International Nuclear Information System (INIS)

The use of europium as a local structural probe allows the various phases appearing in the NaCaPO_4-Na_3Eu(PO_4)_2 and NaSrPO_4-Na_3Eu(PO_4)_2 systems to be detected. The broadening of the europium emission lines in going from the calcium to the strontium phases illustrates the ease of displacement of the PO_4 groups. (Auth.).

International Nuclear Information System (INIS)

The broad bands in the room-temperature excitation spectra of Sm"3"+-, Dy"3"+- and Tm"3"+-activated Ca-#alpha#-SiAlON phosphors are interpreted as the N"3"--to-rare earth charge transfer transition (CTT). From the energies of the charge transfer transitions and from the optical data presented for the Eu"2"+ ion, the location of the divalent rare earth ion energy levels relative to the valence and the conduction band of Ca-#alpha#-SiAlON is derived. The salient features of the energy-level diagram are shown to be practical in explaining the temperature-dependent variations of the Eu"2"+ and Yb"2"+ luminescence efficiency in Ca-#alpha#-SiAlON. A comparative study pertaining to the nature of the Yb"2"+ and Eu"2"+ ion luminescence in Ca-#alpha#-SiAlON and in SrSi_2O_2N_2 is presented. A tentative energy-level diagram of the ...

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis was used for the determination of Sr/Ca ratio in bones to test the influence of a diet on this ratio. Significant differences were observed for Sr/Ca ratio in bones of various animals. Only small differences in the Ca/Sr ratio were observed for the samples of various prehistoric human bones. (author) 4 refs.; 4 tabs.

International Nuclear Information System (INIS)

Spectral-luminescent characteristics of Sr2Y8(SiO4)6O2: Eu powder crystal phosphor with the apatite structure and high-intensity luminescence of Eu3+ ions have been studied. The charge state of europium in the samples has been characterized by means of X-ray L3-adsorption spectroscopy. It was established that Eu3+ forms two types of optical centers. Besides, luminescence of Eu2+ions was found. Reduction Eu3+#->#Eu2+ was considered, which may be due to VSr|| vacancy formation in the 4f crystal lattice position and to negative charge transfer by this vacancy to two EuY3+ ions. Thus, in the silicate lattice there exist inhomogeneously distributed oxygen-deficient centers, which are responsible for nonradiative transfer of excitation energy to Eu3+ and Eu2+ ions. To study ...

Energy Technology Data Exchange (ETDEWEB)

Leafy samples often used as medicine in the Indian Ayurvedic system and vegetables were analyzed for 20 elements (As, Ba, Br, Ca, Ce, Cr, Cs, Co, Eu, Fe, K, La, Na, Rb, Sb, Sc, Sm, Sr, Th, Zn) by employing Instrumental Neutron Activation Analysis (INAA). The samples were irradiated at the 100 kW TRIGA-MAINZ nuclear reactor and the induced activities were counted by gamma ray spectrometry using an efficiency calibrated high resolution High Purity Germanium (HPGe) detector. The concentration of the elements in the medicinal and vegetable leaves and their biological effects on human beings are discussed.

Science.gov (United States)

The development of new efficient afterglow phosphors is currently hampered by a limited understanding of the persistent luminescence mechanism. Radioluminescence (RL) and x-ray absorption measurements on the persistent phosphor SrAl2O4:Eu,Dy were combined to reveal possible valence state changes for the rare earth (co)dopants. Traps in the phosphor material are quickly filled when exposing thermally emptied SrAl2O4:Eu,Dy powder to x rays. On the same time scale a partial oxidation of Eu2+ to Eu3+ is observed by x-ray absorption near-edge spectroscopy (XANES), while for the trivalent dysprosium the valence state remains unchanged. The impact of these observations on the recently proposed models for persistent luminescence is discussed.

British Library Electronic Table of Contents (United Kingdom)

A simple method for preparing LiCaAlF6:Eu2+ phosphor is reported. Photoluminescence (PL) and thermoluminescence (TL) studies were carried out. The TL sensitivity of the phosphor is nearly twice that of CaSO4:Dy TLD phosphor. Several other properties required for TL dosimetry are superior as well. It is suggested that the phosphor can be a suitable replacement for CaSO4:Dy. (Copyright 2007 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim)

British Library Electronic Table of Contents (United Kingdom)

Phosphor material BaAl2O4:Eu2+, Dy3+ with varying compositions of Sr substitution were prepared by the solid-state synthesis method. The phosphor compositions were characterized for their phase and crystallinity by XRD, SEM and TEM. Photoluminescence (PL) properties were investigated measuring PL and decay time for varying Ba/Sr compositions. The PL results show the blue shift in the luminescence properties in Sr substituted BaAl2O4:Eu2+, Dy3+ compared to parent BaAl2O4:Eu2+, Dy3+. It is probably due to the influence of 5d electron states of Eu2+ in the crystal field because of atomic size variation causing crystal defects. Dy3+ ion doping in the phosphor generates deep traps, which results in long afterglow phosphorescence.

Energy Technology Data Exchange (ETDEWEB)

Laser desorption (LD) and thermal desorption (TD) mass spectra of the metallofullerenes found in arc-produced primary soots have been studied for a large variety of alkaline earth and lanthanide elements. The metallofullerene ratios found in the LD spectra indicate that two distinct groups are observed: Sc, Y, La, Ce, Pr, Nd, Gd, Tb, Ho, Er, and Lu (group A) and Ca, Sr, Sm, Eu, and Yb (group B). The TD spectra of most of these same soots also separate into two groups that contain the same elements as groups A and B. Group A metallofullerenes show strong signals in both LD and TD spectra. Group B metallofullerenes are distinguished by their presence in the LD spectra but absence in the TD spectra. From the general ionic behavior of the elements of these groups, and recent studies of the endohedral oxidation states, we propose that the oxidation states are +3 for group A and +2 for group B. C[sub 70] metallofullerenes are ...

International Nuclear Information System (INIS)

The possibility of having Sr as an interstitial metal cation in #alpha#-SiAlON has been investigated in two systems: a single-cation system (Si_3N_4-SrO-AlN) and a multication system (Si_3N_4-(Y_2O_3/SrO/CaO)-AlN). It was found that Sr alone does not form #alpha#-SiAlON and that Sr could only be accommodated in #alpha#-SiAlON in conjunction with Y and Ca. The Sr content of #alpha#-SiAlON increased as the total content of (Y + Ca) increased and appeared to reach a limit at 0.5 at.%, or 0.15 atom per #alpha#-SiAlON. Unexpectedly, some of the #alpha#-SiAlON that contained (Sr + Y + Ca) was present as laths or fibers with the c-axis perpendicular to the hot-press direction.

Energy Technology Data Exchange (ETDEWEB)

Since chlordecone (Kepone, CD) interferes with cardiac Na{sup +} ion translocases, we have studied CD effects on cardiac SR calcium pump activity. SR was isolated from heart ventricles of male Sprague-Dawley rats. Cardiac SR Ca{sup 2+}-ATPase, {sup 45}Ca-uptake and cAMP as well as calmodulin (CaM) dependent protein phosphorylation were measured. Ca{sup 2+}-ATPase was differentiated into low affinity and high affinity forms by measuring the activity using 50 and 0.7 {mu}M free Ca{sup 2+} respectively. CD in vitro inhibited {sup 45}Ca-uptake by SR in a concentration dependent manner with an IC50 value of 7 {mu}M and SR {sup 45}Ca-uptake was totally inhibited at 20-30 {mu}M CD. In agreement with this, both high affinity and low affinity ...

International Nuclear Information System (INIS)

We have studied photoluminescence and thermoluminescence (PL and TL) in CaGa2Se4:Eu crystals in the temperature range 77-400 K. We have established that broadband photoluminescence with maximum at 571 nm is due to intracenter transitions 4f6 5d-4f7 (8S7/2) of the Eu2+ ions. From the temperature dependence of the intensity (log I-103/T), we determined the activation energy (Ea = 0.04 eV) for thermal quenching of photoluminescence. From the thermoluminescence spectra, we determined the trap depths: 0.31, 0.44, 0.53, 0.59 eV. The lifetime of the excited state 4f6 5d of the Eu2+ ions in the CaGa2Se4 crystal found from the luminescence decay kinetics is 3.8 ?sec. (authors)

Energy Technology Data Exchange (ETDEWEB)

The results of real-time neutron diffraction measurements during the superconducting phase formation process in the Bi(Pb)-Sr-Ca-Cu-O system are reported. A Sr-Ca-Cu-O type precursor, with the same stoichiometry as the 2223 phase, was used as starting material, and the temperature range favorable to the formation of the 2223 phase was investigated. The diffraction patterns were processed by a multiphase Rietveld refinement. The formation and decomposition of the 2201 and 2212 phases were directly observed. Experimental evidence on the existence of a partially melted phase in the range 855-860[degrees]C, involved in the formation of the 2223 phase, is discussed. 14 refs., 9 figs., 1 tab.

International Nuclear Information System (INIS)

The optical properties of divalent europium activated Ca-#alpha#-SiAlON were investigated and the excitation and emission processes were discussed. The emission wavelength is influenced by the activator concentration of Eu more than the codopant concentration of Ca, in case of the same matrix composition of #alpha#-SiAlON. The red-shift of emission increases when the concentration of Eu increases. In addition, it was revealed that the red-shift of emission would be caused by the construction of the package of optical device. The correlated color temperature becomes low by the red-shift for the white light-emitting diode (LED) lamp using Ca-#alpha#-SiAlON:Eu phosphor when the phosphor powder concentration increases in the transparent resin which coats the primary light source of a blue LED die. The additional red-shift can be observed when the excessive amount of phosphor coating is ...

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence analysis (XFA) was used in the determination of the contents of metal residues in dosing plates for coin minting. XFA was also used for the determination of the strontium/calcium ratio in bone samples of different animals with the aim to obtain information on the food composition of these animals. It was found that bones of different animals can be distinguished based on the Sr/Ca ratio. No significant differences in the Sr/Ca ratio were observed in human bones of individuals from different social groups. (author). 1 fig., 5 tabs., 4 refs.

British Library Electronic Table of Contents (United Kingdom)

We present the low-temperature physical properties of the polycrystalline perovskite systems La2/3A1/3Mn1-xCoxO3, A=Ca, Sr (0.5x1) including electrical resistance, magnetization, ac and dc susceptibilities. The experimental data suggest the presence of correlated ferromagnetic clusters embedded in some non-ferromagnetic matrix. The systems show semiconducting behavior and negative magnetoresistance.

Energy Technology Data Exchange (ETDEWEB)

A method of preparing a high temperature superconductor from an amorphous phase. The method involves preparing a starting material of a composition of Bi.sub.2 Sr.sub.2 Ca.sub.3 Cu.sub.4 Ox or Bi.sub.2 Sr.sub.2 Ca.sub.4 Cu.sub.5 Ox, forming an amorphous phase of the composition and heat treating the amorphous phase for particular time and temperature ranges to achieve a single phase high temperature superconductor.

