © 2011 Elsevier Ltd. All rights reserved.
Structural analysis and evaluation of the 241SY101 tank annulus heat-up
International Nuclear Information System (INIS)
Ziada, H.H.
1994-01-01
This document provides the structural analysis (static and thermal loads) of the 241SY101 tank to determine the maximum allowable temperature and rate of heating that could be applied to tank 241SY101 through annulus air heating without detrimental effects to the structural integrity of the concrete and steel liner of the tank
Operability Test Report for 241-U Compressed Air System and heat pump
International Nuclear Information System (INIS)
Rensink, G.E.
1995-01-01
The 241-U-701 compressed air system supplies instrument quality compressed air to Tank Farm 241-U. The system was upgraded. The operability test showed that the system operates within its intended design parameters. System performance was monitored, recorded, and used to identify areas of concern. Exceptions to the OTP and additional items for safe system performance were minimal and have been resolved; the air system is ready for Operation's use
8 CFR 241.14 - Continued detention of removable aliens on account of special circumstances.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continued detention of removable aliens on account of special circumstances. 241.14 Section 241.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing...
Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103
International Nuclear Information System (INIS)
Kos, S.E.
1995-12-01
Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked
The fast gamma spectrometric method of the Am-241 determination in Chernobyl restricted zone soils
International Nuclear Information System (INIS)
Gleisberg, B.; Lukachina, V.V.; Kirsenko, V.N.; Tepikin, V.E.; Rajevsky, V.S.; Libman, V.A.; Stoljarevsky, I.P.; Isajev, A.G.
1997-01-01
The known methods of the 241 Am contents determination in environmental objects, as a rule, is based on ion-chromatographic or extraction separation techniques. This approach reflects widespread opinion, that only the α-spectrometric analysis termination is suitable to ensure necessary sensitivity of the overall method of 241 Am actively determination. Really, the minimal detectable activity for such methods is about 0.05 Bq/kg (considering that Am is usually concentrated during separation procedure). However, because of α-spectrometry does not permit to separate the α-peaks of the 241 Am, and 238 Pu, but also in view of high requests to the α-spectrometric specimen purity, the multistage and laborious chemical procedures to separate 241 Am from plutonium radionuclides and other elements (with a thorough control of each separation stage) are needed
Tank 241-TX-105 tank characterization plan
International Nuclear Information System (INIS)
Carpenter, B.C.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-105
Determination of {sup 241}Pu in nuclear waste slurries: A comparative study using LSC and ICP-MS
Energy Technology Data Exchange (ETDEWEB)
Jaeggi, M., E-mail: maya.jaeggi@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland); Roellin, S., E-mail: Stefan.Roellin@babs.admin.ch [Federal Office for Civil Protection, SPIEZ Laboratory, CH-3700 Spiez (Switzerland); Corcho Alvarado, J.A., E-mail: Corcho-Alvarado@chuv.ch [Institute of Radiation Physics, University Hospital and University of Lausanne, Rue du Grand-Pre 1, 1007 Lausanne (Switzerland); Eikenberg, J., E-mail: jost.eikenberg@psi.ch [Department Logistics for Radiation Safety and Security, Radioanalytics, CH-5232 Villligen PSI (Switzerland)
2012-02-15
{sup 241}Pu was determined in slurry samples from a nuclear reactor decommissioning project at the Paul Scherrer Institute (Switzerland). To validate the results, the {sup 241}Pu activities of five samples were determined by LSC (TriCarb and Quantulus) and ICP-MS, with each instrument at a different laboratory. In lack of certified reference materials for {sup 241}Pu, the methods were further validated using the {sup 241}Pu information values of two reference sediments (IAEA-300 and IAEA-384). Excellent agreement with the results was found between LSC and ICP-MS in the nuclear waste slurries and the reference sediments. - Highlights: Black-Right-Pointing-Pointer Good agreement between the {sup 241}Pu activity of 5 slurry samples, using 3 measurement techniques. Black-Right-Pointing-Pointer {sup 241}Pu information values of two IAEA samples agreed well for the 3 measurement techniques. Black-Right-Pointing-Pointer Low detection limits were achieved; 1.8 Bq/kg (Quantulus), 2 Bq/kg (ICP-MS) and 3.5 Bq/kg (TriCarb).
Proposed retention model for human inhalation exposure to 241AmO2
International Nuclear Information System (INIS)
Mewhinney, J.A.; Griffith, W.C.; Muggenburg, B.A.
1980-01-01
A dosimetry model based on a four-year study in Beagle dogs was developed to predict patterns of absorbed radiation doses for people exposed by inhalation to 241 AmO 2 . Following a single inhalation exposure to one of three sizes of monodisperse or a polydisperse aerosol of 241 AmO 2 , pairs of dogs were sacrificed at 8, 32, 64 and 256 days, and 2 and 4 years. For about 80% of the initial lung burden, the retention halftimes were 11, 18, 26 and 27 days for the 0.75, 1.5 and 3.0 μm aerodynamic diameter and the 1.8 μm activity median aerodynamic diameter aerosols, respectively. For the remaining 20% of the initial lung burden, the retention halftimes were between 200 to 300 days with no apparent particle size influence. Additional 241 Am metabolic studies reported in the literature using inhalation exposure or injection of the citrate complex were synthesized in the model as were eleven reported cases of human inhalation exposure. This model is compared to the ICRP II and TGLD lung models, both developed by analogy to Pu metabolism. The proposed model differs from these latter models in two important areas: (a) lung retention of 241 AmO 2 could not be adapted to the classifications used in these models, and (b) the fractional translocation from lung to other organs is 2 to 8 times larger. These factors considerably alter the predicted radiation dose distribution among organs and lead to the conclusion that derived radiation protection standards for 241 AmO 2 inhalation exposure should be modified. (author)
International Nuclear Information System (INIS)
Taya, A.
1986-03-01
The binding of Am-241 hydroxide polymers to the cell components of rat lung was investigated using differential centrifugation, density gradient centrifugation with different media, gel chromatography, free flow electrophoresis and electron microscopic autoradiography with Pu-241. The bovine alveolar macrophage cultures were introduced as an in vitro test system for Am-241 uptake. Form the biochemical and electron microscopic studies it can be concluded that Am-241 is taken up by pulmonary macrophages, where its first storage site is probably the lysosome. Then the Am-241 seems to be solubilized in the lysosomes and to be bound to the cytosolic ferritin of macrophages. Am-241 might be released from the cells and crosses the alveolar membranes as bound to transferrin or as low molecular weight form. (orig.) [de
Retention of 241Am and 239Pu in the rat as influenced by Triton WR 1339
International Nuclear Information System (INIS)
Gruner, R.; Siedel, A.
1976-01-01
A lysosomotropic agent, the non-ionic detergent Triton WR 1339 (a poly-oxyethylene ether of formaldehyde polymers of octylphenol) is known to be stored in rat liver lysosomes. The results of a study made to determine whether Triton WR 1339 exerts an influence on the metabolic fate of monomeric 239 Pu and 241 Am in the rat as well as on the removal of these nuclides by DTPA, since Triton WR 1339 and transuranic elements share the same deposition site, are reported. The influence of Triton WR 1339 on the 241 Am content (per cent of 241 Am dose) of rat organs (skeleton, liver, kidneys) at different times after Triton WR 1339 injection, the influence of the time of Triton WR 1339 injection on the 241 Am content (per cent of 241 Am dose) of the same rat organs, and the influence of Triton WR 1339 Zn-DTPA and the combination of them on the retention of monomeric 239 Pu in the same rat organs (per cent of 239 Pu dose), are shown in tabular form. The mechanism whereby Triton WR 1339 appears to shorten the biological half-life of 239 Pu and 241 Am in rat liver is discussed. (U.K.)
The distribution of plutonium-241 in rodents
International Nuclear Information System (INIS)
Priest, N.D.
1977-01-01
Plutonium-241 citrate solution at pH 6.5 was injected intravenously or intraperitoneally into hamsters and rats at a dose of 50 MBq kg -1 (1.35 mCi kg -1 ). The animals were killed 1 day or 1 week later, and tissues were removed for autoradiography and radiochemical analysis. Plutonium-241 was distributed in rats in the same way as plutonium-239, and is a suitable isotope for high-resolution tissue-section autoradiography. Plutonium deposits in cells consisted of a nuclear and a cytoplasmic component. In the hamster kidney cells, the amount associated with the nucleus was about 55 per cent of the total cellular plutonium at 24 hours after injection. Six days later, it was only about 30 per cent. Plutonium deposits were also characterized in hepatocytes, in the interstitial cells of the testes, in the cells of ovarian follicles, in chondrocytes and in bone cells, including osteoblasts and osteocytes. In bone there appeared to be both an extracellular and intracellular deposit. No evidence was found of substantial incorporation of plutonium into the mineral phase of bone. (author)
Am-241 as a metabolic tracer for inhaled Pu nitrate in external chest counting
International Nuclear Information System (INIS)
Ishigure, Nobuhito; Nakano, Takashi; Enomoto, Hiroko
2000-01-01
The most difficult radionuclides to measure by extemal chest counting are the isotopes of plutonium (Pu). They are detected through weak emission of low energy L X-rays. The Pu treated in nuclear fuel cycle is usually accompanied with 241 Am produced from 241 Pu by β disintegration, which emits γ-rays of 60 keV with the emission rate of 0.36, being more penetrable than the L X-rays. The 241 Am could improve the detection limit of chest counting of Pu, if it being used as a metabolic tracer for Pu in lungs. It has already been shown that the 241 Am which would probably be embedded in a matrix of PuO 2 is cleared from the lungs at the same rate as the Pu for long time after intake (N. Ishigure, et al., Radiat, Prot. Dosim., 79, 133, 1998), which supports the validity of 241 Am as a tracer of inhaled Pu in external chest counting. In the present work another possible chemical form present in work places, Pu nitrate, has been investigated. The solution of Pu(NO 3 ) 4 was nebulized using a compressed-air operated nebulizer. The resultant droplets were passed through a tube with fresh air and conduced into a multi-port nose-only exposure chamber, which resulted in polydisperse aerosols of Pu(NO 3 ) 4 with 0.6 μm in AMAD. Young adult male Wistar rats, being 13 weeks old and weighing 230 g at the time of exposure were used. The exposed rats were periodically sacrificed and the radioactivity of 241 Am and 238/239/240 Pu in the autopsied lungs were measured by photon spectrometry with a NaI/CsI phoswich detector system. The activity ratio of 241 Am vs. Pu in lungs, 2.4% at the exposure, slowly decreased to 2.1% at 4 week and 2.0% at 24 weeks. However, from practical point of view, it could be concluded that 241 Am would be a valid metabolic tracer for inhaled Pu nitrate at least for half a year post inhalation, considering the detection limit for Pu in chest counting, which is much greater than the ALI of Pu and the large uncertainties due to the estimation of chest wall
Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils
International Nuclear Information System (INIS)
Rashydov, N.M.
2002-01-01
Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
International Nuclear Information System (INIS)
JOHNSTON GA
2008-01-01
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D and D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D and D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D and D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and Liability Act of 1980
Granulometric data 241-U tank farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
This report documents the quantitative analysis of disaggregated grains according to a grain size grouping scheme, termed herein granulometric analysis. The sediments analyzed were collected during the drilling of monitoring wells in the 241-U Tank Farm and were utilized to prepare a series of geologic maps and cross sections. The relative proportions of different sediment size fractions found in the sediments underlying the tank farm are important for the purposes of: (1) defining the relationships of various sediment types, (2) developing approximations of engineering and hydrological properties of sediments, and (3) determining sedimentary genesis. Approximately 790 sediment samples in the 241-U Tank Farm were analyzed for grain size with disaggregated intermediate diameters ranging from 64 to 0.063 millimeters. Size analysis was conducted utilizing a nest of nine screens with wire mesh size openings coinciding to the Wentworth-grade scale divisions. The granulometric data were input to a computer program (ROC) to categorize sediment samples into one of nineteen disaggregated sediment classes. Also included in ROC are calcium carbonate data which were determined by a semiquantitative carbon dioxide displacement method. A discussion of drilling and sampling methods, grain size nomenclature, sediment classification, sieving, calcium carbonate analysis, ROC computer program, and procedures is included to aid in understanding granulometric analysis. The background discussion is followed by the granulometric data from 241-U Tank Farm monitoring well sediment samples
International Nuclear Information System (INIS)
HIRZEL, D.R.
2000-01-01
The 241-2 waste tanks are used to store, treat, and transfer waste to Tank Farms. The sampling requirements are established to identify the composition of the tank waste. The primary goal is to meet the Tank Farms acceptance criteria. Tank Farms will not accept waste without extensive characterization sample data. Process and lab wastes are sampled for suitability prior to routing to Tk-D8. The samples are helpful in tracking the amount of chemical constituents to determine treatment and are required to maintain Pu inventory and criticality prevention limitations. Likewise, the waste is sampled prior to inter-tank transfers. The revised Waste Analysis Plan for 241-2 (WAP) contains current facility, process and waste descriptions. The WAP lists the Double Shell Tank (DST) system acceptance criteria, sampling parameters and required analyses. The characterization data on historical process wastes was deleted. A section on the Tank Farms waste approval procedural process was added to describe the steps necessary and documentation required to transfer waste to the DST system. Failure to collect proper samples will result in Tank Farms' refusal to accept PFP waste until proper sampling conditions are met. This will use up unnecessary time and resources but not place the plant in a hazardous position
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan
International Nuclear Information System (INIS)
RASMUSSEN, J.H.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102 required to satisfy the Data Quality Objectives For TWRS Privatization Phase I : Confirm Tank TIS An Appropriate Feed Source For High-Level Waste Feed Batch X(HLW DQO) (Nguyen 1999a), Data Quality Objectives For TWRS Privatization Phase 1: Confirm Tank TIS An Appropriate Feed Source For Low-Activity Waste Feed Batch X (LAW DQO) (Nguyen 1999b), Low Activity Waste and High Level Waste Feed Data Quality Objectives (L and H DQO) (Patello et al. 1999) and Characterization Data Needs for Development, Design, and Operation of Retrieval Equipment Developed through the Data Quality Objective Process (Equipment DQO) (Bloom 1996). The Tank Characterization Technical Sampling Basis document (Brown et al. 1998) indicates that these issues, except the Equipment DQO apply to tank 241-AZ-102 for this sampling event. The Equipment DQO is applied for shear strength measurements of the solids segments only. Poppiti (1999) requires additional americium-241 analyses of the sludge segments. Brown et al. (1998) also identify safety screening, regulatory issues and provision of samples to the Privatization Contractor(s) as applicable issues for this tank. However, these issues will not be addressed via this sampling event. Reynolds et al. (1999) concluded that information from previous sampling events was sufficient to satisfy the safety screening requirements for tank 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
International Nuclear Information System (INIS)
ANDREWS, J.E.
2000-01-01
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications
Tank 241-BY-110 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110
Tank 241-AN-102 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-AN-102
Tank 241-U-111 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-U-111
Tank 241-S-107 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-S-107
Tank 241-B-106 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-B-106
Tank 241-SY-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-SY-103
27 CFR 19.241 - Operations bond-distilled spirits plant and adjacent bonded wine cellar.
2010-04-01
... spirits plant and adjacent bonded wine cellar. 19.241 Section 19.241 Alcohol, Tobacco Products and... wine cellar. (a) General. A wine cellar under the provisions of 27 CFR part 24 shall be treated as... subpart G for the production of distilled spirits; and (2) Such wine cellar and distilled spirits plant...
Radiation protection data sheets for the use of Americium 241 in unsealed sources
International Nuclear Information System (INIS)
Anon.
1993-01-01
This radiation protection data sheet is intended for supervisors and staff in the different medical, hospital, pharmaceutical, university and industrial laboratories and departments where Americium 241 is handled, and also for all those involved in risk prevention in this field. It provides essential data on radiation protection measures during the use of Americium 241 in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography
Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.
2007-09-13
As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
International Nuclear Information System (INIS)
Rapko, Brian M.; Vienna, John D.
2002-01-01
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30
Selective Leaching of Chromium from Hanford Tank Sludge 241-U-108
Energy Technology Data Exchange (ETDEWEB)
Rapko, Brian M.; Vienna, John D.
2002-09-09
This study evaluated the oxidants permanganate, MnO4-, and peroxynitrite, ONOO-, as selective chromium-leaching agents from washed 241-U-108 tank sludge under varying conditions of hydroxide concentration, temperature, and time. The mass changes and final sludge compositions were evaluated using glass-property models to ascertain the relative impacts of the various oxidative alkaline leach conditions on the amount of borosilicate glass required to immobilize a given amount of washed 241-U-108 Hanford tank sludge. Only permanganate leaching removes sufficient chromium to make the chromium concentration in the oxidatively alkaline leached solids non-limiting. In the absence of added oxidants, continued washing or caustic leaching have no beneficial effects. Peroxynitrite addition reduces the amount of glass required to immobilize a given amount of washed 241-U-108 tank sludge by approximately a factor of two. Depending on the leach conditions and the exact chromium concentration limits, contact with alkaline permanganate solutions reduces the amount of immobilized high-level waste glass by a factor of 10 to 30.
An assessment of the dilution required to mitigate Hanford tank 241-SY-101
International Nuclear Information System (INIS)
Hudson, J.D.; Bredt, P.R.; Felmy, A.R.; Stewart, C.W.; Tingey, J.M.; Trent, D.S.; Barney, G.S.; Herting, D.L.; Larrick, A.P.; Reynolds, D.A.
1995-02-01
A group of experts from PNL and WHC convened November 2 and 3, 1994, to screen the current state of knowledge about dilution and reach a consensus on the minimum dilution ratio that will achieve passive mitigation of Tank 241-SY-101 wastes and the dilution ratio that would satisfy the given cross-site transfer criteria with reasonable assurance. The panel evaluated the effects of dilution on the parameters important in gas generation, retention, and release and reached the following conclusions, which are deduced from the existing body of data, experience, and analyses: (1) Dissolution of solids is the single most important aspect of mitigation by dilution. We are confident that diluting until nitrates, nitrites, and aluminum salts are dissolved will mitigate Hanford flammable gas tanks; (2) Sufficient solids dissolution can be achieved in Tank 241-SY-101 at a dilution ratio of 1:1, which will result in a average specific gravity of approximately 1.35. It is likely that a 0.5:1 dilution will also mitigate 241-SY-101, but the current uncertainty is too high to recommend this dilution ratio; (3) The recommended dilution requires a diluent with at least 2 molar free hydroxide, because aluminum probably precipitates at lower hydroxide concentrations. The transfer criteria for Tank 241-SY-101 waste were also evaluated. These criteria have been specified as solids content ≤30% (volume), viscosity ≤30% cP and density <1.5 g/mL. (1) Solids content is the limiting criterion if it is defined as volume fraction of settled solids. A 1:1 dilution will satisfy this criterion at nominal premixing conditions in Tank 241-SY-101; however, analysis of Window E core samples suggests that up to 1.5:1 might be required. If the solids content is interpreted simply as solids volume fraction no further dilution is necessary, because Tank 241-SY-101 waste (excluding the crust) is already below 30%; (2) Bulk density is the next limiting criterion and is met at 0.4:1 dilution
XRCC3 Thr241Met Polymorphism is not Associated with Lung Cancer Risk in a Romanian Population.
Catana, Andreea; Pop, Monica; Marginean, Dragos Horea; Blaga, Ioana Cristina; Porojan, Mihai Dumitru; Popp, Radu Anghel; Pop, Ioan Victor
2016-01-01
Deoxyribonucleic Acid (DNA) repair mechanisms play a critical role in protecting the cellular genome against carcinogens. X-ray cross-complementing gene 3 (XRCC3) is involved in DNA repair and therefore certain genetic polymorphisms that occur in DNA repair genes may affect the ability to repair DNA defects and may represent a risk factor in carcinogenesis. The purpose of our study was to investigate the association between XRCC3 gene substitution of Threonine with Methionine in codon 241 of XRCC3 gene (Thr241Met) polymorphism and the risk of lung cancer, in a Romanian population. We recruited 93 healthy controls and 85 patients with lung cancer, all smokers. Thr241Met, XRCC3 gene genotyping was determined by multiplex Polymerase Chain Reaction-Restriction Fragment Length Polymorphism (PCR-RFLP). Statistical analysis (OR, recessive model), did not revealed an increased risk for lung cancer, for the variant 241Met allele and Thr241Met genotypes (p=0.138, OR=0.634, CI=0.348-1.157; p=0.023, OR=0.257, CI=0.085-6.824). Also, there were no positive statistical associations between Thr241Met polymorphism of XRCC3 gene, gender, tobacco and various histopathological tumor type of lung cancer. In conclusion, the results of the study suggest that the XRCC3 gene Thr241Met polymorphism is not associated with an increased risk for the development of lung cancer in this Romanian group.
39 CFR 241.3 - Discontinuance of post offices.
2010-07-01
... CLASSIFICATION, AND DISCONTINUANCE § 241.3 Discontinuance of post offices. (a) Introduction—(1) Coverage. This... justify in sufficient detail to Postal Service management and affected customers the proposed service... inspection during normal business hours at each post office where the Final Determination is posted for 30...
Inhalation toxicology of 241Am(NO3)3
International Nuclear Information System (INIS)
Ballou, J.E.; Gies, R.A.; Beasley, A.H.
1980-01-01
Inhaled 241 Am(NO 3 ) 3 was rapidly cleared from the lung (90% in 30 days) and translocated principally to skeleton. Although the estimated radiation dose to lung was twofold greater than the bone dose, the principal treatment-related lesion appeared to be osteosarcoma of the skeleton
Double-Shell Tank Visual Inspection Changes Resulting from the Tank 241-AY-102 Primary Tank Leak
International Nuclear Information System (INIS)
Girardot, Crystal L.; Washenfelder, Dennis J.; Johnson, Jeremy M.; Engeman, Jason K.
2013-01-01
As part of the Double-Shell Tank (DST) Integrity Program, remote visual inspections are utilized to perform qualitative in-service inspections of the DSTs in order to provide a general overview of the condition of the tanks. During routine visual inspections of tank 241-AY-102 (AY-102) in August 2012, anomalies were identified on the annulus floor which resulted in further evaluations. In October 2012, Washington River Protection Solutions, LLC determined that the primary tank of AY-102 was leaking. Following identification of the tank AY-102 probable leak cause, evaluations considered the adequacy of the existing annulus inspection frequency with respect to the circumstances of the tank AY-102 1eak and the advancing age of the DST structures. The evaluations concluded that the interval between annulus inspections should be shortened for all DSTs, and each annulus inspection should cover > 95 percent of annulus floor area, and the portion of the primary tank (i.e., dome, sidewall, lower knuckle, and insulating refractory) that is visible from the annulus inspection risers. In March 2013, enhanced visual inspections were performed for the six oldest tanks: 241-AY-101, 241-AZ-101,241-AZ-102, 241-SY-101, 241-SY-102, and 241-SY-103, and no evidence of leakage from the primary tank were observed. Prior to October 2012, the approach for conducting visual examinations of DSTs was to perform a video examination of each tank's interior and annulus regions approximately every five years (not to exceed seven years between inspections). Also, the annulus inspection only covered about 42 percent of the annulus floor
Tank characterization report for single-shell tank 241-B-104
International Nuclear Information System (INIS)
Field, J.G.
1996-01-01
This document summarizes information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-104. Sampling and analyses meet safety screening and historical data quality objectives. This report supports the requirements of Tri-party Agreement Milestone M-44-09. his characterization report summoned the available information on the historical uses and the current status of single-shell tank 241-B-104, and presents the analytical results of the June 1995 sampling and analysis effort. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-44-09 (Ecology et al. 1994). Tank 241-B-104 is a single-shell underground waste storage tank located in the 200 East Area B Tank Farm on the Hanford Site. It is the first tank in a three-tank cascade series. The tank went into service in August 1946 with a transfer of second-cycle decontamination waste generated from the bismuth phosphate process. The tank continued to receive this waste type until the third quarter of 1950, when it began receiving first-cycle decontamination waste also produced during the bismuth phosphate process. Following this, the tank received evaporator bottoms sludge from the 242-B Evaporator and waste generated from the flushing of transfer lines. A description and the status of tank 241-B-104 are sum in Table ES-1 and Figure ES-1. The tank has an operating capacity of 2,010 kL (530 kgal), and presently contains 1,400 kL (371 kgal) of waste. The total amount is composed of 4 kL (1 kgal) of supernatant, 260 kL (69 kgal) of saltcake, and 1,140 kL (301 kgal) of sludge (Hanlon 1995). Current surveillance data and observations appear to support these results
Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer
Energy Technology Data Exchange (ETDEWEB)
ANDREWS, J.E.
2000-01-27
This document comprises the Acceptance Test Report for the 241-AZ-101 Ultrasonic Interface Level Analyzer. This document presents the results of Acceptance Testing of the 241-AZ-101 Ultrasonic Interface Level Analyzers (URSILLAs). Testing of the URSILLAs was performed in accordance with ATP-260-001, ''URSILLA Pre-installation Acceptance Test Procedure''. The objective of the testing was to verify that all equipment and components function in accordance with design specifications and original equipment manufacturer's specifications.
Liver cancer induction by 241Am and thorotrast in deer mice and grasshopper mice
International Nuclear Information System (INIS)
Taylor, G.N.; Mays, C.W.; Lloyd, R.D.; Jones, C.W.; Rojas, J.; Wrenn, M.E.; Ayoroa, G.; Kaul, A.; Riedel, W.
1986-01-01
The carcinogenicity of 241 Am, relative to thorotrast, has been determined in two species of mice: the grasshopper mouse (Onychomys leucogaster) and the deer mouse (Peromyscus maniculatus). These species were used since both have high uptakes of Pu and Am and, unlike conventional mice and rats, both retain relatively high concentrations of plutonium and americium in their livers. The study indicated that the liver carcinogenicity of comparable rad doses of 241 Am or thorotrast is approximately equal. The toxicity ratio ( 241 Am/thorotrast) for liver cancer induction approximated 1.2 with a range of about 0.6 to 1.6. This suggested that nonradiation factors of thorotrast were not significant in liver tumor induction. (orig.)
Effect of alcohol on internally deposited Am-241 in the baboon: a pilot study
International Nuclear Information System (INIS)
Cohen, N.; Antonelli, R.; LoSasso, T.
1977-01-01
The efficacy of ethyl alcohol in enhancing the excretion of Am-241 from the baboon has been tested. Alcohol enhances Am-241 excretion via the fecal route by a factor of about 2.5. However, there is a corresponding increase in fecal volume, and no significant change in the concentration of the nuclide in the feces. Other cathartics tested caused increased fecal volumes with no change in amount of activity excreted leading to a decreased concentration of the nuclide in the feces. Alcohol is not as effective as DTPA in removing Am-241 from the body. Preliminary results suggest that alcohol has little or no enhancement effect on the decorporation capability of DTPA
Operability test procedure [Tank] 241-SY-101 equipment removal system
International Nuclear Information System (INIS)
Mast, J.C.
1994-01-01
The 241-SY-101 equipment removal system (ERS) consists of components, equipment, instrumentation and procedures that will provide the means to disconnect, retrieve, contain, load and transport the Mitigation Pump Assembly (MPA) from waste Tank 241-SY-101 to the Central Waste Complex (CWC). The Operability Test Procedure (OTP) will test the interfaces between ERS components and will rehearse the procedure for MPA removal and transportation to the extent they can be mocked-up at the CTF (Cold Test Facility). At the conclusion of the OTP, the ERS components and equipment will be removed from the CTF, entered into the Component Based Recall System (CBRS), and stored until needed for actual MPA removal and transportation
30 CFR 241.72 - How will the Office of Hearings and Appeals conduct the hearing on the record?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will the Office of Hearings and Appeals conduct the hearing on the record? 241.72 Section 241.72 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PENALTIES Penalties for Federal and Indian Oil and Gas Leases General Provisions § 241.72 How...
36 CFR 241.2 - Cooperation in wildlife management.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.2 Cooperation in wildlife management. The Chief of the... which national forests or portions thereof may be devoted to wildlife protection in combination with...
24 CFR 241.555 - Security instrument and lien.
2010-04-01
... that a default under the first mortgage is a default under the supplementary loan security instrument... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security instrument and lien. 241... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
The readiness of the upgraded 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mixer pump and instrumentation in tank 241-SY-101 was evaluated by the performance of OTP-440-001. Results of the OTP are reported here
Acceptance Test Report for 241-U compressed air system
International Nuclear Information System (INIS)
Freeman, R.D.