International Nuclear Information System (INIS)

Non-radiative energy transfers (ET) from Ce3+ to Pr3+ in Y3Al5O12:Ce3+, Pr3+ and from Sm3+ to Eu3+ in CaMoO4:Sm3+, Eu3+ are studied based on photoluminescence spectroscopy and fluorescence decay patterns. The result indicates an electric dipole-dipole interaction that governs ET in the LED phosphors. For Ce3+ concentration of 0.01 in YAG:Ce3+, Pr3+, the rate constant and critical distance are evaluated to be 4.5x10-36 cm6 s-1 and 0.81 nm, respectively. An increase in the red emission line of Pr3+ relative to the yellow emission band of Ce3+, on increasing Ce3+ concentration is observed. This behavior is attributed to the increase of spectral overlap integrals between Ce3+ emission and Pr3+ excitation due to the fact that the yellow band shifts to the red spectral side with increasing Ce3+ concentration. In CaMoO4:Sm3+, Eu3+, Sm3+-Eu3+ transfer occurs from 4G5/2 ...

Energy Technology Data Exchange (ETDEWEB)

Development of useful high-critical-temperature (high-{Tc}) superconductors requires synthesis of superconducting compounds; fabrication of wires, tapes, and films from these compounds; production of composite structures that incorporate stabilizers or insulators; and design and testing of efficient components. This report describes technical progress of research and development efforts aimed at producing superconducting components based on the Y-Ba-Cu, Bi-Sr-Ca-Cu, Bi-Pb-Sr-Ca-Cu, and Tl-Ba-Ca-Cu oxides systems. Topics discussed are synthesis and heat treatment of high-{Tc} superconductors, formation of monolithic and composite wires and tapes, superconductor/metal connectors, characterization of structures and superconducting and mechanical properties, and fabrication and properties of thin films. Collaborations with industry and academia are also documented. 10 figs.

International Nuclear Information System (INIS)

The behavior of afterglow (AG), thermoluminescence (TL), infrared stimulated luminescence (IRSL) and phototransferred TL (PTTL) under thermal and/or infrared (IR) stimulation in blue (470 nm) light illuminated at room temperature (RT) SrAl2O4:Eu2+, Dy3+ is presented. The TL glow curve consists of four peaks with maxima at about 340, 430, 560 and 680 K. The 340 and 440 K peaks are described well by second order kinetics with activation energies of 0.83 and 1.05 eV, respectively. The AG decay is fitted by the Becquerel's law with exponent 1.5 and correlates well with the thermal emptying of the traps responsible for the 340 K peak. The 340 and 430 K TL peak traps are destroyed under IR (830 nm) stimulation creating IRSL. IR stimulation after illumination with blue light and preliminary heating restore partially the 340 and 430 K TL peaks by phototransfer from deeper traps. The shape of the IRSL decay curves depends strongly on the preheating ...

International Nuclear Information System (INIS)

The electronic structure and surface interactions vapor-deposited Cu on single-crystal and polycrystalline Bi_2Ca/sub 1+//sub x//sub Sr>2-//sub x//sub Cu>2/O/sub 8+//sub y/ were studied using x-ray photoelectron spectroscopy. The results are compared to the Cu/YBa_2Cu_3O/sub 7-//sub x/ interface. Changes in the Cu 2p satellite emission indicate that the Cu adatoms do not disrupt Bi_2Ca/sub 1+//sub x/Sr/sub 2-//sub x/Cu_2O/sub 8+//sub y/ as extensively as YBa_2Cu_3O/sub 7-//sub x/. However, deposition of Cu induces changes in the Bi environment in the superconductor, and surface segregation of Bi metal was observed at high coverages. Core-level attenuation results suggests minimal outdiffusion of oxygen, in contrast with what is observed for Cu/YBa_2Cu_3O/sub 7-//sub x/.

Energy Technology Data Exchange (ETDEWEB)

New phosphates with NaZr{sub 2}(PO{sub 4}){sub 3} structure of the B{sub 0.5}FeTa(PO{sub 4}){sub 3}-type (where B-Ca, Sr, Ba) are synthesized and characterized by X-ray diffraction analysis and IR-spectroscopy. The heating behavior of the phosphates is studied using high-temperature X-ray crystallography in the range 15-625 deg. C. The unit-cell parameters, the coefficients of thermal expansion {alpha}{sub a}, {alpha}{sub c} and their thermal expansion anisotropy |{alpha}{sub c} - {alpha}{sub a}| of the phosphates under study are determined and the dependences of these characteristics on the nature of cations are established and analyzed.

Energy Technology Data Exchange (ETDEWEB)

Cross sections for the elastic and inelastic scattering of /sup 16/O on /sup 58/Ni, /sup 88/Sr, /sup 40/Ca, and /sup 48/Ca have been calculated in a coupled-channels treatment, including the low-lying 2/sup +/ and 3/sup /minus// states of both projectile and target. Real, energy-independent ion-ion potentials and form factors were used, and fusion was simulated by ingoing wave boundary conditions in all channels. The agreement with the measured scattering data is qualitatively as good as obtained in previous optical-model calculations.

Energy Technology Data Exchange (ETDEWEB)

A procedure is described for the isolation and determination of {sup 90}Sr, {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO{sub 4}, Ba(Ra)SO{sub 4} and PbS are prepared. Ra is determined by gamma-spectrometry, {sup 90}Sr and {sup 210}Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for {sup 90}Sr and {sup 210}Pb and 50 mBq/kg for {sup 226}Ra and {sup 228}Ra. The procedure is useful for all kinds of foodstuff. (orig.) [Deutsch] Es wird ein Analysengang zur Abtrennung und Bestimmung von {sup ...

International Nuclear Information System (INIS)

Sr3In0.9Co1.1O6, isostructural to Ca3Co2O6, is revealed by the study of the phase relations in the system SrO-InO1.5-CoOx (1000 oC). The structure of Sr3In0.9Co1.1O6 is refined by the combination of powder X-ray and neutron diffraction. Sr3In0.9Co1.1O6 crystallizes in a trigonal lattice with the cell parameters a=b=9.59438(3) A, c=11.02172(4) A with the space group R-3c. Its structure possesses 1D (In/Co)O3 chains running along the c-axis constructed by alternating face-sharing CoO6 octahedra and (In0.9Co0.1)O6 trigonal prisms. The co-occupation of In3+ and Co3+ at the trigonal prismatic site is evidenced by elementary analysis and determined by the structure refinement. Sr3In0.9Co1.1O6 is paramagnetic, and the susceptibility is consistent with the occupation of Co3+ at 10% of the trigonal prismatic positions in a high spin state (HS, S=2). The HS Co3+ is well ...

International Nuclear Information System (INIS)

Molar extinction coefficients for the solid solutes in aqueous solutions of some alkaline earth chlorides such as MgCl_2.6H_2O, CaCl_2, SrCl_2.6H_2O and BaCl_2.2H_2O have been determined at 81, 356, 511, 662, 1173 and 1332 keV energies in different concentration using the narrow beam transmission methods. (author)

Energy Technology Data Exchange (ETDEWEB)

Low-temperature specific-heat measurements have been carried out between 0.5 and 30--50 K on the high-T/sub c/ copper oxide superconductors La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and RBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ (R = Y, Eu, Ho, Tm, and Yb). The specific heat of the La/sub 1.8/Sr/sub 0.2/CuO/sub 4-//sub delta/ and YBa/sub 2/Cu/sub 3/O/sub 7-//sub delta/ compounds below T/sub c/ can be resolved into a contribution of the form C/sub e/(T) = ..gamma..'T with a finite ..gamma..' and a lattice contribution that consists of Debye and Einstein terms. Specific-heat data for the RBa/sub 3/Cu/sub 3/O/sub 7-//sub delta/ compounds with R = Ho, Tm, and Yb exhibit no features due to magnetic order above 0.5 K, but reveal electronic Schottky anomalies associated with crystalline electric field (CEF) splitting of the Hund's-rules ground-state multiplet of the R/sup 3+/ ions. The Schottky anomalies ...

Science.gov (United States)

High quality La/sub 1.8/Sr/sub 0.2/CuO/sub 4/ and YBa/sub 2/Cu/sub 3/O/sub 7/ superconducting thin films, with zero resistance at 88 K, have been made by dual-ion-beam sputtering of metal and oxide targets at elevated temperatures. The films are about 1.0 ..mu..m thick and are single phase after annealing. The substrates investigated are Nd-YAP, MgO, SrF/sub 2/, Si, CaF/sub 2/, ZrO/sub 2/-9% Y/sub 2/O/sub 3/, BaF/sub 2/, Al/sub 2/O/sub 3/, and SrTiO/sub 3/. Characterization of the films was carried out using Rutherford backscattering spectroscopy, resistivity measurements, transmission electron microscopy, x-ray diffraction, and secondary ion mass spectroscopy. Substrate/film interaction was observed in every case. This generally involves diffusion of the substrate into the film, which is accompanied by, for example, the replacement of Ba by Sr in the YBa/sub 2/Cu/sub 2/O/sub 7/ ...

International Nuclear Information System (INIS)

The chemical composition and evolution of produced waters associated with gas production in the Palm Valley gas field, Northern Territory, has important implications for issues such as gas reserve calculations, reservoir management and saline water disposal. The occurrence of saline formation water in the Palm Valley field has been the subject of considerable debate. There were no occurrences of mobile water early in the development of the field and only after gas production had reduced the reservoir pressure, was saline formation water produced. Initially this was in small quantities but has increased dramatically with time, particularly after the initiation of compression in November 1996. The produced waters range from highly saline (up to 300,000 mg/L TDS), with unusual enrichments in Ca, Ba and Sr, to low salinity fluids that may represent condensate waters. The Sr isotopic compositions of the waters ...

Energy Technology Data Exchange (ETDEWEB)

X-ray fluorescence (XRF) and total-reflection X-ray fluorescence (TXRF) techniques suited well for a multi-element determination of K, Ca, Mn, Fe, Cu, Zn, Rb, and Sr in some Syrian medicinal plant species. The accuracy and the precision of both techniques were verified by analyzing the Standard Reference Materials (SRM) peach-1547 and apple leaves-1515. A good agreement between the measured concentrations of the previously mentioned elements and the certified values were obtained with errors less than 10.7% for TXRF and 15.8% for XRF. The determination of Br was acceptable only by XRF with an error less than 24%. Furthermore, the XRF method showed a very good applicability for the determination of K, Ca, Mn, Fe, Cu, Zn, Rb, Sr, and Br in infusions of different Syrian medicinal plant species, namely anise (Anisum vulgare), licorice root (Glycyrrhiza glabra), and white wormwood (Artemisia herba-alba)

International Nuclear Information System (INIS)

The wide-angle spectra of the 134-MeV (p,n) reaction on "4"8Ca, "5"4Fe, "8"8Sr, and "2"0"8Pb are each dominated by the excitation of a single state at low excitation energy. These excitations correspond to the ''0h#omega#'' stretched states and are seen to be fragmented much less than ''1h#omega#'' stretched states in medium- and heavy-mass nuclei. The normalization factors required for comparison with distorted-wave impulse-approximation calculations are >0.50 and indicate that these are the purest particle-hole states known in these nuclei.