1994-01-01
This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027
241-SY-101 multi-functional instrument tree acceptance for beneficial use (ABU)
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This document formally demonstrates that the ABU process for the 241-SY-101 risers 17B and 17C Multi-functional Instrument Trees (MIT's) has been properly completed in accordance with the approved ABU checklists. For each item required on the ABU Checklist, a bibliography of the documentation prepared and released to satisfy the requirements is provided. Release of this documentation signifies that the tank farm Operations, Engineering, and Maintenance organizations have accepted responsibility for the MIT'S in 241-SY-101 Risers 17B and 17C
Characterisation of a protection level Am-241 calibration source
Bass, G. A.; Rossiter, M. J.; Williams, T. T.
1992-11-01
The various measurements involved in the commissioning process of an Am-241 radioactive source and transport mechanisms to be used for protection level calibration work are detailed. The source and its handling mechanisms are described and measurements to characterize the resultant gamma ray beam are described. For the beam measurements, the inverse square law is investigated and beam uniformity is assessed. A trial calibration of ionization chambers is described. The Am-241 irradiation facility is concluded to be suitable for calibrating secondary standards as part of the calibration service offered for protection level instruments. The umbra part of beam is acceptably uniform for a range of chambers and the measurements obtained were predictable and consistent. This quality will be added to the range of qualities offered as part of the protection level secondary standard calibration service.
36 CFR 241.1 - Cooperation in wildlife protection.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.1 Cooperation in wildlife protection. (a) Officials of the... and regulations for the protection of wildlife. (b) Officials of the Forest Service who have been, or...
27 CFR 24.241 - Decolorizing juice or wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Decolorizing juice or wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.241 Decolorizing juice or wine. (a) Conditions and limitations. If the proprietor wishes to use activated carbon or other...
Engineering evaluation of alternatives: Managing the assumed leak from single-shell Tank 241-T-101
International Nuclear Information System (INIS)
Brevick, C.H.; Jenkins, C.
1996-02-01
At mid-year 1992, the liquid level gage for Tank 241-T-101 indicated that 6,000 to 9,000 gal had leaked. Because of the liquid level anomaly, Tank 241-T-101 was declared an assumed leaker on October 4, 1992. SSTs liquid level gages have been historically unreliable. False readings can occur because of instrument failures, floating salt cake, and salt encrustation. Gages frequently self-correct and tanks show no indication of leak. Tank levels cannot be visually inspected and verified because of high radiation fields. The gage in Tank 241-T-101 has largely corrected itself since the mid-year 1992 reading. Therefore, doubt exists that a leak has occurred, or that the magnitude of the leak poses any immediate environmental threat. While reluctance exists to use valuable DST space unnecessarily, there is a large safety and economic incentive to prevent or mitigate release of tank liquid waste into the surrounding environment. During the assessment of the significance of the Tank 241-T-101 liquid level gage readings, Washington State Department of Ecology determined that Westinghouse Hanford Company was not in compliance with regulatory requirements, and directed transfer of the Tank 241-T-101 liquid contents into a DST. Meanwhile, DOE directed WHC to examine reasonable alternatives/options for safe interim management of Tank 241-T-101 wastes before taking action. The five alternatives that could be used to manage waste from a leaking SST are: (1) No-Action, (2) In-Tank Stabilization, (3) External Tank Stabilization, (4) Liquid Retrieval, and (5) Total Retrieval. The findings of these examinations are reported in this study
PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION
Energy Technology Data Exchange (ETDEWEB)
JOHNSTON GA
2008-01-15
Fluor Hanford, Inc. (FH) is proud to submit the Plutonium Finishing Plant (PFP) 241-Z liquid Waste Treatment Facility Deactivation and Demolition (D&D) Project for consideration by the Project Management Institute as Project of the Year for 2008. The decommissioning of the 241-Z Facility presented numerous challenges, many of which were unique with in the Department of Energy (DOE) Complex. The majority of the project budget and schedule was allocated for cleaning out five below-grade tank vaults. These highly contaminated, confined spaces also presented significant industrial safety hazards that presented some of the most hazardous work environments on the Hanford Site. The 241-Z D&D Project encompassed diverse tasks: cleaning out and stabilizing five below-grade tank vaults (also called cells), manually size-reducing and removing over three tons of process piping from the vaults, permanently isolating service utilities, removing a large contaminated chemical supply tank, stabilizing and removing plutonium-contaminated ventilation ducts, demolishing three structures to grade, and installing an environmental barrier on the demolition site . All of this work was performed safely, on schedule, and under budget. During the deactivation phase of the project between November 2005 and February 2007, workers entered the highly contaminated confined-space tank vaults 428 times. Each entry (or 'dive') involved an average of three workers, thus equaling approximately 1,300 individual confined -space entries. Over the course of the entire deactivation and demolition period, there were no recordable injuries and only one minor reportable skin contamination. The 241-Z D&D Project was decommissioned under the provisions of the 'Hanford Federal Facility Agreement and Consent Order' (the Tri-Party Agreement or TPA), the 'Resource Conservation and Recovery Act of 1976' (RCRA), and the 'Comprehensive Environmental Response, Compensation, and
International Nuclear Information System (INIS)
Godoy, J.M.; Schuettelkopf, H.; Pimpl, M.
1983-04-01
A procedure was developed to measure Pu-241 by liquid scintillation counting. Sample preparation was performed by electroplating of plutonium on stainless steel planchets. To correct the selfabsorption, the linear dependence of counting efficiency in the liquid scintillation counter from the resolution in the alpha spectrometer was used. Pu-238, Pu-239+240 and Pu-241 were measured in the liquid effluents of the Karlsruhe Nuclear Research Center (KfK). The concentrations in monthly mixed samples ranged from 0.07 until 46 nCi Pu-238/m 3 , from 0.13 until 2.1 nCi Pu-239+240/m 3 and from 25 until 190 nCi Pu-241/m 3 . Between 5.4% and 41% of the plutonium content of the KfK waste water are released to the River Old Rhine. The values for the activity ratio Pu-238/Pu-239+240 are between 0.39 and 1.1 and for Pu-241/Pu-239+240 are between 11 and 300. The mean value for Pu-241/Pu-239+240 is 61. The dose exposure of the environmental population of the Karlsruhe Nuclear Research Center caused by released Pu-241 is negligible low. (orig./HP) [de
241Am induced thyroid lesions in the beagle: interim observations
International Nuclear Information System (INIS)
Taylor, G.N.; Zizumbo, I.; Angus, W.; Jones, A.; Elliot, D.
1976-01-01
Injected doses of 2.88, 0.91 or 0.296 μCi 241 Am/kg in young adult beagles produced morphological changes in the thyroid gland and produce lower concentrations of thyroxin in the sera. Interstitial fibrosis without functional impairment was induced by the 0.099 μCi 241 Am/kg dose level. Clinical symptoms of hypothyroidism were not observed, even in those dogs with the most extreme thyroid lesions. The changes were characterized by a decrease in thyroid weight, interfollicular fibrosis, loss of colloid, loss of follicular epithelium, and hypertrophy and hyperplasia of the residual epithelium. Thus far, thyroid tumors have not been observed, however, a significant percentage of the animals in the lower dose levels are still living
A detailed reassessment of the criticality property of pure 241Am
International Nuclear Information System (INIS)
Ganesan, Srinivasan; Wienke, Harm
2002-01-01
We present results of new calculations of criticality of pure 241 Am using several basic evaluated neutron-nuclear cross section databases. The re-assessment of the criticality property of 241 Am presented in this paper is relevant to studies of criticality safety, nuclear waste incineration and non-proliferation. Our calculations start from the basic evaluated nuclear data files and use the NJOY-MCNP code system. This paper invalidates the earlier conclusion and belief in a section of the national and international literature that the minor actinide 241 Am is better than 235 U or 239 Pu as a nuclear fuel. Further our calculated critical mass is larger by 28% than the 197 kg reported in 1997 by Nojiri and Fukasaku who used the SCALE-4.3 system using the same ENDF/B-VI data, showing that there is large discrepancy due to the use of different computational codes and/or QA in nuclear data processing. Our calculated value of critical mass using JENDL-3.2 is 75 kg. This result is essentially in agreement with Nojiri and Fukasaku who used the same JENDL-3.2 data and the then available version of the NJOY-MCNP systems. (author)
Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data
Energy Technology Data Exchange (ETDEWEB)
Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.
2007-05-23
This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.
Project W-320, 241-C-106 sluicing: Civil/structural calculations. Volume 6
Energy Technology Data Exchange (ETDEWEB)
Bailey, J.W.
1998-07-24
This supporting document has been prepared to make the FDNW calculations for Project W-320 readily retrievable. The purpose of this calculation is to conservatively estimate the weight of equipment and structures being added over Tank 241-C-106 as a result of Project W-320 and combine these weights with the estimated weights of existing structures and equipment as calculated in Attachment 1. The combined weights will be compared to the allowable live load limit to provide a preliminary assessment of loading conditions above Tank 241-C-106.
Engineering Task Plan for Tank 241-C-106 contingency chiller definitive design
International Nuclear Information System (INIS)
Rensink, G.E.; Kriskovich, J.R.
1995-01-01
This document identifies the scope, cost, schedule and responsible organizations for completing a design of a contingency ventilation inlet air cooling system for Tank 241-C-106. The air cooling system, described in Rensink (1995), consists of a chiller, cooling coils, and supporting equipment that, when installed will be capable of assuring that the waste temperatures in Tank 241-C-106 are maintained within acceptable limits for safe storage. The effort described herein is scheduled for completion by May 31, 1995 to support Performance Based Incentive (PBI) Milestone SI-2x
International Nuclear Information System (INIS)
Giesy, J.P. Jr.; Paine, D.
1977-01-01
Naturally occurring organics were extracted from water collected from Skinface Pond near Aiken, S.C. Organics were separated into four nominal diameter size fractions (I, greater than 0.0183; II, 0.0183 to 0.0032; III, 0.0032 to 0.0009; IV, less than 0.0009 μm) by membrane ultrafiltration and introduced into Scenedesmus obliquus and Aeromonas hydrophila cultures to determine their effects on 241 Am availability for uptake. Effects on 241 Am uptake were determined in actively growing S. obliquus cultures after 96 h of growth and in dense cultures of nongrowing cells after 4 h. Uptake by A. hydrophila was determined after 4 and 24 h in actively growing cultures. All organic fractions stimulated S. obliquus growth, with the most pronounced effects due to larger organic fractions, whereas no apparent growth stimulation of A. hydrophila was observed for any organic fraction. For both long-term and short-term studies, cellular 241 Am concentration (picocuries/cell) increased with increasing 241 Am concentration for S. obliquus and A. hydrophila. Fraction IV increased 241 Am uptake by both S. obliquus and A. hydrophila during 4-h incubations. During 96-h incubations fraction I was flocculated and cosedimented, with S. obliquus and A. hydrophila cells causing an apparent increase in 241 Am uptake. Fractions II and III reduced apparent 241 Am uptake by S. obliquus as a result of biological dilution caused by increased algal growth due to the organics. Fraction IV caused a reduction in 241 Am uptake by S. obliquus not attributable to biological dilution. Organics increased 241 Am uptake by A. hydrophila during 4- and 24-h incubations. A. hydrophila also caused flocculation of fraction I during 96-h incubations
Priest, N D; Howells, G; Green, D; Haines, J W
1983-01-01
The distribution and retention of intravenously injected 241Am in the skeleton of the female rat has been investigated using autoradiographic and radiochemical techniques. The studies were designed to assess the dosimetric and toxicologic implications of an 241Am intake by man. They showed that in the rat approximately one third of the intravenously injected 241Am was deposited in the skeleton where it appeared to be retained with a long biological half-time. The studies also showed: 1 241Am is initially deposited onto all types of bone surface including endosteal surfaces, periosteal surfaces and those of the vascular canals within cortical bone, but seems to be preferentially deposited onto those that are resorbing, 2 Bone accretion results in the burial of surface deposits of 241Am, 3 Bone resorption causes the removal of 241Am from surfaces, 4 Resorbed 241Am is retained by phagocytic cells (probably macrophages) in the bone marrow, 5 The transfer of 241Am from the phagocytic cells in the marrow to adjacent bone surfaces seems to occur, (local recycling). 6 The possibility that some of the 241Am removed from the bone surfaces enters the blood and is redeposited in bone, (systemic recycling) cannot be dismissed. These results show that 241Am deposition and redistribution in bone shares many characteristics with other 'bone surface-seeking radionuclides' typified by 239Pu. Consequently, it is suggested that a similar model to that used to calculate annual limits of intake for 239Pu in man would be suitable for the calculation of corresponding values for the 241Am isotopes.
Adsorption of 241Am and 226Ra from natural water by wood charcoal
International Nuclear Information System (INIS)
Miro, C.; Baeza, A.; Salas, A.; Pastor-Valle, J.F.; Pastor-Villegas, J.
2008-01-01
The adsorption of 241 Am and 226 Ra from natural water by a granulated wood charcoal was investigated as a function of the solution pH, in the range 4-10, and of the water flow, in the range 3.5-42 cm 3 /min. The percentage adsorption of 241 Am (fairly constant at >80% for all pHs) was greater than that of 226 Ra (which increased with increasing pH from ∼40% up to >80%). The results are explained by considering the different species of each radionuclide present at the pH values of the solution at the end of the adsorbent column, and the pH of the point of zero charge of the adsorbent. At pH 6, the elimination of 241 Am from natural water was independent of the water flow, while the elimination of 226 Ra declined linearly as the flow rate was increased
Neutron and gamma-ray spectra of 239PuBe and 241AmBe
International Nuclear Information System (INIS)
Vega-Carrillo, H.R.; Manzanares-Acuna, Eduardo; Becerra-Ferreiro, A.M.; Carrillo-Nunez, Aureliano
2002-01-01
Neutron and gamma-ray spectra of 239 PuBe and 241 AmBe were measured and their dosimetric features were calculated. Neutron spectra were measured using a multisphere neutron spectrometer with a 6 LiI(Eu) scintillator. The 239 PuBe neutron spectrum was measured in an open environment, while the 241 AmBe neutron spectrum was measured in a closed environment. Gamma-ray spectra were measured using a NaI(Tl) scintillator using the same experimental conditions for both sources. The effect of measuring conditions for the 241 AmBe neutron spectrum indicates the presence of epithermal and thermal neutrons. The low-resolution neutron spectra obtained with the multisphere spectrometer allows one to calculate the dosimetric features of neutron sources. At 100 cm both sources produce approximately the same count rate as that of the 4.4 MeV gamma-ray per unit of alpha emitter activity
Tank 241-BY-105 rotary core sampling and analysis plan
International Nuclear Information System (INIS)
Sasaki, L.M.