Energy Technology Data Exchange (ETDEWEB)

Results on the oxidative dehydrogenation of ethane on rare-earth oxide (REO) based catalysts (Na-P-Sm-O, Sm-Sr(Ca)-O, La-Sr-O and Nd-Sr-O) are described. Oxygen adsorption was found to be a key factor which determines the activity of this type of catalysts. Continuous flow experiments in the presence of catalysts which reveal strong oxygen adsorption showed that the reaction mixture is ignited resulting in an enhanced heat generation at the reactor inlet. The heat produced by the oxidative reactions was sufficient under the conditions chosen for the endothermic thermal pyrolysis which takes place preferentially in the gas phase. Ignition of the reaction mixture is an important catalyst function. Contrary to non-catalytic oxidative dehydrogenation, reaction temperatures above 700 C could be achieved without significant external heat input. Ethylene yields of up to 34-45% (S=66-73%) were obtained on REO-based catalysts under ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

Energy Technology Data Exchange (ETDEWEB)

An historic Strontianite-type specimen from Strontian, Scotland, UK, was characterized to broaden our knowledge on luminescence properties of common carbonates. These fibrous aggregates are Strontianite (Sr{sub x}Ca{sub 1-x}CO{sub 3}) with circa 6% of CaO, interfacial water, hydrosilicate anions and substitutional divalent cations, e.g., Ca{sup 2+}, Mn{sup 2+}, Fe{sup 2+} in structural Sr{sup 2+} positions. The specimen was analyzed by X-ray Fluorescence Spectrometry (XRF), Environmental Scanning Electron Microscopy coupled with an Energy Dispersive X-ray Spectroscopy (ESEM-EDS) probe, Spatially-resolved Cathodoluminescence under the Scanning Electron Microscope (SEM-CL), Differential-Thermal Analyses (DTA), Thermogravimetry (TG), Thermoluminescence (TL), Radioluminescence (RL) and High Resolution Spectra Thermoluminescence (3DTL), to gain an overview of the spectral emissions, the ...

Energy Technology Data Exchange (ETDEWEB)

The use of high-performance ion exchangers allows a trace-matrix-separation (SMT) directly followed by an ion chromatographic (IC) separation of the analytes. Based on the principles described in Part 1, a combined procedure IC-SMT-IC for metallic impurities in Mo and W is presented. Up to 12 metal traces (Fe, Cu, Pb, Zn, Ni, Co, Cd, Ca, Mn, Sr, Mg and Ba) can be determined in one run with 35 min. A special method for traces of U and Th is also given. Detection limits are typically 10-100 ng g{sup -1} in the metal sample. (author). 14 refs.; 10 figs.; 6 tabs.

British Library Electronic Table of Contents (United Kingdom)

A rapid and cost-effective assessment was required to provide advice to management on the connectivity between juvenile and adult life cycle stages of Baldchin Groper Choerodon rubescens, a labrid endemic to the west coast of Australia, which has high social value, but relatively low commercial fishery importance. To minimise costs we used laser ablation ICP-MS to analyse levels of a small suite of elements (Ca, Mg, Mn, Cu, Zn, Sr, Rb, Ba and Pb) at the margin (adult phase) and core (juvenile phase) of the same otoliths of adult C. rubescens, collected at ten locations in five management zones. The elemental composition of both otolith margins and cores differed significantly among management zones and in some cases among locations within zones. Similarity of the pattern of among-zone elem...

Energy Technology Data Exchange (ETDEWEB)

During this reporting period the work supported by the US Department of Energy Grant No. DE-FG02-87ER40326.A005 has resulted in two publications and two papers presented at professional meetings. The neutron scattering measurement for this budget period has been completed along with scattering measurements for carbon {sup 88}Sr, {sup 40}Ar, {sup 90}Zr, {sup 208}Pb, {sup 40}Ca and {sup 28}Si. The carbon scattering yield serves to define the detector efficiencies. The silicon sample was available and is of importance in both nuclear physics and reactor physics.

International Nuclear Information System (INIS)

The determination of ratio of neutron over proton matrix elements by inelastic proton scattering, for 0"+#->#2"+ transitions, is investigated via the comparison between experimental data and theoretical calculations. Calculations into the context of a macroscopic and a microscopic description are performed for a wide mass range nuclei: "1"8O, "3"0Si, "3"2","3"4S, "4"8Ca, "8"8Sr, for which these ratios were determined previously with an independent technique. At that point the choice of the theoretical model may be very critical. It is thus the purpose of this investigation to point out the most suitable model. It is found that in general both theoretical models can be employed for the reliable determination of neutron over proton matrix element ratios.

International Nuclear Information System (INIS)

The elastic and inelastic scattering of "1"4C at 51 MeV from targets of "4"0Ca, "5"6Fe, "6"0Ni, "6"6Zn and "8"8Sr has been measured using a Q3D spectrometer. The "1"4C-nucleus potentials have been derived by optical-model analysis of the observed elastic scattering; the inelastic scattering differential cross sections were interpreted in the distorted-wave Born approximation and also in the coupled-channels approach. The analysis yields "1"4C-nucleus potentials that closely resemble "1"2sup(,)"1"3C and "1"6O potentials. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Trace elemental analysis was carried out in various parts of some anti-diabetic medicinal plants using PIXE technique. A 3 MeV proton beam was used to excite the samples. The elements Cl, K, Ca, Ti, Cr, Mn, Fe, Ni, Cu, Zn, Br, Rb and Sr were identified and their concentrations were estimated. The results of the present study provide justification for the usage of these medicinal plants in the treatment of diabetes mellitus (DM) since they are found to contain appreciable amounts of the elements K, Ca, Cr, Mn, Cu, and Zn, which are responsible for potentiating insulin action. Our results show that the analyzed medicinal plants can be considered as potential sources for providing a reasonable amount of the required elements other than diet to the patients of DM. Moreover, these results can be used to set new standards for prescribing the dosage of the herbal drugs prepared from these plant materials.

International Nuclear Information System (INIS)

Two new equiatomic ternary compounds, EuPtSi and EuPdSi, have been synthesized and are found to crystallize in the cubic LaIrSi type structure. The magnetic susceptibility of both compounds follows Curie-Weiss behavior in the temperature range 10 to 300 K with an effective magnetic moment close to that of Eu"2"+ moment. The paramagnetic Curie temperatures are 5 K for EuPtSi and 9 K for EuPdSi. There is no clear indication of magnetic ordering in the susceptibility of both the compounds down to 4.2 K. However, "1"5"1Eu Moessbauer studies show a hyperfine split pattern in EuPtSi at 4.2 K indicating the onset of magnetic ordering. The "1"5"1Eu isomer shifts are temperature independent and are characteristic of the divalent Eu ion. All these results establish that the Eu ions are in ...

Wastenet

...EU Descartes Prizes for excellence in research and science communication descartes, prize, science communication, research, rtd, european commission, ...european union, eu EU Descartes Prizes for excellence in research and science communication Research - EU Descartes Prizes for excellence in research and science ...communication en European Commission Research Descartes Prize Contact | Search ...

Science.gov (United States)

The title compounds were prepared by arc-melting of the elemental components. Whereas NdPdSi and SmPdSi are already present after the arc-melting, alpha-GdPdSi and alpha-TbPdSi are formed only during the annealing at 800 degC. The four compounds crystallize with the recently reported alpha-YbAuGe type structure, which was refined for alpha-GdPdSi: Pnma, a=2108.0(4) pm, b=433.9(1) pm, c=745.6(1) pm, Z=12, R=0.026 for 1447 structure factors and 62 variable parameters. The lanthanoid atoms are situated between two-dimensionally infinite nets of condensed, puckered hexagons formed by alternating palladium and silicon atoms, with Pd-Si distances varying between 251 and 262 pm. In the third dimension these nets are linked via weak Pd-Pd (300 pm), Pd-Si (283 pm), and Si-Si bonds (261 pm). The refinements of the occupancy parameters suggested that ca. 2% of the palladium sites are occupied by silicon atoms and vice versa. The structural relationships between the two ...

British Library Electronic Table of Contents (United Kingdom)

The X-ray storage phosphor CsBr:Eu2+ in form of needle image plates is believed to be a promising alternative to the granular BaFBr:Eu2+ with regard to PSL yield and spatial resolution. Unfortunately, CsBr:Eu2+ exhibits poor radiation hardness, which is caused by a migration of europium ions initiated by naturally existing defect centers like (Eu2+-VCs)-centers and X-ray generated MEu-centers. It will be shown that the formation of (Eu2+-O2?)-dipoles at the expense of (Eu2+-VCs)-dipoles, incorporated by thermal annealing in O2-containing and humid atmosphere, does not improve the radiation stability. There is, however, a strong improvement in the radiation hardness by codoping of CsBr:Eu2+ with lithium ions, which is accompanied by a complete suppression of the previously observed MEu-cent...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared

Energy Technology Data Exchange (ETDEWEB)

The pharmacological properties of medicinal plants have been related to the presence of organic compounds, however elements are also known to have an important participation in the active compounds constitution process. In this study, instrumental neutron activation analysis (INAA) was applied to determine elements in leaves of Casearia obliqua medicinal plant collected at two different locations in the Atlantic Forest, Brazil, SP. Soil samples collected from where this plant was grown were also analyzed in order to verify if there is a correlation between the elements present in soils and plant leaves. Br, Ca, Cl, Co, Cr, Cs, Fe, K, La, Mn, Na, Rb, Sb, Sc and Zn were determined in C. obliqua leaves and the elements As, Ca, Ce, Eu, Fe, Hf, La, Lu, Nd, Rb, Sc, Sm, Tb, Th, U and Zn in soils. Soil samples collected from two different locations presented similar concentrations for most elements. Likewise, C. obliqua leaves ...

Energy Technology Data Exchange (ETDEWEB)

A comparative study by Eu-L/sub III/ X-ray absorption and /sup 151/Eu-Moessbauer spectroscopy is presented for the EuPd/sub 2-x/Au/sub x/ Si/sub 2/ series. Possible ways to distinguish between mixed-valent behaviour and final-state effects in the L/sub II /I-edge spectra are discussed.