1995-01-01
This Sampling and Analysis Plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for two rotary-mode core samples from tank 241-BY-105 (BY-105)
Tank 241-BY-103 Tank Characterization Plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-103
International Nuclear Information System (INIS)
Sehmel, G.A.
1978-01-01
Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height
Tank 241-U-203: Tank Characterization Plan
International Nuclear Information System (INIS)
Sathyanarayana, P.
1995-01-01
The revised Federal Facility Agreement and Consent Order states that a tank characterization plan will be developed for each double-shell tank and single-shell tank using the data quality objective process. The plans are intended to allow users and regulators to ensure their needs will be met and resources are devoted to gaining only necessary information. This document satisfies that requirement for Tank 241-U-203 sampling activities
Compressed air piping, 241-SY-101 hydraulic pump retrieval trailer
International Nuclear Information System (INIS)
Wilson, T.R.
1994-01-01
The following Design Analysis was prepared by the Westinghouse Hanford Company to determine pressure losses in the compressed air piping installed on the hydraulic trailer for the 241-SY-101 pump retrieval mission
Improved MOX fuel calculations using new Pu-239, Am-241 and Pu-240 evaluations
International Nuclear Information System (INIS)
Noguere, G.; Bouland, O.; Bernard, D.; Leconte, P.; Blaise, P.; Peneliau, Y.; Vidal, J.F.; Saint Jean, C. de; Leal, L.; Schilleebeeckx, P.; Kopecky, S.; Lampoudis, C.
2013-01-01
Several studies based on the JEFF-3.1.1 nuclear data library show a systematic over-estimation of the critical keff for core configurations of MOX fuel assemblies. The present work investigates possible improvements of the C/E results by using new evaluations for Am-241, Pu-239 and Pu-240. The work reported in this paper demonstrates the performances of the new Am-241 evaluation based on capture and transmission data measured at the IRMM. For Pu-239, the new evaluation, established in the frame of the WPEC/SG-34, is able to explain a systematic discrepancy observed between different EOLE experiments. The combination of the Am-241 and Pu-239 evaluations demonstrates the necessity to improve the radiation width of the first resonance of Pu-240
Energy Technology Data Exchange (ETDEWEB)
Want, J.; Merry-Libby, P.
1985-10-29
Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body because of its high dose conversion factor. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. In Ohio, a gemologist's laboratory was contaminated with americium-241. Prior to decontamination of the laboratory, potential radiological impacts to the surrounding environment were assessed. A hypothetical fire accident resulting in a unit release (1 curie) was assumed. Potential radiological impacts were simulated using an atmospheric dispersion and dosimetry model with local meteorological data, population census data, and detailed information regarding the neighborhood. The results indicate that there could have been a significant impact on nearby residents from americium-241 via atmospheric dispersion if a major catastrophic release had occurred prior to contamination and decommissioning of the laboratory. 14 refs., 3 figs., 2 tabs.
241Am, 137Cs, Sr and Pb uptake by tobacco as influenced by application of Fe chelators to soil
International Nuclear Information System (INIS)
Fuhrmann, Mark; Lanzirotti, Antonio
2005-01-01
To determine the potential for phytoextraction of 241 Am and other contaminants from soil, accumulation of 241 Am, 137 Cs, Sr, Fe, Al, Pb, and Mg by tobacco was determined for soil applications of two concentrations of ethylenediaminetetraacetic acid (EDTA), citric acid, and ascorbic acid. In tobacco receiving EDTA at 3.1 mmol/kg of soil, 241 Am content of plants averaged 15 Bq/kg (ranging up to 26 Bq/kg) while Fe concentrations became constant at 4.5 mmol/kg. Soil treatment with 18.8 mmol/kg EDTA resulted in average 241 Am concentrations of 29 Bq/kg (19 times higher than controls). Uptake of Pb was similar to 241 Am. In these samples, Fe increased to a maximum of almost 18 mmol/kg and 241 Am content increased linearly with both Fe and Al. Plants receiving ascorbic and citric acids took up smaller quantities of 241 Am, Pb, and Fe, even though these reagents were able to elute about as much Fe from the soil as EDTA. Synchrotron microbeam X-ray fluorescence (SXRF) was used to determine radial distributions of elements in roots and stems with and without EDTA treatment. SXRF maps indicate differences in behavior between Fe and Pb that are consistent with the bulk plant observations and provide insight into changes in metal content of the roots in the presence of EDTA
International Nuclear Information System (INIS)
Zal U'yun Wan Mahmood; Hidayah Shahar; Zaharudin Ahmad; Yii Mei Wo; Ahmad Sanadi Abu Bakar
2010-01-01
The present distributions of 239+240 Pu, 241 Am and activity ratio of 241 Am/ 239+240 Pu in surface seawater of the Peninsular Malaysia east coast were studied. The surface seawater samples were collected at 30 identified stations during the expedition conducted in 2008. 239+240 Pu activity concentrations in surface seawater of the studied area were in the range of 2.33 ± 0.20-7.95 ± 0.68 mBq/m 3 , meanwhile 241 Am activity concentrations ranged from MDA to 1.90 ± 0.23 mBq/m 3 . The calculated activity ratios of 241 Am/ 239+240 Pu were varied and disperse distributed with the ranged of 0.12-0.53. The relationships between anthropogenic radionuclide and oceanographic parameters such as turbidity and salinity were examined. The linearly relationships between 239+240 Pu and oceanographic parameters are important for better understanding of its transport processes and behavior in the east coast of Peninsular Malaysia marine environment. Thus, the differ of distribution of 239+240 Pu, 241 Am and 241 Am/ 239+240 Pu in the studied area mainly due to high affinity of 239+240 Pu to associate with sinking particles, mobility nature of 241 Am, degree of particle reactive of both anthropogenic radionuclides, scavenging and removal process; and others. (author)
Methods of assessment of whole body 241Am content
International Nuclear Information System (INIS)
Foltanova, S.; Malatova, I.; Klisak, J.
1998-01-01
This paper discuss an influence of different skull phantoms on efficiency of the measurement. Description of some methods of an assessment of the 241 Am content in the human skeleton from measurements performed over long bones of the human body is also offered. (authors)
International Nuclear Information System (INIS)
ERMI, A.M.
1999-01-01
This procedure provides instructions for readiness of the first portion of the upgraded 241-SY-101 Data Acquisition and Control System (DACS) computer system to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank will be systematically evaluated by the performance of this procedure
Tank 241-C-108 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-C-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-C-108 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-107 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-107 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-107 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank 241-BY-108 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in ''Program Plan for the Resolution of Tank Vapor Issues'' (Osborne and Huckaby 1994). Tank 241-BY-108 was vapor sampled in accordance with ''Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution (Osborne et al., 1994)
Tank 241-BY-106 vapor sampling and analysis tank characterization report. Revision 1
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank 241-BY-106 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. The drivers and objectives of waste tank headspace sampling and analysis are discussed in open-quotes Program Plan for the Resolution of Tank Vapor Issues.close quotes Tank 241-BY-106 was vapor sampled in accordance with open-quotes Data Quality Objectives for Generic In-Tank Health and Safety Issue Resolution.close quotes
Tank characterization report for double-shell Tank 241-AW-105
International Nuclear Information System (INIS)
DiCenso, A.T.; Amato, L.C.; Franklin, J.D.; Lambie, R.W.; Stephens, R.H.; Simpson, B.C.
1994-01-01
In May 1990, double-shell Tank 241-AW-105 was sampled to determine proper handling of the waste, to address corrosivity and compatibility issues, and to comply with requirements of the Washington Administrative Code. This Tank Characterization Report presents an overview of that tank sampling and analysis effort, and contains observations regarding waste characteristics. It also addresses expected concentration and bulk inventory data for the waste contents based on this latest sampling data and background tank information. This report summarizes the available information regarding the waste in Tank 241-AW-105, and using the historical information to place the analytical data in context, arranges this information in a useful format for making management and technical decisions concerning this waste tank. In addition, conclusions and recommendations are given based on safety issues and further characterization needs
Activity determination of the Am-241 sources from radioactive lightning rods
International Nuclear Information System (INIS)
Minematsu, Denise; Dellamano, Jose Claudio; Ferreira, Robson de Jesus
2009-01-01
The authorization for manufacture commerce and installation of radioactive lightning rods, in Brazil, was lifted in 1989 by the National Nuclear Energy Commission - CNEN (Resolution no 4/89). Since this date, these devices have been replaced and have been sent to the Institutes subordinated to the CNEN, amongst them the Nuclear and Energy Research Institute - IPEN-CNEN/SP. Radioactive Waste Management Laboratory - RWML of the IPEN - CNEN/SP had received, approximately, 16,000 units up to the end of 2008. The radioactive lightning rod is constituted in its majority, for a central metallic rod, where two or three metallic plates are mounted. In these plates, on average, six Am-241 sources are fixed. The process used for the radioactive lightning rods treatment is the dismantling of the device and the withdrawal of the sources from the metallic plates. The activity values of the lightning rods sources, supplied by the manufacturers, vary from two to three orders of magnitude and therefore it is necessary to characterize these sources. This paper describes the methodology used to measure the actual activity of each Am-241 sources extracted from the radioactive lightning rods. The first step was to sample tens of Am-241 sources and carry out the activity measurements for further use in the system calibration. The equipment used in this first stage was a gamma spectrometer, previously calibrated with an Am-241 standard source, in agreement with the same arrangement and same geometry in the measures of the sources. Results show that there are sources with similar activity values of those supplied by the manufacturers, but there are also sources with no activity - or also activity very low compared with the expected value -, as well as sources contend other radionuclides. (author)
Effects of the herbicide glyphosate on the uptake of 239Pu and 241Am to vegetation
International Nuclear Information System (INIS)
Nisbet, A.F.; Shaw, S.
1990-01-01
Glyphosate (n-phosphonomethyl glycine) is a broad spectrum herbicide widely used in lowland agriculture, forestry and improved upland pastures. Although its metal chelating properties are well established, its interaction with radionuclides remains unknown. A pot experiment was conducted to determine the effect of soil applications of glyphosate on the uptake of 239 Pu and 241 Am to peas and carrots grown in loam, peat and sand soils. Soil-to-plant transfer factors were calculated for treated and untreated soils at harvest. The most marked effect was an increase in 241 Am uptake to crops grown in loam soil. Supplementary laboratory batch experiments were conducted by shaking radiolabelled soil and its associated soil solution with glyphosate. The activity concentration of 241 Am increased ten fold in the liquid phase of loam soils treated with glyphosate. It is postulated that this 241 Am desorption could have been mediated by the formation of a stable Am-glyphosate complex which was subsequently more available for crop uptake than Am alone. (author)
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan; FINAL
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses, and provide subsamples to the Process Chemistry Laboratory. The Process Chemistry Laboratory will prepare test plans and perform process tests to evaluate the behavior of the 241-AZ-102 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. Requirements for analyses of samples originating in the process tests will be documented in the corresponding test plan
Characterization of Direct Push Vadose Zone Sediments from the 241-U Single-Shell Tank Farm
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Valenta, Michelle M.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Iovin, Cristian; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-12-20
The overall goals of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., are 1) to define risks from past and future single-shell tank farm activities, 2) to identify and evaluate the efficacy of interim measures, and 3) to aid, via collection of geochemical information and data, the future decisions that must be made by the U.S. Department of Energy (DOE) regarding the near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas (WMAs). For a more complete discussion of the goals of the Tank Farm Vadose Zone Project, see the overall work plan, Phase 1 RCRA Facility Investigation/Corrective Measures Study Work Plan for the Single-Shell Tank Waste Management Areas (DOE 1999). Specific details on the rationale for activities performed at WMA U are found in Crumpler (2003). To meet these goals, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory (PNNL) to perform detailed analyses of vadose zone sediment collected within the U Single-Shell Tank Farm. Specifically, this report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from ten direct push characterization holes emplaced to investigate vadose zone contamination associated with potential leaks within the 241-U Single-Shell Tank Farm. Specific tanks targeted during this characterization campaign included tanks 241-U-104/241-U-105, 241-U-110, and 241-U-112. Additionally, this report compiles data from direct push samples collected north of tank 241-U-201, as well as sediment collected from the background borehole (C3393). After evaluating all the characterization and analytical data, there is no question that the vadose zone in the vicinity of tanks 241-U-104 and 241-U-105 has been contaminated by tank-related waste. This observation is not new, as gamma logging of drywells in the area has identified uranium contamination at the
Evaluation of neutron nuclear data for 241Am and 243Am
International Nuclear Information System (INIS)
Kikuchi, Yasuyuki
1982-08-01
Neutron nuclear data of 241 Am and 243 Am were evaluated for JENDL-2. Evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) and (n,4n) reaction cross sections, the resolved and unresolved resonance parameters, the angular or energy distribution of the emitted neutrons, and the average number of neutrons emitted per fission. The fission cross section was evaluated on the basis of newly measured data, and lower values than JENDL-1 were given in the subthreshold energy region. The reliability of the calculation parameters are also much improved, because experimental data became available for the total and capture cross sections of 241 Am in the high energy region. (author)
Energy Technology Data Exchange (ETDEWEB)
Shinohara, N.; Hatsukawa, Y.; Hata, K.; Kohno, N. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-03-01
The thermal neutron capture cross section {sigma}{sub 0} and Resonance integral I{sub 0} of {sup 241}Am leading to the production of {sup 242m}Am and {sup 242g}Am were measured by radiochemical method. The cross sections obtained in this study are {sigma}{sub 0}=60.9 {+-} 2.6 barn, I{sub 0}=213 {+-} 13 barn for {sup 241}Am(n,{gamma}){sup 242m}Am and {sigma}{sub 0}=736 {+-} 31 barn, I{sub 0}=1684 {+-} 92 barn for {sup 241}Am(n,{gamma}){sup 242g}Am. (author)
Biosorption of Am-241 and Cs-137 by radioactive liquid waste by coffee husk
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Rafael Vicente de Padua; Sakata, Solange Kazumi; Bellini, Maria Helena; Marumo, Julio Takehiro, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
Radioactive Waste Management Laboratory of Nuclear and Energy Research Institute, IPEN-CNEN/SP, has stored many types of radioactive liquid wastes, including liquid scintillators, mixed wastes from chemical analysis and spent decontamination solutions. These wastes need special attention, because the available treatment processes are often expensive and difficult to manage. Biosorption using biomass of vegetable using agricultural waste has become a very attractive technique because it involves the removal of heavy metals ions by low cost biossorbents. The aim of this study is to evaluate the potential of the coffee husk to remove Am-241 and Cs-137 from radioactive liquid waste. The coffee husk was tested in two forms, treated and untreated. The chemical treatment of the coffee husk was performed with HNO{sub 3} and NaOH diluted solutions. The results showed that the coffee husk did not showed significant differences in behavior and capacity for biosorption for Am-241 and Cs-137 over time. Coffee husk showed low biosorption capacity for Cs-137, removing only 7.2 {+-} 1.0% in 4 hours of contact time. For Am-241, the maximum biosorption was 57,5 {+-} 0.6% in 1 hours. These results suggest that coffee husk in untreated form can be used in the treatment of radioactive waste liquid containing Am-241. (author)
Inorganic, radioisotopic and organic analysis of 241-AP-101 tank waste
International Nuclear Information System (INIS)
SK Fiskum; PR Bredt; JA Campbell; LR Greenwood; OT Farmer; GJ Lumetta; GM Mong; RT Ratner; CZ Soderquist; RG Swoboda; MW Urie; JJ Wagner
2000-01-01
Battelle received five samples from Hanford waste tank 241-AP-101, taken at five different depths within the tank. No visible solids or organic layer were observed in the individual samples. Individual sample densities were measured, then the five samples were mixed together to provide a single composite. The composite was homogenized and representative sub-samples taken for inorganic, radioisotopic, and organic analysis. All analyses were performed on triplicate sub-samples of the composite material. The sample composite did not contain visible solids or an organic layer. A subsample held at 10 C for seven days formed no visible solids. The characterization of the 241-AP-101 composite samples included: (1) Inductively-coupled plasma spectrometry for Ag, Al, Ba, Bi, Ca, Cd, Cr, Cu, Fe, K, La, Mg, Mn, Na, Nd, Ni, P, Pb, Pd, Ru, Rh, Si, Sr, Ti, U, Zn, and Zr (Note: Although not specified in the test plan, As, B, Be, Co, Li, Mo, Sb, Se, Sn, Tl, V, W, and Y were also measured and reported for information only) (2) Radioisotopic analyses for total alpha and total beta activities, 3 H, 14 C, 60 Co, 79 Se, 90 Sr, 99 Tc as pertechnetate, 106 Ru/Rh, 125 Sb, 134 Cs, 137 Cs, 152 Eu, 154 Eu, 155 Eu, 238 Pu, 239+240 Pu, 241 Am, 242 Cm, and 243+244 Cm; (3) Inductively-coupled plasma mass spectrometry for 237 Np, 239 Pu, 240 Pu, 99 Tc, 126 Sn, 129 I, 231 Pa, 233 U, 234 U, 235 U, 236 U, 238 U, 241 AMU, 242 AMU, 243 AMU, As, B, Be, Ce, Co, Cs, Eu, I, Li, Mo, Pr, Rb, Sb, Se, Ta, Te, Th, Tl, V, and W; (4) total U by kinetic phosphorescence analysis; (5) Ion chromatography for Cl, F, NO 2 , NO 3 , PO 4 , SO 4 , acetate, formate, oxalate, and citrate; (6) Density, inorganic carbon and organic carbon by two different methods, mercury, free hydroxide, ammonia, and cyanide. The 241-AP-101 composite met all contract limits (molar ratio of analyte to sodium or ratio of becquerels of analyte to moles of sodium) defined in Specification 7 for Envelope A. Except for a few cases, the
Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms
International Nuclear Information System (INIS)
Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-01-01
Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes
Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms
Energy Technology Data Exchange (ETDEWEB)
Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.
2007-12-21
Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes
ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN
International Nuclear Information System (INIS)
DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ
2006-01-01
This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts
ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ
2006-12-13
This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts.
Tank 241-C-103 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103
2010-10-01
... OF UNITED STATES RAIL OPERATIONS § 241.13 Prohibition against track owner's requiring or permitting... for compliance with this section and subject to civil penalties under § 241.15. A common carrier by...
Acceptance/operational test procedure 241-AN-107 Video Camera System
International Nuclear Information System (INIS)
Pedersen, L.T.
1994-01-01
This procedure will document the satisfactory operation of the 241-AN-107 Video Camera System. The camera assembly, including camera mast, pan-and-tilt unit, camera, and lights, will be installed in Tank 241-AN-107 to monitor activities during the Caustic Addition Project. The camera focus, zoom, and iris remote controls will be functionally tested. The resolution and color rendition of the camera will be verified using standard reference charts. The pan-and-tilt unit will be tested for required ranges of motion, and the camera lights will be functionally tested. The master control station equipment, including the monitor, VCRs, printer, character generator, and video micrometer will be set up and performance tested in accordance with original equipment manufacturer's specifications. The accuracy of the video micrometer to measure objects in the range of 0.25 inches to 67 inches will be verified. The gas drying distribution system will be tested to ensure that a drying gas can be flowed over the camera and lens in the event that condensation forms on these components. This test will be performed by attaching the gas input connector, located in the upper junction box, to a pressurized gas supply and verifying that the check valve, located in the camera housing, opens to exhaust the compressed gas. The 241-AN-107 camera system will also be tested to assure acceptable resolution of the camera imaging components utilizing the camera system lights
Tank characterization report for single-shell tank 241-C-204
International Nuclear Information System (INIS)
Conner, J.M.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-C-204. This report supports the requirements of Tri Party Agreement Milestone M 44 09
Tank characterization report for single shell tank 241-SX-108
Energy Technology Data Exchange (ETDEWEB)
Eggers, R.F., Westinghouse Hanford
1996-07-11
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-SX-108. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.
Tank characterization report for single-shell tank 241-B-101
International Nuclear Information System (INIS)
Schreiber, R.D.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-B-101. This report supports the requirements of Tri-Party Agreement Milestone M-44-09
Tank characterization report for single-shell tank 241-T-108
International Nuclear Information System (INIS)
Baldwin, J.H.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-T-108. This report supports the requirements of Tri-Party Agreement Milestone M-44-09
Tank characterization report for single-shell tank 241-T-106
International Nuclear Information System (INIS)
Jo, J.
1996-03-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-T-106. This report supports the requirements of Tri-Party Agreement Milestone M-44-09
Tank characterization report for double-shell tank 241-SY-103
International Nuclear Information System (INIS)
Conner, J.M.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-SY-103. This report supports the requirements of Tri-Party Agreement Milestone M-44 09
Tank characterization report for double-shell tank 241-AP-105
International Nuclear Information System (INIS)
Hu, T.A.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-105. This report supports the requirements of the Tri-Party Agreement Milestone M 44-05
Tank characterization report for single-shell tank 241-B-107
International Nuclear Information System (INIS)
Conner, J.M.
1998-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-107. This report supports the requirements of the Tri-Party Agreement Milestone M-44-ISB
Tank characterization report for double-shell tank 241-SY-103
International Nuclear Information System (INIS)
Hansen, D.R.
1996-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-SY-103. This report supports the requirements of the Tri-Party Agreement Milestone M-44-09
Tank characterization report for double-shell tank 241-AW-102
International Nuclear Information System (INIS)
Bell, K.E.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05
Tank characterization report for double-shell tank 241-AW-102
Energy Technology Data Exchange (ETDEWEB)
Bell, K.E.
1997-05-29
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05.
Tank characterization report for single-shell tank 241-BX-111
International Nuclear Information System (INIS)
Anantatmula, R.P.
1998-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste, stored in Tank 241-BX-111. This report supports the requirements of the Tri-Party Agreement Milestone M-44-ISB
Tank characterization report for single-shell tank 241-B-108
International Nuclear Information System (INIS)
Schreiber, R.D.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-108. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05
Tank characterization report for single-shell tank 241-b-110
International Nuclear Information System (INIS)
Field, J.G.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-110. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05
Factors influencing the chemical extractability of 241Am from a contaminated soil
International Nuclear Information System (INIS)
Nishita, H.; Hamilton, M.
1976-01-01
Factors influencing the extractability of 241 Am from an artificially contaminated soil were investigated. This was done with an equilibrium batch technique using CH 3 COOH-NH 4 OH and HNO 3 -NaOH extracting systems. The influence of several soil components was determined indirectly by selectively removing them from the soil. The effect of water- and HCl-soluble salts and organic matter on 241 Am extractability was small. The most marked effect was due to the soil organic fraction that was not water- or HCl-soluble. This organic fraction was influential under both low and high pH conditions, but its influence was particularly marked under low pH conditions. The free iron-oxides had an appreciable effect under low pH conditions, but no observable effect in the high pH range. Though to a lesser extent, the free silica and alumina, amorphous alumino-silicate, and possibly residual organic matter also showed some influence. These results provide some implications on the conditions that influence the movement of 241 Am in soils and its availability to plants. A review of the literature on the behavior of Am in soils is included
Evaluation of neutron data for americium-241
Energy Technology Data Exchange (ETDEWEB)
Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)
1997-03-01
The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.
49 CFR 192.241 - Inspection and test of welds.
2010-10-01
... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.241 Inspection and test of welds. (a) Visual inspection of welding must be conducted by an individual qualified by appropriate training and experience to ensure that: (1) The welding is performed in accordance...
Mechanism of vertical migration of Am 241 in peaty-gley soil
International Nuclear Information System (INIS)
Kalinin, V.N.
2002-01-01
Nowadays soil in the Chernobyl zone has become a source from which radionuclides can come to other objects of biosphere. The vertical migration determines distribution of the radionuclides in the soil. For research of vertical migration of Am 241 in soil the distribution of the radionuclide in granulometric fractions of the soil particles was measured, humus was extracted from the soil with the help of a sodium pyrophosphate solution by the accelerated method of Kononova and Beltchikova. For an estimation of a share of a mobile form of radionuclide the soil was dissolved in ammonium acetate solution. The conclusion is made, that nowadays significant part of Am 241 is strongly fixed on a mineral matrix of the soil and migrates together with the soil particles
Integral test for Np237 and Am241 cross sections in JENDL, ENDF and JEF libraries
International Nuclear Information System (INIS)
Iwasaki, Tomohiko; Unesaki, Hironobu; Kitada, Takanori
2002-01-01
Experiments using Kyoto University critical assembly (KUCA) were performed for measuring the capture and fission reaction rates of 237 Np and 241 Am. A back-to-back fission chamber was employed for the measurement of the fission rate of 237 Np and 241 Am relative to 235 U. The capture rate of 237 Np relative to 197 Au was measured by using activation method. Eleven cores, of which the spectra were changed systematically, were mocked up for the present measurements. Five cores among the eleven were utilized for the fission reaction rate measurement. The experiment was analyzed using the Monte Carlo code MVP, the transport code TWOTRAN and the diffusion code CITATION using the libraries based on JENDL3.2, ENDF/B-VI and JEF2.2. As the results, for 237 Np, JENDL3.2 showed good agreement for both capture and fission. However, for the fission rate of 241 Am, JENDL3.2 underestimates 15-20%. On the other hand, ENDF/B-VI and JEF2.2 show different C/Es for 237 Np and 241 Am. (author)
Tank Characterization Report for Single-Shell Tank 241-U-103
International Nuclear Information System (INIS)
ADAMS, M.R.
2000-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-U-103. This report supports the requirements of the Tri-Party Agreement Milestone M-44-15B
Tank characterization report for single-shell tank 241-BY-109
International Nuclear Information System (INIS)
Jo, J.
1998-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-BY-109. This report supports the requirements of the Tri-Party Agreement Milestone M-44-15B
Tank characterization report for single-shell tank 241-T-102
International Nuclear Information System (INIS)
Baldwin, J.H.
1997-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-T-102. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-T-102 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendixes. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. The most recent core sampling of tank 241-T-102 (March 1993) predated the existence of data quality objectives (DQOs). An assessment of the technical issues from the currently applicable DQOs was made using data from the 1993 push mode core sampling event, a July 1994 grab sampling event, and a May 1996 vapor flammability measurement. Historical information for tank 241-T-102, provided in Appendix A, includes surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge model. Appendix B contains further sampling and analysis data from the March 1993 push mode core sampling event and data from the grab sampling event in August 1994 and May 1996 vapor flammability measurement. Of the two push mode cores taken in March of 1993, cores 55
Tank characterization report for single-shell tank 241-T-102
Energy Technology Data Exchange (ETDEWEB)
Baldwin, J.H.
1997-06-24
A major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-T-102. The objectives of this report are to use characterization data in response to technical issues associated with tank 241-T-102 waste; and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendixes. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. The most recent core sampling of tank 241-T-102 (March 1993) predated the existence of data quality objectives (DQOs). An assessment of the technical issues from the currently applicable DQOs was made using data from the 1993 push mode core sampling event, a July 1994 grab sampling event, and a May 1996 vapor flammability measurement. Historical information for tank 241-T-102, provided in Appendix A, includes surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge model. Appendix B contains further sampling and analysis data from the March 1993 push mode core sampling event and data from the grab sampling event in August 1994 and May 1996 vapor flammability measurement. Of the two push mode cores taken in March of 1993, cores 55
Biosorption of Am-241 and Cs-137 by radioactive liquid waste by coffee husk
International Nuclear Information System (INIS)
Ferreira, Rafael Vicente de Padua; Sakata, Solange Kazumi; Bellini, Maria Helena; Marumo, Julio Takehiro
2011-01-01
Radioactive Waste Management Laboratory of Nuclear and Energy Research Institute, IPEN-CNEN/SP, has stored many types of radioactive liquid wastes, including liquid scintillators, mixed wastes from chemical analysis and spent decontamination solutions. These wastes need special attention, because the available treatment processes are often expensive and difficult to manage. Biosorption using biomass of vegetable using agricultural waste has become a very attractive technique because it involves the removal of heavy metals ions by low cost biossorbents. The aim of this study is to evaluate the potential of the coffee husk to remove Am-241 and Cs-137 from radioactive liquid waste. The coffee husk was tested in two forms, treated and untreated. The chemical treatment of the coffee husk was performed with HNO 3 and NaOH diluted solutions. The results showed that the coffee husk did not showed significant differences in behavior and capacity for biosorption for Am-241 and Cs-137 over time. Coffee husk showed low biosorption capacity for Cs-137, removing only 7.2 ± 1.0% in 4 hours of contact time. For Am-241, the maximum biosorption was 57,5 ± 0.6% in 1 hours. These results suggest that coffee husk in untreated form can be used in the treatment of radioactive waste liquid containing Am-241. (author)
Metabolism of americium-241 in dairy animals
International Nuclear Information System (INIS)
Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.