Wastenet

...The number of documents that contain the keyword absolute zero is: 2 EU Descartes Prizes for excellence in research and science communication EU Descartes Prizes ...for excellence in research and science communication -Chemistry Close to Absolute Zero - Descartes Prize 2000 - Winner- Ian Smith EU Descartes Prizes for excellence ...in research and science communication EU Descartes Prizes for excellence in research and science communication -Chemistry Close to Absolute Zero - Descartes Prize 2000 ...

Energy Technology Data Exchange (ETDEWEB)

Eu 4f electronic structures of a temperature-induced valence transition system EuPd{sub 2}Si{sub 2} have been investigated by bulk-sensitive high-resolution photoemission spectroscopy at temperatures from 20 to 300 K. The bulk Eu{sup 2+} 4f component is definitely distinguished from two surface Eu{sup 2+} 4f components. The changes in the spectral intensity of the bulk Eu{sup 2+} and Eu{sup 3+} 4f configurations and in the energy separation between these states are observed in the temperature dependent photoemission spectra. These temperature dependences are related to the valence transition of EuPd{sub 2}Si{sub 2}. The Eu mean valence is evaluated to be 2.75{+-}0.03 at 20 K and 2.30{+-}0.05 at 300 K. These values are in good agreement with those evaluated from Moessbauer and Eu L{sub III}-edge X-ray ...

Energy Technology Data Exchange (ETDEWEB)

This patent describes a process for the conversion of low molecular weight alkanes to higher molecular weight hydrocarbons. It comprises: contacting the low molecular weight alkanes, at an elevated temperature, with oxygen and a catalyst of the formula Zn{sub a}A{sub b}M{sub c}M'{sub d}O{sub x} wherein A is Li, Na, K, or mixtures thereof; M is Al, Ga, Cr, La, Y, Sc, V, Nb, Ta, Cu or mixtures thereof; M' is Cs, Rb, Mg, Ca, Sr, Ba, Sm, Pb, Mn, Sb, P, Sn, Bi, Ti, Zr, Hf, or mixtures thereof; a if from about 1 to about 20; b is from about 0.1 to about 20; c is from about 0 to about 5 d is from about 0 to about 20, and x is a number needed to fulfill the valence requirements of the other elements; provided that at least one c and d is a t least 0.1; and when M' is Sn, c must be at least 0.1.

Energy Technology Data Exchange (ETDEWEB)

The authors introduce the single electron (Cooper-pair) tunneling junctions using c-axis Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8+d} (Bi-2212) superconducting single crystal whiskers. Focused-ion-beam (FIB) etching patterned the Bi-2212 whiskers. The fabricated small stacked junctions have in-plane area S smaller than <1 {micro}m{sup 2}. The junctions showed the current-voltage (I-V) characteristics with the periodic structure of current peaks. The stacking layered structure of Bi-2212 works as multi-junctions array which decrease the effective capacitance, C{sub {Sigma}} = C{sub 0}/N, where C{sub 0} is the capacitance of junction and N is the layer number of elementary junctions. The period of current peaks of I-V curves corresponds to the charging energy of the single Cooper pair, 2Ec (=e{sup 2}/C{sub {Sigma}}).

Energy Technology Data Exchange (ETDEWEB)

Magnetic properties of single crystals of nonstoichiometric fluorides M[sub 1-x]R[sub x]F[sub 2+x] (M = Ca, Sr, Ba; R = Ce, Pr, Nd, Gd, Ho, Er, Tm, Yb; with 0.05 [le] x [le] 0.28) with the fluorite-type structure have been studied for the first time. The magnetic susceptibility was measured using a Faraday balance in the 15-300 K temperature range. The samples are paramagnetic following the Curie-Weiss law. The values of paramagnetic Curie temperatures and effective magnetic moments of rare-earth ions have been found. Deviations of the temperature dependence of magnetic susceptibility from the Curie-Weiss law are observed for some nonstoichiometric fluorides at temperatures ranging from 60 to 85 K. Possible reaons for these deviations are discussed. Measurements of magnetic susceptibility provide an effective technique for a rapid and accurate determination of the concentration of rare-earth ions in nonstoichiometric fluorides.

Energy Technology Data Exchange (ETDEWEB)

As one of the largest contractors for the construction of ethylene plants featuring steam cracker furnaces as their core component Linde AG has examined the `real` chemical recycling of polymers in steam cracker furnaces as an alternative to their thermal utilisation. In steam cracker furnaces the feedstock, i.e., hydrocarbons, is broken down to ethylene, propylene, and other valuable products in a steam dilution of approx. 800-870 C. In the ideal case, if polyolefins are used as feedstock, then the initial product which led to the polymers can be fully recycled. In this context a series of experiments was carried out in a laboratory-scale cracker plant. The purpose of this was to demonstrate the technical feasibility and the economic advantage of using recycling polyethylene or polypropylene as feedstock for steam cracker plants. (orig./SR) [Deutsch] Die Linde AG als einer der bedeutendsten Kontraktoren fuer den Bau von Ethylenanlagen, deren Herzstueck die ...

Science.gov (United States)

The exchange of Eu[sup 3+] for Na[sup +] cations into the sodalite cages of X zeolite (Eu[sub 25]Na[sub 11]X) leads selectively to the isomerization reaction of cyclopropane to propylene. The latter reaction is catalyzed by Broensted acid sites with an apparent activation energy of 10.6 kcal/mol. Sorption measurements of cyclopropane and propylene with Eu/NaX and NaX zeolites at 40 C support the view that Na[sup +] cations might be considered as sites for sorption of these molecules. Force fields created by Eu[sub 4]O[sup 10+] present in Eu/NaX zeolite may affect sorption. On the other hand, Broensted acid sites in Eu/NaX enhance sorption of cyclopropane and propylene at 40 C. Chemisorption of propylene on the Broensted acid sites of Eu/NaX is reversible and may occur via a propylene carbenium cation intermediate. Small amounts of hexene are ...

International Nuclear Information System (INIS)

Eu3+ ions are anchored on TiO2 matrix by coupling with 2,2'-bipyridyl 4,4'-dicarboxylic acid. Five different luminescence centers are observed for TiO2|2,2'-bipyridyl 4,4'-dicarboxylic acid|Eu3+ electrodes due to electron transitions between d and f orbitals. Photo-luminescence of TiO2|2,2'-bipyridyl 4,4'-dicarboxylic acid|Eu3+ electrodes is increased by attaching 2-thenoyltrifluoroacetone to Eu3+ ions. Immersion of TiO2|2,2'-bipyridyl 4,4'-dicarboxylic acid|Eu3+|2-thenoyltrifluoroacetone electrodes in propylsulfide is found to be further increased intensities of luminescence bands by a factor of three.

International Nuclear Information System (INIS)

High-temperature LiCl-KCl molten salt medium provides an efficient way to produce the paramagnetic Eu(II) ion to be magnetically diluted into a diamagnetic host medium. Eu(II) was formed by a dissolution and an auto-reduction processes in a high-temperature LiCl-KCl eutectic melt at 723 K by using Eu_2O_3 as a starting material. By using EPR and luminescence spectroscopic method, we studied the nature of the magnetically isolated paramagnetic Eu(II) ion diluted in a LiCl-KCl medium. With the aid of these spectroscopic tools, it was found that stable Eu(II) species was formed spontaneously at 723 K under anaerobic conditions. EPR and luminescence spectroscopy provided detailed information regarding the nature of the europium ion in a molten salt.

Energy Technology Data Exchange (ETDEWEB)

A carrier coprecipitation procedures has been developed for the removal of radioactive strontium from caustic liquid low-level waste (LLLW) generated at Oak Ridge National Laboratory. The two-step treatment process involves the addition of normal Sr (as SrCl{sub 2}) to the waste matrix, which is composed primarily of 0.3 M NaOH and 0.6 M Na{sub 2}CO{sub 3}. The active Sr equilibrates with the normal Sr carrier and coprecipitates as SrCO{sub 3} at pH 13. A liquid/solid separation is made before the pH of the supernate is reduced to pH 8 with sulfuric acid. During the neutralization step, the aluminum is the waste precipitates as Al(OH){sub 3}. Further Sr decontamination is achieved as traces of active Sr sorb to the Al(OH){sub 3} that precipitates during the neutralization step. A final liquid/solid separation is made at pH 8 to remove the ...

International Nuclear Information System (INIS)

An absorption method of elimination of liquid radioactive wastes (LRW) of low and intermediate activity level by decreasing their contamination up to the level permitting their discharge into the environment is proposed in the paper. The LRW decontamination is accompanied with efficient compacting the resulting secondary solid wastes. The method is based on the use of a new very efficient, chitin containing natural fiber bio-sorbent, Mycoton, which is manufactured commercially in Ukraine. The chemical composition of the sorbent and its highly developed surface provide practically unrestricted opportunities for producing its modifications having any necessary absorption and operational characteristics. The effects of pH, the presence of various salts and complexing agents, as well as of some other factors to the distribution coefficients of the most important radionuclides have been carefully studied in experiments with Mycoton and its modifications. It appeared, that the Mycoton based ...

International Nuclear Information System (INIS)

Eu-#alpha#-SiAlON (Eu_m_/_2Si_1_2_-_m_-_nAl_m_+_nO_nN_1_6_-_n) was synthesized with nominal compositions having small m and n values, by firing the powder mixture of Eu_2Si_5N_8, #alpha#-Si_3N_4, AlN, and Al_2O_3 at 1900 "oC for 6 h under 1 MPa nitrogen atmosphere. The ratio of the oxidation state of Eu"2"+/Eu"3"+ was estimated from the X-ray absorption fine structure (XAFS) measurement. The observed X-ray absorption near edge spectrum (XANES) showed that the Eu ion in Eu-#alpha#-SiAlON was mainly in divalent state but also coexisted with a small amount of Eu in the trivalent state. The crystal structure of Eu-#alpha#-SiAlON was refined by the Rietveld analysis of the X-ray powder diffraction patterns. The lattice constants of the samples increased with increasing m and n values. The excitation band ...

International Nuclear Information System (INIS)

Cross-sections for "8"4Sr(n, 2n)"8"3Sr, "8"6Sr(n, 2n)"8"5"mSr, "8"6Sr(n, 2n)"8"5Sr, "8"8Sr(n, 2n)"8"7"mSr, "8"4Sr(n, p)"8"4Rb, "8"6Sr(n, p)"8"6Rb, "8"8Sr(n, p)"8"8Rb and "8"8Sr(n, #alpha#)"8"5"mKr reactions have been measured at neutron energies from 13.5 to 14.6 MeV using activation technique and by means of #gamma#-ray spectrometry. The neutron flux was determined using the monitor reaction "9"3Nb(n, 2n)"9"2"mNb and the neutron energies were measured by the method of cross-section ratios for "9Zr(n, 2n)"8"9Zr to "9"3Nb (n, 2n)"9"2"mNb reactions. The results of present work are compared with data published previously.