1978-01-01
Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hour collection period, and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by cows and goats was estimated to be 0.014 and 0.016% of the oral dose, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 , respectively, for cows and 5.6 x 10 -4 and 1.2 x 10 -3 , respectively, for goats. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2%, respectively, for cows, and 2, 4, and 2%, respectively, for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hours after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by liver and kidney. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows
International Nuclear Information System (INIS)
Jagasia, Poonam; Dhami, P.S.; Tripathi, S.C.; Gandhi, P.M.
2015-01-01
Closing the fuel cycle is an inevitable option for sustained growth and is hallmark of Indian Atomic Energy Programme. Analysis of fissile component especially plutonium is very important for almost all the process streams at the back end of the fuel cycle. Among the various Isotopes of plutonium, 241 Pu is β emitter and decays to 241 Am (T 1/2 of ∼432 y) which is an α emitter and having γ energy of ∼60 keV. Its specific activity is about 56 times higher than that Pu. Therefore, Pu stream is always associated with 241 Am and its activity increases with time needing its separation prior to radiometric assay. Among the various separation techniques, solvent extraction method employing thenoytrifluoroacetone (TTA) is commonly employed for its selective separation under particular experimental conditions. In an alternate approach, 2-ethyl hexyl 2-ethyl hexyl phosphonic acid (KSM-17) based extraction paper chromatography (EPC) was attempted for separation of 241 Am from plutonium prior to radiometry. Pu 4+ forms strong complex with KSM-17 and is held at the point of application whereas 241 Am migrates towards the solvent front under the experimental conditions. During migration clear separation is observed in ∼15 minutes using 0.5 M HNO 3 as developing reagent. After separation is achieved, 1 cm 2 spot area containing Pu is desorbed in 1 mL xylene phase and used for radiometric counting
Medical observation and evaluation of persons accidentally exposed to 241Am-Be neutron source
International Nuclear Information System (INIS)
Li Jinbang; Bai Yushu; Zhang Jiayu
1986-01-01
A radiation accident caused by an 241 Am-Be source is reported. A boy, 17 years old, brought an 241 Am-Be source of 120 mCi to home and drilled a hole in it. In all 10 persons were irradiated with varying doses and were contaminated to different extent. The maximum dose of external exposure was 121 x 10 -3 Gy and the maximum concentration of urinary 241 Am was 2.8 dpm. The exposed persons felt dizziness, palpitation and myalgia at the early stage. At that time there were slight increase in leucocyte counts, presence of heterogeneous lymphocytes and increase in frequency of leucocyte spinous process. Follow-up study for one and a half years on general health condition, hematological changes, immune function (T-and B-lymphocytes) and crystalline lens alterations revealed no significant differences between the irradiated and the non-irradiated persons, but the frequencies of all types of chromosome aberrations in the irradiated group were significantly higher than those in the control group
Effect of 241Am on bone structure according to its microdistribution
International Nuclear Information System (INIS)
Polig, E.
1976-01-01
Female rats, eight weeks old, were injected intravenously with monomeric 241 Am(III)-citrate (30 μCi/kg) and sacrificed after 7,28 and 56 days. Half of the animals received once weekly an intraperitoneal injection of Ca-DTPA (30 μmol/kg), the first dose being administered 1.5 h after 241 Am. From the distal end of the femurs, 20-μm-thick longitudinal and sagittal sections were prepared. Both dose-rate distributions and morphometric parameters were determined by an electronic image analyser by scanning cellulose nitrate α detectors or microradiographs. Initially after injection, 241 Am is heavily deposited on the epiphyseal and metaphyseal sides of the cartilage plate as well as near the articular cartilage, whereas the labelling of the periosteal and endosteal surfaces in cortical bone and of all trabecular surfaces is less pronounced. Seven days after injection the maximum dose rate in the metaphyseal band amounts to approximately 120 rad/d and increases to 170 rad/d at 56 days. Deformations of the trabecular structure are presented quantitatively as deviations in the frequency function of chord lengths over trabeculae or marrow spaces. The endosteal surface area is lower in 241 Am animals than in controls and the complexity of the bone structure is reduced. In control animals the surface/volume ratio varies between 36mm -1 and 64mm -1 . The mean trabecular width ranges between 40 μm and 100 μm and the mean width of the marrow spaces range between 90 μm and 210 μm. As a result of the locally high activity, the mechanism of bone resorption is strongly impaired in the metaphysis, manifesting as annormal trabeculation. There is no pronounced diminution of DTPA efficacy over the period of observation. Ca-DTPA treatment lowers the dose rates in the metaphysis and as a consequence the inhibition of bone resorption seems to be partially suspended. (author)
241-AN-A valve pit manifold valves and position indication acceptance test procedure
Energy Technology Data Exchange (ETDEWEB)
VANDYKE, D.W.
1999-08-25
This document describes the method used to test design criteria for gear actuated ball valves installed in 241-AN-A Valve Pit located at 200E Tank Farms. The purpose of this procedure is to demonstrate the following: Equipment is properly installed, labeled, and documented on As-Built drawings; New Manifold Valves in the 241-AN-A Valve Pit are fully operable using the handwheel of the valve operators; New valve position indicators on the valve operators will show correct valve positions; New valve position switches will function properly; and New valve locking devices function properly.
Analysis of potential hazards associated with 241Am loaded resins from nitrate media
International Nuclear Information System (INIS)
Schulte, Louis D.; Rubin, Jim; Fife, Keith William; Ricketts, Thomas Edgar; Tappan, Bryce C.; Chavez, David E.
2016-01-01
LANL has been contacted to provide possible assistance in safe disposition of a number of 241 Am-bearing materials associated with local industrial operations. Among the materials are ion exchange resins which have been in contact with 241 Am and nitric acid, and which might have potential for exothermic reaction. The purpose of this paper is to analyze and define the resin forms and quantities to the extent possible from available data to allow better bounding of the potential reactivity hazard of the resin materials. An additional purpose is to recommend handling procedures to minimize the probability of an uncontrolled exothermic reaction.
Contributions to the preparation of 241americium metal and a few 241americium silicides
International Nuclear Information System (INIS)
Wittmann, F.D.
1980-01-01
In order to take a closer look at the americium-silicon system, three further silicides of americium: Am 5 Si 3 , Am 2 Si 3 and AmSi 2 were prepared in addition to the already known americium monosilicide and starting from the knowledge gained from the latters preparation. Radiographic investigations were carried out into the temperature region of 900 0 C. They showed no change of structure in the three compounds. It was possible to prepare residue-free americium metal by reducing AmF 3 with Si, whereby the SiF 4 formed can be easily separated off as volatile compound, and the Am metal is brought into a very pure form by sublimation suitable for spectrochemical investigations. Attempts to prepare binary germanides and gallides of 241 americium were unsuccessful. (RB) [de
International Nuclear Information System (INIS)
Bhati, Sharda
2009-01-01
To simulate photon transport in the thorax region of the MIRD phantom for a given uniform source distribution of 241 Am in the lungs of the phantom and to compute the pulse height response of a 20 cm dia phoswich detector located right above the lungs on the thorax surface. The total peak counts in the simulated pulse height spectrum of 241 Am can be used to compute the calibration factors of the phoswich for estimation of the lung burdens of 241 Am
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan
International Nuclear Information System (INIS)
TEMPLETON, A.M.
1999-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102
Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan
International Nuclear Information System (INIS)
RASMUSSEN, J.H.
2000-01-01
This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102
Test plan for tank 241-C-104 retrieval testing
International Nuclear Information System (INIS)
HERTING, D.L.
1999-01-01
Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document
Justification for Continued Operation for Tank 241-Z-361
Energy Technology Data Exchange (ETDEWEB)
BOGEN, D.M.
1999-09-01
This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford.
Test Plan for Tank 241-C-104 Retrieval Testing
International Nuclear Information System (INIS)
HERTING, D.L.
1999-01-01
Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document
Justification for Continued Operation for Tank 241-Z-361
International Nuclear Information System (INIS)
BOGEN, D.M.
1999-01-01
This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford
Isolating 241Am from waste solutions containing Al, Ca, Fe, and Cr
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; King, C.M.
1982-01-01
About 2.4 kg of 241 Am contaminated with calcium and aluminum had been recovered from low-activity waste during recycle of 11% 240 Pu. A process was developed and demonstrated to purify the americium before shipment as 241 AmO 2 . The americium and some of the calcium were batch extracted into 50% TBP-n-paraffin from 2.2M Al(NO 3 ) 3 - 0.3M HNO 3 solution in a canyon tank. Pregnant solvent was scrubbed first with 2.1M Al 3+ -0.3M Li + -6.7M NO 3 - and then with 7M LiNO 3 to reduce the calcium content and to displace the aluminum. Americium was then stripped from the solvent with water and concentrated by evaporation. Before precipitating the americium with oxalic acid, the nitric acid was adjusted with NH 4 OH to yield a 1M NH 4 NO 3 solution. Recovery across the batch extraction step was 97.8%, while 93% of the calcium and >99% of the aluminum was rejected. Recovery across precipitation averaged >96% while producing a product which was >99.3% pure 241 AmO 2 . The major impurities were water, carbon, calcium, iron, and zinc
Critical mass calculations for 241Am, 242mAm and 243Am
International Nuclear Information System (INIS)
Dias, Hemanth; Tancock, Nigel; Clayton, Angela
2003-01-01
Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)
Tank 241-U-105 push mode core sampling and analysis plan
International Nuclear Information System (INIS)
Bell, K.E.
1995-01-01
This Sampling and Analysis Plan (SAP) will identify characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples and two push mode core samples from tank 241-U-105 (U-105)
Solid Phase Characterization of Tank 241-C-105 Grab Samples
International Nuclear Information System (INIS)
Ely, T. M.; LaMothe, M. E.; Lachut, J. S.
2016-01-01
The solid phase characterization (SPC) of three grab samples from single-shell Tank 241-C-105 (C-105) that were received at the laboratory the week of October 26, 2015, has been completed. The three samples were received and broken down in the 11A hot cells.
Tank characterization report for single-shell tank 241-C-109
Energy Technology Data Exchange (ETDEWEB)
Simpson, B.C.
1997-05-23
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices.
Tank characterization report for single-shell tank 241-C-109
International Nuclear Information System (INIS)
Simpson, B.C.
1997-01-01
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices
Tank characterization report for single-shell tank 241-U-106
International Nuclear Information System (INIS)
Brown, T.M.
1997-01-01
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-U-106. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-U-106 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 of this report summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations regarding safety status and additional sampling. The appendixes contain supporting data and information. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ikology et al. 1996), Milestone M-44-10
Tank characterization report for single-shell tank 241-U-106
Energy Technology Data Exchange (ETDEWEB)
Brown, T.M.
1997-04-15
One major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-U-106. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-U-106 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 of this report summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations regarding safety status and additional sampling. The appendixes contain supporting data and information. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ikology et al. 1996), Milestone M-44-10.
Operational experience in mitigating flammable gas releases from Hanford Site Tank 241-SY-101
International Nuclear Information System (INIS)
Lentsch, J.W.; Babad, H.; Kirch, N.W.
1995-01-01
Flammable gases consisting of hydrogen, nitrous oxide, ammonia, and methane are periodically released from Hanford Site waste tank 241-SY-101 at concentrations above the flammable limit. A large mixer pump installed in the tank in 1993 has effectively mitigated this problem by continuously releasing small amounts of the flammable gases at the rate they are generated. Tank 241-SY-101 is also equipped with multiple high-sensitivity gas monitoring systems and level detection systems to measure the quantity of gas that is retained in and released from the waste
Metabolism of americium-241 in dairy animals
International Nuclear Information System (INIS)
Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.
1978-10-01
Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hr collection period and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by both cows and goats was estimated to be 0.014% of the respective oral doses. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 respectively for cows and 4.4 x 10 -3 and 1.2 x 10 -3 respectively for goats. The relatively high americium concentrations noted in caprine milk following the oral doses are discussed. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2% respectively for cows and 2, 4, and 2% respectively for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hrs after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by the liver. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows
Decorporation of 241Am and 252Cf by Ca-DTPA from rat, Syrian and Chinese hamster
International Nuclear Information System (INIS)
Seidel, A.
1977-01-01
Retention and mobilization by Ca-DTPA of 241 Am and 252 Cf from rats, Syrian and Chinese hamsters are compared. Previous observations of a much longer residence time of actinides in hamsters liver than in rat liver are confirmed. Identical dose-effect functions were obtained for skeleton of rats and Syrian hamsters whereas 252 Cf removal from Chinese hamster skeleton was lower. The mobilization of 241 Am was lower than that of 252 Cf. With regard to species differences, qualitatively similar results were obtained for 241 Am as for 252 Cf. The results will be discussed with regard to the reduction by DTPA treatment of radiation risk in animal species with different biological half times of actinides in their livers. In this connection, attention will be paid to the usefulness of long-term DTPA treatment
Ferrocyanide Safety Program: Data interpretation report for tank 241-T-107 core samples
International Nuclear Information System (INIS)
Sasaki, L.M.; Valenzuela, B.D.
1994-08-01
Between November 1992 and March 1993, three core samples were obtained from tank 241-T-107. Analyses were performed on these core samples to support the Ferrocyanide Safety Program and the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1994) Milestone M-10-00. This document summarizes and evaluates those analytical results that are pertinent to the Ferrocyanide Safety Issue. This document compares the analytical results with the data requirements for ferrocyanide tanks as documented in Data Requirements of the Ferrocyanide Safety Issue Developed Through the Data Quality Objectives Process (Meacham et al. 1994) and provides an assessment of the safety condition of the tank. Analytes not listed in the Data Quality Objectives (DQO) document (Meacham et al. 1994) or not pertinent to the Ferrocyanide Safety Issue are not discussed in this report. Complete documentation of the analytical results can be found in the data package for the tank 241-T-107 cores (Svancara and Pool 1993). A more complete evaluation of the analytical results and an estimate of the tank inventory will be provided in a forthcoming tank characterization report for tank 241-T-107
Tank characterization report for single-shell tank 241-A-101
International Nuclear Information System (INIS)
Field, J.M.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-A-101. This tank has been listed on the Hydrogen Watch List. This report supports the requirements of the Tri-Party Agreement Milestone M-44-10
Sentinel node biopsy for melanoma: a study of 241 patients
DEFF Research Database (Denmark)
Chakera, Annette Hougaard; Drzewiecki, Krzysztof Tadeusz; Jakobsen, Annika Loft
2004-01-01
The aim of this study was to evaluate the sentinel node biopsy (SNB) technique for melanoma using both radiocolloid and blue dye in 241 clinically N0 patients with melanomas >1.0 mm, or thinner lesions exhibiting regression/ulceration. We showed that an increase in injected radioactivity increased...