International Nuclear Information System (INIS)

German 2009 [1 p.] Germany Steigies, Christian IEAP, Christian-

Energy Technology Data Exchange (ETDEWEB)

The experimental results of the components substitution effect on crystal structure, electronic transport properties, and Eu effective valence in solid solutions based on EuCu{sub 2}Si{sub 2} and EuPd{sub 2}Si{sub 2} ternary compounds are presented. It is shown, that when the Eu effective valence reaches the critical value {nu}{sup cr}{sub eff}=2.1, corresponding to degeneration of the 4f{sup 7} and 4f{sup 6} configurations, the condition of the concentrated Kondo system and an essential perturbation of the band electron spectrum near the Fermi level occur. (orig.).

Energy Technology Data Exchange (ETDEWEB)

The unknown parities of five strong dipole states between 6 and 8 MeV in /sup 88/Sr are shown to be negative.

International Nuclear Information System (INIS)

Published in summary form only. 6 Refs.

International Nuclear Information System (INIS)

The solid solutions Eu(Ir_1_-_xPd_x)_2Si_2, which exist for 0#<=#x#<=#0.125 and 0.75#<=#x#<=#1, cristallize with the tetragonal ThCr_2Si_2-type structure. The variation of the europium valence with composition has been thoroughly studied at temperatures 4.2#<=#T#<=#293 K by "1"5"1Eu Moessbauer resonance. For 0#<=#x#<=#0.125 the europium valence at room temperature decreases as x increases. For 0.75#<=#x#<=#1 the valence transition temperature Eu"3"+#->#Eu"2"+ increases as x increases. (orig.).

Science.gov (United States)

A mass spectrometric determination was made of the Sr/sup 88/ and Sr/sup 90/ yieldd from Pu/sup 239/ irradiated by an integral flux of 2.7 x 10/sup 20/ nvt of slow neutrons. (R.V.J.)

International Nuclear Information System (INIS)

... beta spectrometers decay energy-level transitions k conversion l conversion

KoreaScience (Korea)

Full Text Available

Science.gov (United States)

... []`ZV\\]`YYYZLQSWWZVafb_SR]VFSV]JJ]_XSXUTXYPV\\VLVUQKX\\\\XMRV\\Z\\ XLJRUVPRXSTLIOTY\\\\ QIZVYXOTQTXT_YVYYZTPONTSTRNTYWSQNQQPPQLSQMPPPIFIMKKPNCHKFEACDINLFEBIKD? ...

Energy Technology Data Exchange (ETDEWEB)

No abstract prepared.

UK PubMed Central (United Kingdom)

Store-operated Ca²⁺ entry (SOCE) is a ubiquitous Ca²⁺ influx pathway involved in control of multiple cellular and physiological processes including cell proliferation. Recent evidence...Full Text Available

Energy Technology Data Exchange (ETDEWEB)

As part of our effort to develop a semicontinuous PuO/sub 2/ reduction process, we are investigating promising materials for containing a 900/sup 0/C molten CaCl/sub 2/ . CaO chlorination reaction. We want the material to contain this reaction and to be reusable. We tested candidate materials in a simulated salt (no plutonium) using anhydrous HCl as the chlorinating agent. Data are presented on the performance of 36 metals and alloys, 9 ceramics, and 3 coatings.

International Nuclear Information System (INIS)

A simple and rapid method is described for the determination of major and trace elements in rock and sediment samples by wavelength dispersive XRF. Sample measured were made from cellulose powder pressed into 4 cm diameter aluminium ring 0.4 t cm"-"2, and then 1 g of powdered sample (0.08 g cm"-"2) was placed on the disk and repressed at 1.6 t cm"-"2. X-ray measurements were performed for total XRF intensity (I_p) at the characteristic line of each element and background intensity (I_b) in vicinity of the line. The correction of matrix effect was achieved by X-ray intensity ratio of peak to background for each element. Eight standard rock samples from Geological Survey of Japan were used as standard materials, and linear calibration curves were obtained by the plot of I_p - I_b vs. concentration for Ca, Na and Pb and by the plot of I_p/I_b ratio vs. concentration for Si, Fe, Ti, K, P, Cl, Cr, Mn, Ni, Cu, Zn, Pb, Sr and Ba, respectively. The ...

International Nuclear Information System (INIS)

The research performed during this reporting period (9/1/84 to 8/31/85) resulted in: (1) publication of three papers; (2) presentation of an invited paper to the conference on ''Neutron-Nucleus Collisions: A Probe of Nuclear Structure''; (3) presentation of three contributed papers at APS meetings; and (4) preparation of three manuscripts, two of which are in the process of internal review at the Oak Ridge National Laboratory and are included with this report, and the third is being typed as this report is being written. The publications and papers deal with topics in both nuclear structure and astrophysics. Our efforts to study the systematic behavior of the optical model potential in the energy region just above neutron binding has been made substantially more reliable with the publication of a paper which discusses the accuracy of the methods used to average the measured scattering matrix. In the area of stellar nucleosynthesis, comparison of our model calculations and measured ...

International Nuclear Information System (INIS)

We have investigated the growth behaviors of high temperature compatible ZrO_2 insulation coatings on Ag and AgMg sheathed Bi_2Sr_2Ca_1Cu_2O_x superconducting tapes depending on number of dipping and thermal conditions. The coatings were fabricated on long-length superconducting tape substrates using a solution derived from Zr tetrabutoxide, solvent and chelating agent for high magnetic field magnets. The layer-on-layer growth behaviors were characterized by environmental scanning electron microscope (ESEM), energy dispersive spectroscopy (EDS), X-ray maps and X-ray diffraction (XRD). This research showed that the ZrO_2 coatings were regularly grown on Ag-based tape substrates and coating thickness increased with increasing number of dipping. It was found that ceramic oxides formed at temperature range 450 and 550 deg. C. The final coating thickness changed between 6 and 8 #mu#m after annealing process. Resistance of insulation measured from ...

Energy Technology Data Exchange (ETDEWEB)

Proton induced X-ray and {gamma}-ray emission (PIXE/PIGE) have been used to analyze major and trace elements in a suite of 140 core samples from around of the Jim`s Find South gold anomaly in the Tanami desert, located in heavily weathered terrain. Simultaneous analyses were obtained for 30 elements, ranging in atomic number from {sup 3}Li to {sup 90}Th. The method was chosen because of its speed and the wide range of determination, its flexibility, precision and low detection limits. The regolith powder samples were treated by hot aqua regia before making them into pills. The PIXE/PIGE data of the acid insoluble residue give three factor analysis clusters. The first cluster comprises the elements F, Al, K, V, Mn, Fe, Ga, Rb, W and Au and is essentially related to sericitic wallrock alteration. The second cluster consists of Ti, As, Y, Zr, and Nb and is largely related to resistant minerals. The third cluster consists of Na, Ca and Sr and is ...

Science.gov (United States)

... Grant support: National Cancer Institute Center grant CA 16087 and National Cancer Institute grant CA091892, Department of Defense grant ...

International Nuclear Information System (INIS)

The DC magnetic susceptibility of the REBa_2F_7 compounds was measured by a SQUID magnetometer in the temperature range 5-300 K. Except for Eu, the other compounds show either Curie law or Curie-Weiss law with relatively small values of paramagnetic Curie temperature, #theta#_p, with effective magnetic moments in the range expected of electronic ground state of the trivalent rare earth ion with appropriate J value. The behaviour of Eu is complex. (orig.).

Energy Technology Data Exchange (ETDEWEB)

Instrumental neutron activation analysis (INAA) followed by gamma-ray spectrometry was used to determine the concentrations of As, Ca, Co, Cr, Cu, Eu, Fe, K, La, Mg, Mn, Mo, Na, Pr, Sb, Se, Th, U, V and Z, in 82 leaf samples belonging to two cultivars of pigeonpea (Cajanus cajan (L.) Millsp). Pigeonpea, an easy cultivation legume species, probably originated from Africa and adapted to brazilian conditions, is a very promising and unconventional source of food, mainly to the grain production intended for human feeding, and that even can be used in flour products. It is an excellent proteic supplement for ruminants, due to its large potential of forage production and its high nutritive value, or in addition it can be used in the recuperation of exhausting soils either by means of its utilization as green manure or by taking free Nitrogen from the atmosphere to produce nitrates which can be utilized by the plants. However, in spite of the several ...

Energy Technology Data Exchange (ETDEWEB)

The g factors of the 2/sub 1//sup +/ states in sup(84,86,88)Sr have been deduced using the thin-foil transient field technique with the field calibration of the Rutgers group. The values are g(/sup 84/Sr)= + 0.419(47), g(/sup 86/Sr)= + 0.273(50) and g(/sup 88/Sr)= + 1.15(17). The mean lifetimes of the 2/sub 1//sup +/ states in sup(86,88)Sr were determined by the Doppler-shift attenuation method to be 2.10(22) ps and 0.219(23) ps respectively. The g factor and lifetime results are compared with shell model and interacting boson model predictions.

International Nuclear Information System (INIS)

An overview on neutron scattering studies of ferromagnetic and antiferromagnetic all-semiconductor superlattices is presented. Diffraction experiments on MnTe/CdTe, MnTe/ZnTe and EuTe/PbTe superlattices show pronounced correlations between the MnTe and EuTe layers across the non-magnetic spaces, even though these layers are antiferromagnetic and the systems are nearly-insulating. Current theory status of these systems is discussed. Diffractometry and reflectometry data from EuS/PbS superlattices reveal pronounced antiferromagnetic coupling between the ferromagnetic EuS block. First polarized neutron reflectometry data from superlattices prepared of a novel ferromagnetic 'spintronics' material, Ga(Mn)As are also presented. (author)

International Nuclear Information System (INIS)

Europium (Eu) ions-doped titanate nanowires were synthesized via a sol-gel-hydrothermal chemistry and they were found to be roll multilayered trititanate-type nanowires intercalated with Eu3+ and alkali ions. The average diameter was about 20 nm for nanowires synthesized in NaOH solution and about 10 nm for nanowires synthesized in KOH solution. Under ultraviolet excitation the nanowires showed bright red emission corresponding to 5D0-7Fj of Eu3+ ions at room temperature, which was attributed to the non-radiative energy transfer from the surrounding Ti-O octahedral nanosheets to the central Eu3+ ions in interlayer. The luminescent properties of nanowires were influenced by the type of co-intercalated alkali ions, doping degree, hydrothermal and annealing temperatures. The intensity ratio of 5D0-7F2 to 5D0-7F1 of titanate nanowires intercalated with Eu3+ and Na+ ions was higher than ...

DEFF Research Database (Denmark)

Udgivelsesdato: 2002-May

International Nuclear Information System (INIS)

(1974). United States Lingafelter, JW Nuclear Services Corp., Campbell, CA

UK PubMed Central (United Kingdom)

The presynaptic Ca²⁺ signal, which triggers vesicle release, disperses to a broadly distributed residual [Ca²⁺] ([Ca²⁺]_res) that plays an important...Full Text Available

International Nuclear Information System (INIS)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2"+_1 level in "8"8Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The angular #gamma##gamma#-correlations for nuclei of Sr even-even isotopes with a=8 82, 84, 86, 88 were measured. Multipole structurs of #gamma#-transtion series and th coefficients multipole mixing were determined.