Tank characterization report for single-shell tank 241-BY-112
International Nuclear Information System (INIS)
Baldwin, J.H.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-BY-112. This report supports the requirements of the Tri-Party Agreement Milestone M-44-10. (This tank has been designated a Ferrocyanide Watch List tank.)
International Nuclear Information System (INIS)
Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong
2016-01-01
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
Energy Technology Data Exchange (ETDEWEB)
Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)
2016-01-11
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
International Nuclear Information System (INIS)
Taya, A.; Carmack, D.B.; Muggenburg, B.A.; Mewhinney, J.A.
1992-01-01
Experiments were conducted to study the phagocytosis and dissolution of 241 AmO 2 particles by rat, dog and monkey alveolar macrophages (PAM) in vitro. The phagocytosis and dissolution of 241 AmO 2 particles were followed up to 20 and 72 h, respectively. Dog and monkey PAM took up 241 AmO 2 particles at similar rates, whereas rat PAM phagocytosed only 60% of the amount phagocytosed by dog and monkey PAM at 20h. The PAM of the three species dissolved 241 AmO 2 particles at similar rates; 8-10% was dissolved by 72h. The results of the 241 AmO 2 uptake in vitro may reflect in vivo situations, where the differences in uptake seen in vitro would probably diminish at later times after exposure. The dissolution results imply that the dissolution of 241 AmO 2 particles by alveolar macrophages of the three species might be species-independent. (author)
International Nuclear Information System (INIS)
Huevel, R. Van Den; Vander Plaetse, F.; Leppens, H.; Schoeters, G.
1992-01-01
Pregnant BALB/c mice and age and sex matched nulliparous controls were contaminated with 241 Am (13 kBq per mouse). Five days after the termination of contamination, 241 Am incorporation was measured in the tissues of adults and in the liver an the femur of newborn and one-month-old mice. Pregnancy resulted in higher 241 Am concentrations in bone but lower concentrations in the liver of the mothers. Protracted administration of 241 Am compared to a single injection resulted in a lower concentration of 241 Am in the livers of pregnant mice, their nulliparous controls and from newborn mice. The higher 241 Am concentration in the femur at birth after protected exposure before 14 days of gestation compared to protracted exposure after 14 days of gestation could reflect the increased placental transfer of 241 Am with advancing gestational age. Radiation doses to the femur were estimated between 4 and 20 mGy. Haemopoietic changes were noticed at these dose levels in all groups until at least 6 months after birth. (author)
Tank 241-A-104 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-A-104. This Tank Characterization Plan will identify characterization objectives pertaining to sample collection, hot cell sample isolation, and laboratory analytical evaluation and reporting requirements in addition to reporting the current contents and status of the tank as projected from historical information
Granulometric data 241-TY Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 200 sediment samples collected during the drilling of wells in the 241-TY Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 200 sediment samples are documented in this paper
Granulometric data 241-S Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 580 sediment samples collected during the drilling of wells in the 241-S Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment glass of each of the 580 sediment samples are documented in this report
Granulometric data 241-C Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 500 sediment samples collected during the drilling of wells in the 241-C Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 500 sediment samples are documented in this report
Granulometric data 241-T Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 850 sediment samples collected during the drilling of wells in the 241-T Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 850 sediment samples are documented in this report
Granulometric data 241-B Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 400 sediment samples collected during the drilling of wells in the 241-B Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 400 sediment samples are documented in this report
Granulometric data 241-T Tank Farm monitoring well sediments
International Nuclear Information System (INIS)
Fecht, K.R.; Price, W.H.
1977-12-01
Approximately 650 sediment samples collected during the drilling of wells in the 241-BY Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 650 sediment samples are documented in this report
Project W-320, 241-C-106 sluicing supporting documentation bibliography
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
This supporting document has been prepared to make the listing of documentation used to develop, or in support of Project W-320, readily retrievable. All documents are sorted by document number and list the document type. Tank 241-C-106 has been included on the High Heat Load Watch List
Vapor and gas sampling of single-shell tank 241-B-102 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (the team) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-B-102. This document presents sampling data resulting from the April 18, 1996 sampling of SST 241-B-102. Analytical results will be presented in a separate report issued by Pacific Northwest National Laboratory (PNNL), which supplied and analyzed the sampling media. The team, consisting of Sampling and Mobile Laboratories (SML) and Special Analytical Studies (SAS) personnel, used the vapor sampling system (VSS) to collect representative samples of the air, gases, and vapors from the headspace of SST 241-B-102 with sorbent traps and SUMMA canisters
Neutron and gamma-ray spectra of {sup 239}PuBe and {sup 241}AmBe
Energy Technology Data Exchange (ETDEWEB)
Vega-Carrillo, H.R. E-mail: rvega@cantera.reduaz.mx; Manzanares-Acuna, Eduardo; Becerra-Ferreiro, A.M.; Carrillo-Nunez, Aureliano
2002-08-01
Neutron and gamma-ray spectra of {sup 239}PuBe and {sup 241}AmBe were measured and their dosimetric features were calculated. Neutron spectra were measured using a multisphere neutron spectrometer with a {sup 6}LiI(Eu) scintillator. The {sup 239}PuBe neutron spectrum was measured in an open environment, while the {sup 241}AmBe neutron spectrum was measured in a closed environment. Gamma-ray spectra were measured using a NaI(Tl) scintillator using the same experimental conditions for both sources. The effect of measuring conditions for the {sup 241}AmBe neutron spectrum indicates the presence of epithermal and thermal neutrons. The low-resolution neutron spectra obtained with the multisphere spectrometer allows one to calculate the dosimetric features of neutron sources. At 100 cm both sources produce approximately the same count rate as that of the 4.4 MeV gamma-ray per unit of alpha emitter activity.
Sampling and Analysis Plan for Tank 241-AP-108 Waste in Support of Evaporator Campaign 2000-1
International Nuclear Information System (INIS)
RASMUSSEN, J.H.
2000-01-01
This Tank Sampling and Analysis Plan (TSAP) identifies sample collection, laboratory analysis, quality assurance/quality control (QA/QC), and reporting objectives for the characterization of tank 241-AP-108 waste. Technical bases for these objectives are specified in the 242-A Evaporator Data Quality Objectives (Bowman 2000 and Von Bargen 1998) and 108-AP Tank Sampling Requirements in Support of Evaporator Campaign 2000-1 (Le 2000). Evaporator campaign 2000-1 will process waste from tank 241-AP-108 in addition to that from tank 241-AP-107. Characterization results will be used to support the evaporator campaign currently planned for early fiscal year 2000. No other needs (or issues) requiring data for this tank waste apply to this sampling event
The influence of 241-Am and DTPA on morphometric parameters of the rat femur
International Nuclear Information System (INIS)
Polig, E.
1976-01-01
Microradiographically detectable alterations of the bone structure in the femur of young rats induced by monomeric 241-Am(III) (i.v., 30 μCi/kg) were studied. The morphometric and dosimetric measurements were carried out by means of an electronic image analyzer. 8 weeks after injection of 241-Am a characteristic alteration of the frequency distribution of the chord lengths over the trabeculae in the epiphysis and over the metaphyseal marrow spaces was found. The structure of the spongiosa is irregular with both large, coarse and small fragmented trabeculae. The complexity of the bone architecture and the area of the endosteal surfaces is reduced. The surface/volume ratio in control animals varies between 36 mm -1 in the epiphysis and 64 mm -1 in the region of the epiphyseal cartilage plate. From the specific surface burden (pCi/mm 2 ) the average dose rates were determined. There is no significant difference between the calcified tissue fraction in controls and animals with 241-Am, with the exception of the metaphyseal band where the locally high dose rates cause a devitalization of the tissue with inhibition of bone resorption as well as an abnormal trabeculation in the metaphysis. Treatment by Ca-DTPA reduces the 241-Am deposition nonuniformly and the pathological manifestations are markedly less pronounced. The mean trabecular width is about 100 μm in the epiphysis and has a minimum of 40 μm in the central part of the epiphyseal plate. The mean chord length over the marrow spaces varies between 90 and 210 μm. (orig.) [de
Americium-241 and -243 as an ion-engine propellant
International Nuclear Information System (INIS)
Schachter, M.M.
1994-01-01
Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years
Plutonium-239 and americium-241 uptake by plants from soil. Final report
International Nuclear Information System (INIS)
Brown, K.W.
1979-03-01
Alfalfa was grown in soil contaminated with plutonium-239 dioxide (239PuO2) at a concentration of 29.7 nanocuries per gram (nCi/g). In addition to alfalfa, radishes, wheat, rye, and tomatoes were grown in soils contaminated with americium-241 nitrate (241Am(NO3)3) at a concentration of 189 nCi/g. The length of exposure varied from 52 days for the radishes to 237 days for the alfalfa. The magnitude of plutonium incorporation by the alfalfa as indicated by the concentration ratio, 0.0000025, was similar to previously reported data using other chemical forms of plutonium. The results did indicate, however, that differences in the biological availability of plutonium isotopes do exist. All of the species exposed to americium-241 assimilated and translocated this radioisotope to the stem, leaf, and fruiting structures. The magnitude of incorporation as signified by the concentration ratios varied from 0.00001 for the wheat grass to 0.0152 for the radishes. An increase in the uptake of americium also occurred as a function of time for four of the five plant species. Evidence indicates that the predominant factor in plutonium and americium uptake by plants may involve the chelation of these elements in soils by the action of compounds such as citric acid and/or other similar chelating agents released from plant roots
Examination report: Remote video examination of air slots under the primary tank at 241-AN-107
International Nuclear Information System (INIS)
Pedersen, L.T.
1998-01-01
This report documents the results of remote video examination of air slots in the insulating concrete slab beneath the primary tank at 241-AN-107. Life Extension Equipment Engineering has selected tank 241-AN-107 for ultrasonic evaluation of tank wall, knuckle, and floor plates. Access to the primary tank floor plates is via the air slots which were formed into the insulating concrete slab during tank construction (reference drawings H-2-71105 and H-2-71160). Prior to deployment of the ultrasonic inspection equipment it is desirable to examine the air slots for obstructions and debris which could impede the ultrasonic equipment. The criteria, equipment description, deliverables, and responsibilities for examination of the air slots are described in HNF-1949, Rev. 0, ''Engineering Task Plan for Remote Video Examination of Air Slots Under the Primary Tank at 241-AN-107''
Tank 241-AZ-101 steam bumping and settling Process Test report
International Nuclear Information System (INIS)
Winkler, C.M.
1995-01-01
This report summarizes the process test in which the airlift circulators in Tank 241-AZ-101 were shutdown. The test was successful, in that no extreme temperature excursions occurred. Only general data was obtianed through the use of a gamma energy probe
Project W-320, 241-C-106 sluicing piping calculations, Volume 7
International Nuclear Information System (INIS)
Bailey, J.W.
1998-01-01
The object of this report is to calculate the hydraulic forces imposed at the sluicer nozzle. This is required by Project W-320 waste retrieval for tank 241-C-106. The method of analysis used is Bernoulli's momentum equation for stead flow
24 CFR 241.825 - Pro rata refund of insurance premium.
2010-04-01
... Projects Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.825 Pro rata refund of insurance premium... of the current annual loan insurance premium theretofore paid which is applicable to the portion of... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata refund of insurance...
Systems engineering study: tank 241-C-103 organic skimming,storage, treatment and disposal options
Energy Technology Data Exchange (ETDEWEB)
Klem, M.J.
1996-10-23
This report evaluates alternatives for pumping, storing, treating and disposing of the separable phase organic layer in Hanford Site Tank 241-C-103. The report provides safety and technology based preferences and recommendations. Two major options and several varations of these options were identified. The major options were: 1) transfer both the organic and pumpable aqueous layers to a double-shell tank as part of interim stabilization using existing salt well pumping equipment or 2) skim the organic to an above ground before interim stabilization of Tank 241-C-103. Other options to remove the organic were considered but rejected following preliminary evaluation.
Tank 241-U-106, cores 147 and 148, analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Steen, F.H.
1996-09-27
This document is the final report deliverable for tank 241-U-106 push mode core segments collected between May 8, 1996 and May 10, 1996 and received by the 222-S Laboratory between May 14, 1996 and May 16, 1996. The segments were subsampled and analyzed in accordance with the Tank 241-U-106 Push Mode Core Sampling and analysis Plan (TSAP), the Historical Model Evaluation Data Requirements (Historical DQO), Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) and the Safety Screening Data Quality Objective (DQO). The analytical results are included in Table 1.
Historical trends in tank 241-SY-101 waste temperatures and levels
International Nuclear Information System (INIS)
Antoniak, Z.I.
1993-09-01
The gas release and fluctuating level of the waste in tank 241-SY-101 have prompted more detailed interest in its historical behavior, in hopes of achieving a better understanding of its current status. To examine the historical behavior, essentially all of the tank waste temperature and level data record has been retrieved, examined, and plotted in various ways. To aid in interpreting the data, the depth of the non-convective waste layer was estimated by using a least-squares Chebyshev approximation to the temperatures. This report documents the retrieval critical examination, and graphic presentation of 241-SY-101 temperature and waste level histories. The graphic presentations clearly indicate a tank cooling trend that has become precipitous since late 1991. The plots also clearly show the decreasing frequency of waste gas release events, increasing height of the non-convective layer, and larger level drops per event
Tank characterization report for single-shell tank 241-C-110. Revision 1
International Nuclear Information System (INIS)
Benar, C.J.