Energy Technology Data Exchange (ETDEWEB)

An application of the renormalized random phase approximation to nuclear structure is presented for the semi-magic nuclei /sup 88/Sr and /sup 90/Zr. It is reported the outcome for the microscopic approach in comparison with the semiphenomenological version for the particle-hole forces.

International Nuclear Information System (INIS)

We have measured the K-shell ionization probability Psub(K) across the isobaric analog resonances in the elastic channel of the reactions "8"8Sr(p, p_0)"8"8Sr at 5.06 MeV and "8"6Sr(p, p_0)"8"6Sr at 6.02 MeV. The dependence of Psub(K) on the beam energy for two scattering angles 90"0 and 155"0 is analysed in the framework of the theory developed by Anholt et al. taking into account the effect of compound-nucleus scattering. A compound elastic cross section (dsigma/d#OMEGA#)sub(CE)=40+-10 mb/se at the peak of the resonance is deduced in the reaction "8"8Sr+p at 5.06 MeV, while the experimental results agree with a negligible value of (dsigma/d#OMEGA#)sub(CE) for the resonance in "8"6Sr+p at 6.02 MeV. (orig.).

Energy Technology Data Exchange (ETDEWEB)

To examine the hormonal regulation of the ATP-dependent Ca{sup 2+} pump in the kidneys, the ATP-dependent Ca{sup 2+} uptake by the basolateral membrane vesicles in the renal cortex was measured using radioactive calcium ({sup 45}Ca{sup 2+}) in rats with vitamin D deficiency or rats undergoing thyroparathyroidectomy. The V{sub max} of the Ca{sup 2+} pump activity was increased not only by administering calcitriol, but also by normalizing the serum calcium level in vitamin D-deficient rats. PTH suppressed the Ca{sup 2+} pump activity in normocalcemic vitamin D-deficient rats. Thyroparathyroidectomy did not affect the Ca{sup 2+} pump activity in the kidneys of normal rats. It was concluded that the ATP-dependent Ca{sup 2+} pump activity was depressed by secondary hyperparathyroidism in vitamin D-deficient rats. (author).

International Nuclear Information System (INIS)

... de-excitation excited states gamma radiation inelastic scattering mev range

KoreaScience (Korea)

Full Text Available

International Nuclear Information System (INIS)

(1980). United States Panhuise, VE Bull, SR Seydel, JA Univ of Missouri-

International Nuclear Information System (INIS)

... mixing coupled channel theory differential cross sections excited states helium

International Nuclear Information System (INIS)

... range 01-10 nuclei photons radiation sources recoils resonance scattering

International Nuclear Information System (INIS)

... excitation experimental data gamma radiation mev range 01-10 parity

Energy Technology Data Exchange (ETDEWEB)

In vivo effects of toxaphene on calcium pump activity in rat brain synaptosomes was studied. Male Sprague-Dawley rats were dosed with toxaphene at 0,25,50, and 100 mg/kg/day for 3 days and sacrificed 24 h after last dose. Ca/sup 2 +/-ATPase activity and /sup 45/Ca uptake were determined in brain P/sub 2/ fraction. Toxaphene inhibited both Ca/sup 2 +/-ATPase activity and /sup 45/Ca/sup 2 +/ uptake and the inhibition was dose dependent. Both substrate and Ca/sup 2 +/ activation kinetics of Ca/sup 2 +/-ATPase indicated non-competitive type of inhibition as evidenced by decreased catalytic velocity but not enzyme-substrate affinity. The inhibited Ca/sup 2 +/-ATPase activity and Ca/sup 2 +/ uptake were restored to normal level by exogenously added calmodulin which increased both velocity and affinity. The inhibition of ...

Science.gov (United States)

The role of intracellular Ca2+ (Ca2+i) on hematopoiesis was investigated in long term bone marrow cultures using cytokines and agonists of P2 receptors. Cytokines interleukin 3 and granulocyte/macrophage colony stimulator factor promoted a modest increase in Ca2+i concentration ([Ca2+]i) with activation of phospholipase Cgamma, MEK1/2, and Ca2+/calmodulin kinase II. Involvement of protein kinase C was restricted to stimulation with interleukin 3. In addition, these cytokines promoted proliferation (20 times) and an increase in the Gr-1(-)Mac-1+ population with participation of gap junctions (GJ). Nevertheless ATP, ADP, and UTP promoted a large increase in [Ca2+]i, moderate proliferation (6 times), a reduction in the primitive Gr-1(-)Mac-1(-)c-Kit+ population, and differentiation into macrophages without participation of GJ. It is likely that ...

Science.gov (United States)

Insect host/parasitoid interactions are co-evolved systems in which host defenses are balanced by parasitoid mechanisms to disable or hide from host immune effectors. Although there is a rich literature on these systems, parasitoid immune-disabling mechanisms have not been fully elucidated. Here we report on a newly discovered immune-disabling mechanism in the Pieris rapae/Pteromalus puparum host/parasitoid system. Because venom injections and parasitization suppresses host phagocytosis, we turned attention to the P. rapae scavenger receptor (Pr-SR), posing the hypothesis that P. puparum venom suppresses expression of the host Pr-SR gene. To test our hypothesis, we cloned a full-length cDNA of the Pr-SR. Multiple sequences alignment showed the deduced amino acid sequence of Pr-SR is similar to scavenger receptors of other lepidopterans. Bacterial and bead injections induced Pr-SR ...

International Nuclear Information System (INIS)

The mechanism for afterglow suppression in codoped CsI:Tl,Eu reported in the preceding paper was investigated by combined radioluminescence and thermoluminescence experiments. Model rate equations informed by these experiments were employed to simulate afterglow. It was found that codoping with europium introduces deep electron traps, with room-temperature glow peaks, that effectively scavenge the electrons from shallow traps associated with thallium, thus suppressing afterglow in the time domain of tens of milliseconds.

Wastenet

... The final strand is to invest in new infrastructure, supporting the growth of small and medium-sized businesses and developing new productive industries like pharmaceuticals, locomotive engineering and plastics. Having acted as an adviser to the government, I can see several reasons why the EU should welcome and support this model of economic development. The most important is that Kazakhstan's diversification and its determination to move production up the ...

Wastenet

...relevant international NGO networks Lobby for sufficient support in EU institutions for developing EU legislation on IAS Provide input into the debate about the wilderness concept at the Wilderness Conference under the Czech Presidency National level press work on Art. 17 composite report and Natura 2000 management CEEweb Natura 2000 Working Group meetings Develop a CEEweb proposal on how to discuss and ensure the appropriate management of Natura 2000 sites on ...

International Nuclear Information System (INIS)

Optically stimulated luminescence (OSL) and thermoluminescence are observed in polycrystalline RbMgF3:Eu2+ after x-ray, ?-ray, or ? irradiation. The main electron traps are F-centers but there are other unidentified traps. The main hole traps at room temperature are probably Eu3+ and thermal or optical stimulation leads to electron-hole recombination at the Eu3+ site and Eu2+ emissions arising from 6PJ to 8S7/2 and 4f5d(Eg) to 8S7/2 transitions. We find that some of the electron traps can be emptied by infrared stimulation and all of the electron traps can be emptied by white light stimulation. The OSL dark decay is long and exceeds 5 days for traps that are emptied by white light stimulation after initial infrared bleaching. Our results show that this compound can be used as a radiation dosimeter for intermediate dose levels where the 87Rb self-dose does not significantly affect the dose reading.

Energy Technology Data Exchange (ETDEWEB)

Cyclic voltammetry (CV), scanning electron microscopy (SEM), and energy dispersive spectroscopy (EDS) were employed to investigate the electrodeposition of Eu and Al in an LiCl-KCl eutectic melt containing Eu{sup 2+} and Al{sup 3+} at 450 deg. C. In order to deposit a pure Eu and Al alloy, the stoichiometrically lower concentration of Al{sup 3+} than that of Eu{sup 2+} and Al wires as a counter electrode was introduced into the bath of LiCl-KCl melt for the electrodeposition. The electrodeposition takes place at a potential more negative than -1.95 V vs. Ag|Ag{sup +} while the deposit is oxidized at more positive potential than -1.92 V. Two new reduction peaks and an anodic peak on a W working electrode were observed at -2.39 V, -2.42 V, and -2.1 V, vs. Ag|Ag{sup +}, respectively, suggesting that the potential window of the Al system in LiCl-KCl melt can be extended to -2.43 V vs. Ag|Ag{sup +}. The EDS ...

Energy Technology Data Exchange (ETDEWEB)

A method was developed in which the potential of various measures is assessed systematically with a view to meeting the future EU5 emission specifications. Varied boundary conditions are taken into account, and their influence on the PM-NOx tradeoff was investigated. The relative cost is compared to an existing EU4 injection system. It was attempted to apply these measures to the impending US regulations (Tier2 Bin5) and to offer an outlook to EU6. The result shows that it is possible in principle for a car of the 1600 kg class to reduce NOx emissions while maintaining the EU4-PM emission standards.In the case of envisaged serial application subject to emission standards like US Tier 2 and EU6, much work is still required in terms of system robustness and life. In higher-class vehicles, the NOx reduction potential is lower, and it will be more difficult to make do without NOx ...

International Nuclear Information System (INIS)

Analysis of Sr-90 in milk and tap water has been conducted in New York City since 1954. The milk sample analyzed is a monthly composite of pasteurized milk purchased daily at retail stores. The monthly Sr-90 to calcium ratios for New York City since the inception of the sampling progam in 1954 through 1981 are tabulated. Samples of New York City tap water are taken daily so that by the end of the month, approximately 100 liters have been collected. Data on Sr-90 since the inception of the program are presented. The available Cs-137 data expressed as the Cs-137 to Sr-90 ratio are given. A graphical presentation of the New York City Sr-90 data is also shown.

Science.gov (United States)

The /sup 86,88/Sr(d, /sup 3/He)/sup 85,87/Rb reactions were studied at energy of 28 MeV and angular distributions were obtained for all observed states. Spectroseopic factors were extracted from distorted-wave Born-approximation calculations of the cross sections. These spectroacopic factors, and those from the /sup 86,88/Sr(/sup 3/He, d)/sup 87,89/ Y reactions, mixing in the ground state of /sup 88/Sr is inferred. The two g/sub (9/2) neutro n ton orbital populations in /sup 86/Sr. (auth)

International Nuclear Information System (INIS)

A procedure is described for the isolation and determination of "9"0Sr, "2"2"6Ra, "2"2"8Ra and "2"1"0Pb in food. These nuclides are highly radiotoxic, above all for babies and children. Samples are dry ashed, alkali metals are removed as carbonates. Separation from other matrix ions and separation of Ra, Sr and Pb can be achieved with a column of Sr-Spec, an immobilized crown ether. For activity measurements membrane filters with SrSO_4, Ba(Ra)SO_4 and PbS are prepared. Ra is determined by gamma-spectrometry, "9"0Sr and "2"1"0Pb are determined by low-level-betacounting. The determination limits are 10 mBq/kg for "9"0Sr and "2"1"0Pb and 50 mBq/kg for "2"2"6Ra and "2"2"8Ra. The procedure is useful for all kinds of foodstuff. (orig.).