1997-01-01
One of the major functions of the Tank Waste Remediation System (IWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-C-110. The objectives of this report are to use characterization data in response to technical issues associated with 241-C-110 waste and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. While only the results from recent sample events will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-C-110 are provided included surveillance information, records pertaining to waste transfers and tank operations, and 1124 expected tank contents derived from a process knowledge model. The sampling events are listed, as well as sample data obtained before 1989. The results of the 1992 sampling events are also reported in the data package. The statistical analysis and numerical manipulation of data used in issue resolution are reported in Appendix C. Appendix D contains the evaluation to establish the best basis for the inventory estimate and the statistical analysis performed for this evaluation. A bibliography that resulted from an in-depth literature search of all known information sources applicable to tank 241-C-110 and its respective waste types is contained in Appendix E
Rotary mode core sampling approved checklist: 241-TX-113
International Nuclear Information System (INIS)
Fowler, K.D.
1998-01-01
The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-113 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment
Rotary mode core sampling approved checklist: 241-TX-116
International Nuclear Information System (INIS)
FOWLER, K.D.
1999-01-01
The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-116 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment
Activity determination of the Am-241 radioactive lightning rods
International Nuclear Information System (INIS)
Dellamano, Jose C.; Minematsu, Denise; Potiens Jr, Ademar J.
2008-01-01
Full text: The radioactive lightning rods had been manufactured in Brazil up to 1989, when the Comissao Nacional de Energia Nuclear (CNEN) lifted the license for manufacture, commerce and installation of these devices. Since this date, the radioactive lightning rods have been replaced for conventional protection systems against electric discharges and have been sent to the institutes subordinated to the CNEN, amongst them the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP). The radioactive lightning rods are constituted in its majority for a central metallic rod where the plates are mounted. Am-241 radioactive sources are fixed in these plates. The treatment of these devices is made in a glove box, where mechanically the sources are separate of the plates and connecting rods, placed in a metallic package and stored for posterior characterization, final packaging, intermediate storage and final disposal. In accordance with manufacturers information had been installed in Brazil, approximately 75,000 units with activities varying between 25 and 92 MBq. Preliminary studies were carried out in some of the 16,000 lightning rods received by the Laboratorio de Rejeitos Radioativos (LRR) of the IPEN-CNEN/SP, and demonstrated that the variation of the values of activity is very bigger. The implantation of a methodology for the radioisotope characterization of the Am-241 removed sources of the radioactive lightning rods is important because the isotope inventory is necessary for the certification of the processes considered for packaging and storage, besides being indispensable data for the final disposal. It is convenient mentioning that one is not about the determination of activity of a radioactive source with geometry and defined characteristics, but the implantation of a measure protocol for groups of sources that will be used in the routine tasks of the LRR. The current work presents the methodology developed for the radioisotope characterization of the Am
Recovery of 241Am/Be neutron sources, Wooster, Ohio
International Nuclear Information System (INIS)
Tompkins, J.A.; Wannigman, D.; Hatler, V.
1998-07-01
In August 1997, the Nuclear Regulatory Commission (NRC) submitted to the US Department of Energy (DOE) a partial list of licensed radioactive sealed sources to be recovered under a pilot project initiating Radioactive Source Recovery Program (RSRP) operations. The first of the pilot project recoveries was scheduled for September 1997 at Eastern Well Surveys in Wooster, Ohio, a company with five unwanted sealed sources on the NRC list. The sources were neutron emitters, each containing 241 Am/Be with activities ranging from 2.49 to 3.0 Ci. A prior radiological survey had established that one of these sources, a Gulf Nuclear Model 71-1 containing 3 Ci of 241 Am, was contaminated with 241 Am and might be leaking. The other four sources were obsolete and could no longer be used by Eastern Well Surveys for their intended application in well-logging applications due to NRC decertification of these sources. All of the sources exceeded the limits established for Class C waste under 10 CFR 61.55 and, as a result, are the ultimate responsibility of the DOE under the provisions of PL 99-240. This report describes the cooperative effort between the DOE and NRC to recover the sources and transport them to Los Alamos National Laboratory (LANL) for deactivation under the RSRP. This operation alleviated any potential risk to the public health and safety from the site which might result from the leaking neutron sources or the potential mismanagement of unwanted sources. The on-site recovery occurred on September 23, 1997, and was performed by personnel from LANL and its contractor and was observed by staff from the Region III office of the NRC. All aspects of the recovery were successfully accomplished, and the sources were received at LANL on September 29, 1997. Experience gained during this operation will be used to formulate operational poilicies and procedures which will contribute to the eventual routine recovery operations of a full-scale RSRP
Energy Technology Data Exchange (ETDEWEB)
Froning, M.; Hill, P. [Forschungszentrum Juelich GmbH (Germany). Geschaeftsbereich Sicherheit und Strahlenschutz
2016-07-01
During dismantling operation in former nuclear facility routine incorporation monitoring had been part of the safety measures. For an occupational radiation worker positive measurements results for {sup 241}Am, {sup 90}Sr and {sup 137}Cs were obtained after the end of the working period. Follow up monitoring had been performed assessing urine and faeces samples for {sup 241}Am and {sup 90}Sr as well as in-vivo measurements for {sup 137}Cs. Ingestion could be proven as incorporation path. The internal dose assessment according to GMBl 2007{sup [1]} finally yielded internal dose at 13 μSv.
International Nuclear Information System (INIS)
Tingey, J.M.; Bredt, P.R.; Shade, E.H.
1994-10-01
Of the 177 high-level waste underground storage tanks at the Hanford Site, 25 have been identified as being potentially capable of generating and releasing flammable gas. Tank 241-SY-101 has exhibited periodic releases of gas, and in some cases the gas released has exceeded the lower flammable gas limit. The components of the released gas from Tank 241-SY-101 are hydrogen, nitrous oxide, nitrogen, ammonia, carbon monoxide, and methane. A mitigation strategy that may effectively reduce the retention and release of these gases and the release of flammable gases is dilution coupled with eating of the tank wastes. The purpose of this work was to determine changes in rheological and physical properties caused by heating and dilution of actual 241-SY-101 waste. In May and December 1991, following periodic gas releases, samples of the waste in Tank 241-SY-101 were obtained. Current work quantified the effects of heating coupled with NaOH dilution of a combination of waste samples from Tank 241-SY-101 characteristic of a non-convective layer. The experimental approach and results of this heating and dilution study on Tank 241-SY-101 waste samples are described in Sections 2 and 3, respectively. In Section 3.1, a discussion of the rheological properties of the waste as a function of shearing forces, volume percent dilution, and temperature is presented. In Section 3.2, the physical properties of the waste dilutions are described, including the densities of the slurry, filtered solids, and filtrate; the settling behavior; and the percent filtered solids in the composite sample and each of the composite dilutions. A brief discussion of the results and uncertainties is given is Section 3.3. The conclusions of this investigation are reported in Section 4
Field study of the migration of 237Np, 238Pu and 241Am in a weak loess aquifer
International Nuclear Information System (INIS)
Liu, C.L.; Wang, Z.M.; Li, S.S.; Yang, Y.E.; Li, B.; Jiang, H.; Jiang, L.; Wang, L.; Li, D.
2004-01-01
The migration of 237 Np, 238 Pu and 241 Am in a weak loess aquifer was investigated in-situ in an Underground Research Facility. Quartz containing 237 Np, 238 Pu, 241 Am and 3 H was introduced into the aquifer with a stainless steel tube. The local water flow in the aquifer was monitored using a 3-dimensional sampling system. The contaminated area of the aquifer was obtained wholly with the help of a pre-installed stainless steel frame and cut into small pieces (samples) 3-dimensionally and analyzed. 3 H in the water samples was determined with a liquid scintillation analyzer (Tri-Camb 2250). Radioactivity of 237 Np and 241 Am in the soil samples were determined with a low energy photon detector (HPGe), 238 Pu was analyzed with a low background αandβ detector after chemical separation. The result of the 3-year experiment indicated that 237 Np, 238 Pu and 241 Am were strongly absorbed by the loess aquifer. The retardation factor of 237 Np in the loess aquifer was 1.54 x 10 4 . (author)
International Nuclear Information System (INIS)
Heuvel, R.L. van den
1990-01-01
Radiation damage from 241 Am to bone marrow cells was manifest in long-term bone marrow cultures (LTC) from offspring of mice radiocontaminated at 14th day of gestation (119, 479, 803, 1754 kBq 241 Am kg). Offspring were reared by their own contaminated mother for 3 weeks postnatal. LTC from these offspring were less able to support in vitro CFC proliferation than control LTC. This radiation damage persisted 71 weeks after radiocontamination in utero. Damage was observed at lower doses if 241 Am contamination occurred at foetal rather than adult ages. Radiation damage was observed only using LTC. After culturing LTC in 25% FCS and recharging the stromal adherent layer with bone marrow cell suspensions originating either from control offspring or from offspring contaminated with 241 Am in utero evidence was found that the proliferation capacity of haemopoietic cells was diminished. However, the nature of effects on the stromal elements is currently somewhat equivocal. Following in utero contamination stromal adherent cells appeared to support better production of in vitro CFC. (author)
Energy Technology Data Exchange (ETDEWEB)
Huevel, R. Van Den; Vander Plaetse, F.; Leppens, H.; Schoeters, G. (Centre d' Etude de l' Energie Nucleaire, Mol (Belgium))
1992-01-01
Pregnant BALB/c mice and age and sex matched nulliparous controls were contaminated with {sup 241}Am (13 kBq per mouse). Five days after the termination of contamination, {sup 241}Am incorporation was measured in the tissues of adults and in the liver an the femur of newborn and one-month-old mice. Pregnancy resulted in higher {sup 241}Am concentrations in bone but lower concentrations in the liver of the mothers. Protracted administration of {sup 241}Am compared to a single injection resulted in a lower concentration of {sup 241}Am in the livers of pregnant mice, their nulliparous controls and from newborn mice. The higher {sup 241}Am concentration in the femur at birth after protected exposure before 14 days of gestation compared to protracted exposure after 14 days of gestation could reflect the increased placental transfer of {sup 241}Am with advancing gestational age. Radiation doses to the femur were estimated between 4 and 20 mGy. Haemopoietic changes were noticed at these dose levels in all groups until at least 6 months after birth. (author).
Energy Technology Data Exchange (ETDEWEB)
Veran, M.P.; Garnier-Laplace, J.; Baudin, J.P. [CEA Cadarache, Inst. de Protection et de Surete Nucleaire (IPSN), 13 - Saint-Paul-lez-Durance (France)
1999-07-01
The {sup 241}Am transfers are quantified in the heart of a model ecosystem, representative of the aquatic medium downstream the site of Marcoule. The dominating phenomenon of adsorption governs the distribution of Am in the ecosystem. The capacities of bioaccumulation are more important for the primary producers, the zooplankton and the filter molluscs. The results show the key role of the benthic fauna able to mobilize {sup 241}Am fixed on the sediment and the importance of the feeding to explain the contamination of the omnivorous fishes. The dreissensia can be used as bio indicator of radio contamination by transuranium elements. (N.C.)
On a low intensity 241 Am Compton spectrometer for measurement ...
Indian Academy of Sciences (India)
In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.
Structural evaluation of thermocouple probes for 241-AZ-101 waste tank
International Nuclear Information System (INIS)
Kanjilal, S.K.
1994-01-01
This document reports on the structural analysis of the thermocouple probe to be installed in 241-AZ-101 waste tank. The thermocouple probe is analyzed for normal pump mixing operation and potential earthquake induced loads required by the Hanford Site Design Criteria SDC-4.1
Structural evaluation of thermocouple probes for 241-AZ-101 waste tank
Energy Technology Data Exchange (ETDEWEB)
Kanjilal, S.K.
1994-12-06
This document reports on the structural analysis of the thermocouple probe to be installed in 241-AZ-101 waste tank. The thermocouple probe is analyzed for normal pump mixing operation and potential earthquake induced loads required by the Hanford Site Design Criteria SDC-4.1.
Preliminary Analysis of High-Flux RSG-GAS to Transmute Am-241 of PWR’s Spent Fuel in Asian Region
Budi Setiawan, M.; Kuntjoro, S.
2018-02-01
A preliminary study of minor actinides (MA) transmutation in the high flux profile RSG-GAS research reactor was performed, aiming at an optimal transmutation loading for present nuclear energy development. The MA selected in the analysis includes Am-241 discharged from pressurized water reactors (PWRs) in Asian region. Until recently, studies have been undertaken in various methods to reduce radiotoxicity from actinides in high-level waste. From the cell calculation using computer code SRAC2006, it is obtained that the target Am-241 which has a cross section of the thermal energy absorption in the region (group 8) is relatively large; it will be easily burned in the RSG-GAS reactor. Minor actinides of Am-241 which can be inserted in the fuel (B/T fuel) is 2.5 kg which is equivalent to Am-241 resulted from the partition of spent fuel from 2 units power reactors PWR with power 1000MW(th) operated for one year.
Single-Shell Tank (SST) Retrieval Project Plan for Tank 241-C-104 Retrieval
International Nuclear Information System (INIS)
DEFIGH PRICE, C.
2000-01-01
In support of the SST Interim Closure Project, Project W-523 ''Tank 241-C-104 Waste Retrieval System'' will provide systems for retrieval and transfer of radioactive waste from tank 241-C-104 (C-104) to the DST staging tank 241-AY-101 (AY-101). At the conclusion of Project W-523, a retrieval system will have been designed and tested to meet the requirements for Acceptance of Beneficial Use and been turned over to operations. Completion of construction and operations of the C-104 retrieval system will meet the recently proposed near-term Tri-Party Agreement milestone, M-45-03F (Proposed Tri-Party Agreement change request M-45-00-01A, August, 30 2000) for demonstrating limits of retrieval technologies on sludge and hard heels in SSTs, reduce near-term storage risks associated with aging SSTs, and provide feed for the tank waste treatment plant. This Project Plan documents the methodology for managing Project W-523; formalizes responsibilities; identifies key interfaces required to complete the retrieval action; establishes the technical, cost, and schedule baselines; and identifies project organizational requirements pertaining to the engineering process such as environmental, safety, quality assurance, change control, design verification, testing, and operational turnover
Tank characterization report for double-shell tank 241-AN-105
International Nuclear Information System (INIS)
Jo, J.
1997-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for double-shell tank 241-AN-105. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-AN-105 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1996) milestone M-44-10
Tank characterization report for single-shell tank 241-S-104
International Nuclear Information System (INIS)
Jo, J.
1997-01-01
One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-S-104. The objectives of this report are: (1) to use characterization data in response to technical issues associated with 241-S- 104 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1996) milestone M-44-05