International Nuclear Information System (INIS)

1 - Description: Format: MATXS. Number of groups: 80 neutron-, 24 photon-groups. 97 Nuclides: 1-H-1, 1-H-2, 2-He-3, 2-He-4, 3-Li-6, 3-Li-7, 4-Be-9, 5-B-10, 5-B-11, 6-C- nat., 7-N-14, 7-N-15, 8-O-16, 9-F-19, 11-Na-23, 12-Mg-nat., 13-Al-27, 14-Si-nat., 15-P-31, 17-Cl-nat., 18-Ar-40, 19-K-nat., 20-Ca-nat., 22-Ti-nat., 23-V-nat., 24-Cr-50, 24-Cr-52, 24-Cr-53, 24-Cr-54, 25-Mn-25, 26-Fe-54, 26-Fe-56, 26-Fe-57, 26-Fe-58, 27-Co-59, 28-Ni-58, 28-Ni-60, 28-Ni-61, 28-Ni-62, 28-Ni-64, 29-Cu-nat., 31-Ga-nat., 39-Y-89, 40-Zr-nat., 41-Nb-93, 42-Mo-nat., 47-Ag-107, 47-Ag-109, 48-Cd-nat., 50-Sn-nat., 63-Eu-151, 63-Eu-153, 64-Gd-152, 64-Gd-154, 64-Gd-155, 64-Gd-156, 64-Gd-157, 64-Gd-158, 64-Gd-160, 73-Ta-181, 74-W-182, 74-W-183, 74-W-184, 74-W-186, 75-Re-185, 75-Re-187, 79-Au-197, 82-Pb-nat., 83-Bi-209, 90-Th-232, 91-Pa-233, 92-U-232, 92-U-233, 92-U-234, 92-U-235, 92-U-236, 92-U-237, 92-U-238, 93-Np-237, 93-Np-238, 94-Pu-238, 94-Pu-239, ...

International Nuclear Information System (INIS)

Y2Te4O11:Eu3+ and Y2Te5O13:Eu3+ single crystals in sub-millimeter scale were synthesized from the binary oxides (Y2O3, Eu2O3 and TeO2) using CsCl as fluxing agent. Crystallographic structures of the undoped yttrium oxotellurates(IV) Y2Te4O11 and Y2Te5O13 have been determined and refined from single-crystal X-ray diffraction data. In Y2Te4O11, a layered structure is present where the reticulated sheets consisting of edge-sharing [YO8]13- polyhedra are interconnected by the oxotellurate(IV) units, whereas in Y2Te5O13 only double chains of condensed yttrium-oxygen polyhedra with coordination numbers of 7 and 8 are left, now linked in two crystallographic directions by the oxotellurate(IV) entities. The Eu3+ luminescence spectra and the decay time from different energy levels of the doped compounds were investigated and all detected emission levels were identified. Luminescence properties of the ...

International Nuclear Information System (INIS)

Eu"3"+ and Tb"3"+ complexes with novel branched calix[4]arene ligands incorporating 2,2' -bipyridine subunits functionalized in the 6- or 5,5'-positions have been synthesized and their photophysical properties investigated. High luminescence intensity was obtained for the Eu"3"+ complex of the calix[4]arene ligand carrying four 5,5' -substituted- 2,2' -bipyridines, which has high molar extinction coefficients (#epsilon#_m_a_x 39 600 M"-"1 cm"-"1) and a high luminescence quantum yield (15%). (authors). 12 refs., 2 figs., 1 tab.

Energy Technology Data Exchange (ETDEWEB)

The paper demonstrates that the photocatalytic activity of TiO{sub 2} towards the decomposition of gaseous benzene in a batch reactor can be greatly improved by loading TiO{sub 2} on the surface of Sr{sub 2}CeO{sub 4}. The research investigates the optimum loading amount of TiO{sub 2} on Sr{sub 2}CeO{sub 4} in enhancing the photocatalytic activity of TiO{sub 2}. The prepared photocatalyst was characterized by XRD, UV-vis diffuse reflectance and XPS analyses. TiO{sub 2} is loaded on Sr{sub 2}CeO{sub 4} at 773 K. TiO{sub 2}/Sr{sub 2}CeO{sub 4} absorbs much more visible light than TiO{sub 2}. The XPS spectrum shows that there are Ti, O, C, Sr elements on the surface of the TiO{sub 2}/Sr{sub 2}CeO{sub 4}, and that the binding energy value of Ti2p transfers to a lower value. TiO{sub 2}/Sr{sub 2}CeO{sub 4} demonstrates 2.0 times the photocatalytic ...

International Nuclear Information System (INIS)

A lysimeter approach (under natural climatologic conditions) was used to evaluate the effect of four metal immobilizing soil treatments [compost (C), compost + cyclonic ashes (C + CA), compost + cyclonic ashes + steel shots (C + CA + SS)) and cyclonic ashes + steel shots (CA + SS)] on metal leaching through an industrially contaminated soil. All treatments decreased Zn and Cd leaching. Strongest reductions occurred after CA + SS and C + CA + SS treatments (Zn: -99.0% and -99.2% respectively; Cd: -97.2% and -98.3% respectively). Copper and Pb leaching increased after C (17 and >30 times for Cu and Pb respectively) and C + CA treatment (4.4 and >3.7 times for Cu and Pb respectively). C + CA + SS or CA + SS addition did not increase Cu leaching; the effect on Pb leaching was not completely clear. Our results ...

UK PubMed Central (United Kingdom)

1. Digital imaging and photometry were used in conjunction with the fluorescent Ca2+ indicator, Fura-2, to examine intracellular Ca2+ signals produced by depolarization of single adrenal chromaffin...Full Text Available

KoreaScience (Korea)

Full Text Available

KoreaScience (Korea)

Full Text Available

UK PubMed Central (United Kingdom)

SUMMARYWe recorded Ca²⁺ current and intracellular Ca²⁺ ([Ca²⁺]_i) in isolated adult rat dorsal root ganglion (DRG) neurons at 20 and...Full Text Available

International Nuclear Information System (INIS)

The first-principles energetics of the constituent elements Ca and Mg and the Mg_2Ca C14 laves phase (C14) in the Ca-Mg binary system were used in the computational thermodynamic modeling, with models for the Gibbs energy of individual phases. C14 was modeled as (Ca,Mg)_2(Ca,Mg)_1 with four end-members. The first-principles calculations were performed using two computer codes: (i) WIEN2K based on the full-potential linearized augmented plane-wave (FLAPW) method and (ii) VASP based on the pseudo-potentials and a plane wave basis set. The total energies of the pure Ca and Mg in the fcc, bcc, and hcp structures, three laves phase structures of Mg_2Ca, and the four end-members of C14 were calculated at 0 K. The enthalpies of formation of the four end-members were obtained accordingly and used as input data in evaluating the Gibbs energy ...

Energy Technology Data Exchange (ETDEWEB)

We obtained the ratios of {sup 134}Cs/{sup 137}Cs and {sup 154}Eu/{sup 137}Cs in spent PWR fuels with gamma scanning equipment of irradiated material examination facility. The fuel segments, of which the burn-up is about 40 GWD/MTU and its cooling time is 8.4 years, are prepared in Post Irradiated Examination Facility and transported to IMEF. By considering of multi-peaks of {sup 134}Cs and {sup 154}Eu, we obtained the relative efficiency of the gamma scanning system as a function of energy. And finally we obtained the number ratios of radioactive nuclides in 72 fuel pellets, radioactive {sup 134}Cs/{sup 137}Cs and {sup 154}Eu/{sup 137}Cs. (author). 4 refs., 27 tabs., 28 figs.

Wastenet

...challenges faced by the industrial sector by implementing a Research Agenda for Embedded Computing Systems. The Artemis JU will manage and co-ordinate open ...5 billion research programme on Embedded Computing Systems. The programme is open to organisations within the EU Member States as well as Associated ...

International Nuclear Information System (INIS)

Synthesis of Eu-doped #beta#- and 15R-SiAlONs was studied by the ammonia nitridation of precursors derived from an #alpha#-Si_3N_4 fine powder dispersed in aluminum glycine gel with various Si/Al ratio and post-annealing in a nitrogen pressure furnace. The largest amount of #beta#-SiAlON was observed in the product at 1750 deg. C for Si/Al = 1/1 with small amounts of both #alpha#- and 15R-SiAlON impurities. The product showed two emissions at around 420 nm and 560 nm. The emission intensities decreased with increasing amount of #beta#-SiAlON. The former and latter emissions were assigned to Eu"2"+ in the 15R- and #alpha#-SiAlONs impurities. A mixture of Eu-doped 15R-SiAlON with #alpha#-Al_2O_3 impurity was obtained for Si/Al = 1/6, using AlN together with Al(NO_3)_3.9H_2O in a 2/1 atomic ratio as the aluminum source. It showed a bluish-white emission at 450 nm under 254 nm radiation.

International Nuclear Information System (INIS)

Full text. This research assesses models for new nuclear build in European Union (EU) member states to find the most stable form. The countries examined in this study are the United Kingdom and Romania. The results attest that due to various historical, political, competition, and electricity market structural conditions Romania and the United Kingdom have emerged with different models for new build nuclear projects. This paper begins with an assessment of the effects on the nuclear sector from energy, environmental and competition legislation in the EU. Then the political and economic climate of the aforementioned EU member states is completed. Following this an overview of the market structure of the electricity sector in those respective countries is conducted. Then the key research on the models and the phases of new nuclear build are explored. The research concludes each model has transcended from different political ...

Energy Technology Data Exchange (ETDEWEB)

Cyclopropane isomerization to propylene over various Eu[sup 3+] loadings in NaX zeolite have been studied by measurements of steady-state and transient kinetics and by Fourier transform infrared spectroscopy. As Eu[sup 3+] loading increases, the rate of deactivation increases, the conversion increases, apparent activation energies are lowered, and Bronsted acid site strength and amounts increase. Apparent activation energies of 13-15 kcal/mol for propylene formation have been observed for these systems, consistent with literature reports for other metal supported heterogeneous catalyst systems. Deactivation studies have shown that activity can be restored by heating in He at 380[degrees]C between various temperature runs, and that gases desorbed during regeneration are predominantly propylene. Poisoning studies of Bronsted sites with Na vapor lead to deactivation of these catalysts. A reaction mechanism scheme based on [pi] allyl intermediates ...

International Nuclear Information System (INIS)

The "8"6Kr("3He,n)"8"8Sr and "8"8Sr("3He,n)"9"0Zr reactions were studied to determine whether significant excited 0"+ strength was observed or whether these nuclei exhibited absence of excited state strength generally seen away from shell closures. Various properties of the levels are considered including angular distributions, spins, parities, interference, and enhancement. It is concluded that neither "8"8Sr nor "9"0Zr exhibit the strong proton pairing vibration expected for a closed proton shell nucleus.

International Nuclear Information System (INIS)

The results are presented of a study in radioactivity of forage (grass, alfalfa, clover), cereals (wheat, oats, rye, barley) and different agriculture products (fodder beet, sugar beet, leguminous plants, poppy, tobacco, maize, potatoes). Total beta activity, "4"0K, "9"0Sr and "1"3"7Cs activities were studied for the period 1962 to 1975 in selected localities in Slovakia. The highest values of "9"0Sr and "1"3"7Cs were measured in 1963, the lowest levels of "9"0Sr in 1975 while the lowest levels of "1"3"7Cs in 1973. (B.S.).

International Nuclear Information System (INIS)

This paper summarises the main results obtained so far in the frame of the EU Home Team test programme of ITER primary wall small scale mock ups. It describes briefly the fabrication method of the mock ups, the test conditions and the main results obtained with high heat flux and thermal fatigue tests of Cu alloy/stainless steel and beryllium/Cu alloy/stainless steel mock ups. The results obtained so far show good thermal fatigue performance and operation margin of the ITER primary first wall concept. (author)

International Nuclear Information System (INIS)

This paper presents the main achievements of the European Home Team (EU HT) test programme of ITER primary wall small scale mock ups. It describes briefly the fabrication method of the mock ups, the test conditions and the main results obtained with high heat flux and thermal fatigue tests of Cu alloy/stainless steel and beryllium/Cu alloy/stainless steel mock ups. The results obtained so far show very good thermal fatigue performance and operation margin of the ITER primary first wall concept.

Wastenet

...Fransman - University of Edinburgh Patents: The next battleground for climate change - 07 May 2008 - Alison Brimelow - European Patents Office (EPO) Rethinking the EU budget - 23 Apr 2008 - Daniel Gros - Centre for European Policy Studies (CEPS) US needs a 'Science White House' - 23 Apr 2008 - David Baltimore - American Association for the Advancement of Science Addressing consumer concerns about climate change - 14 Apr 2008 - Various Authors - McKinsey Why the internal market needs ...

Science.gov (United States)

... stwrvy}prpgup sbjmqnunrnktq mqhng}vuutmkojmvrsltqllttprcmkhflhikjlhx }msxvtv wxusu{xmrv}t~rwqymx{ylsptyhxvx sr}~z~u}uzvw^mdqu lt|wvyqvtllox} jlopl~ tplr ...

International Nuclear Information System (INIS)

Full text: The surface properties of poly (tetrafluoroethylene) (PTFE) are changed by the exposure to synchrotron radiation (SR). We succeeded in controlling the wettability of the PTFE surface from hydrophobic to hydrophilic by varying the substrate temperature during the SR irradiation and found that the wettability was ascribable to microstructure and chemical composition of surface.In these previous works, oxygen atoms were found to inhabit on the hydrophobic surface of PTFE. In this study, we investigated the surface modification of PTFE from the SR exposure experiment under the O_2 gas atmosphere. The SR exposure to the PTFE sheet was carried out at beamline 6 (BL6) of the New- SUBARU. The PTFE sheet was irradiated to the white beam, ranging 50-1000 eV at BL6 at room temperature. The gas cell was mounted at the irradiation chamber. The O_2 gas pressure in the gas cell can be maintained at about ...

International Nuclear Information System (INIS)

... 900526-11-8 277 p. MATERIALS SCIENCE antiferromagnetic materials cerium

British Library Electronic Table of Contents (United Kingdom)

ABSTRACT Aim The study aimed to test simultaneously our understanding of the effects of bupropion sustained-release (SR) treatment on putative mediators and our understanding of determinants of post-quit abstinence, including withdrawal distress, cigarette craving, positive affect and subjective reactions to cigarettes smoked during a lapse. The specificity of bupropion SR effects was also tested in exploratory analyses. Design Data from a randomized, placebo-controlled clinical trial of bupropion SR were submitted to mediation analyses. Setting Center for Tobacco Research and Intervention, Madison, WI, USA. Participants A total of 403 adult, daily smokers without contraindications to bupropion SR use. Intervention Participants were assigned randomly to receive a 9-week course of bupropion...

International Nuclear Information System (INIS)

... excited states inelastic scattering mev range 10-100 mev range 100-1000

International Nuclear Information System (INIS)

... minutes living radioisotopes nuclear reactions nuclei nucleons odd-odd nuclei

International Nuclear Information System (INIS)

... functions intermediate structure isobaric analogs level widths mev range

International Nuclear Information System (INIS)

The resonant scattering of bremsstrahlung #gamma#-rays by a SrCO_3 target has been studied for #gamma#-ray energies of 5-11 MeV. Six #gamma#-transitions of energies between 6-8 MeV, which indicate six resonant states in "8"8Sr, were observed. The relative intensities of the resonantly scattered #gamma#-rays at 125 and 150"0 were found to be compatible only with the assignment of spin 1 to the six states. Radiative widths of the resonant states were deduced. The possibility that these states are components of the giant M1 resonance in "8"8Sr is discussed. (orig.).

International Nuclear Information System (INIS)

Rb-Sr phlogopite age determinations, interpreted as emplacement ages, are reported for 15 southern African kimberlites. Jagersfontein and Rietfontein (85 and 95 Ma) have ages typical of the majority of well-known Cretaceous kimberlites, whereas somewhat older ages of about 118 to 125 Ma have been obtained for localities in the Postmasburg, Barkly West and Boshoff districts. Previous zircon ages of 90Ma for Finsch and Roberts Victor are believed to be incorrect. Two other localities in the Barkly West area have significantly younger emplacement ages of about 114 Ma relative to most Barkly West occurrences. Two off-craton kimberlites, Uintjiesberg and Mzongwana, are 100 and 150 Ma in age respectively. Swartruggens and Elandskloof have ages of 150-160 and 165 Ma respectively. A Barkly West occurrence, Klipfontein, also has an apparent age of 160 Ma, but this result cannot be considered reliable. The emplacement ages and initial ...

Energy Technology Data Exchange (ETDEWEB)

This guide is one of the actions following from the recommendations of the Thermie B project that aimed to support the development of a new European Integrated Clean Coal (CCT) Program concept (STR - 1121 - 96), November 1998. The concept aimed to enhance the market deployment of EU CCTs. This guide is prepared for EU industry to help them finding support for their CCT exports to the target markets. The guide will include easy accessible information on the most relevant EC-programs and is intended as a practical tool for EU CCT industry, to assist them in identifying and selecting the export support and programs best able to support their specific export assistance. The guide is a manual (signpost) through the 'jungle of assistance' and therefore does not include extensive information on application procedures, since this kind of information can be easily obtained, once the relevant program is identified. ...

Science.gov (United States)

Using bremsstrahlung, the resonance fluorescence yield has been measured for the 1.836-MeV 2/sup +//sub 1/ level in /sup 88/Sr. The observed yield corresponds to a level width GAMMA = 2.94 +- 0.15 meV.

International Nuclear Information System (INIS)

The results of photoneutron spectra measurements for the reaction (#gamma#,n) on the Sr-88 nuclei near threshold are presented. The parameters of resonance levels, as well as radiative S_#gamma#"("1") and neutron S_n"("1") strength functions for transitions on the first excited level of Sr-87 were obtained. 2 refs.; 1 fig.; 1 tab.

International Nuclear Information System (INIS)

Over the recent years the nuclear structure around the N = 50 shell closure, which is very pronounced in the strontium and zirconium isotopes, has been the subject of extensive experimental and theoretical work. On the proton side Z = 38 and Z = 40 provide fairly closed sub-shells. In the strontium isotopes the lg/sub 9/2/ neutron shell is closed at "8"8Sr, supplying relatively pure neutron-hole and neutron-particle states with large spectroscopic factors in "8"7Sr and "8"9Sr, as well as core-coupled states. The mass region is thus ideally suited to examine the transition from a correlated to an uncorrelated (chaotic?) excitational behavior. These two types are characterized e.g. by the density of excited states, the transition strengths, and the spectroscopic factors observed in transfer reactions. We conducted (n,#gamma#) and (d,p) reactions leading to /sup 87,88,89/Sr in addition to ...

Energy Technology Data Exchange (ETDEWEB)

The authors study the general features of the dimensional reduction scheme for multi-dimensional spaces of the type M/sup 4/ x S/R, S/R being a symmetric coset space. The properties of the scalar potentials of the reduced theories are investigated and an effective method of explicit calculation of these potentials is elaborated. They consider also a wide class of embeddings of Lie subalgebras into simple Lie algebras resulting in reduced theories of physical interest.

International Nuclear Information System (INIS)

As a result of the accident at the Chernobyl Power Plant the larger part of Belarus turned out to be polluted by radionuclides. At present isotopes of Cs, Sr and Pu, characterized by long half-lives are most dangerous for the health of the population of the polluted territories. The aim of the present work was to characterize plant species with high "1"3"7Cs and "9"0Sr accumulation ability and to determine the dependence of the accumulation on the treatment with biologically active substances. (author)

Energy Technology Data Exchange (ETDEWEB)

The constancy in excitation energy of the lowest 2/sup +/ state in the Sr isotopes across the N=56 subshell closure is shown to result from a reduction in the 2psub(1/2)-2psub(3/2) proton spin-orbit splitting as the 2dsub(5/2) neutron orbital is filled.

International Nuclear Information System (INIS)

The electron scattering form factor for excitation of the 1"+ state of "8"8Sr at 3.486 MeV has been calculated in the quasiparticle random phase approximation (QRPA). The disagreement between the data and restricted shell-model calculations can be explained in terms of the pairing correlations introduced by the QRPA; no #DELTA#-h admixtures are required. (orig.).

British Library Electronic Table of Contents (United Kingdom)

We study the influence of Sr substitutions on the structural counterpart of the MI transition of Formula Not Shown . When Sr content increases, the commensurate CDW modulation of pure Formula Not Shown is changed into an incommensurate short range modulation that we attribute to a charge ordering of the Formula Not Shown electrons. The same features are observed in S deficient samples.

Energy Technology Data Exchange (ETDEWEB)

The gamma-ray spectrum following neutron capture on /sup 87/Sr was measured at 3 neutron energies: E/sub n/ = thermal, 2 keV, and 24 keV. Gamma rays were detected in a three-crystal Ge(Li)-NaI-NaI pair spectrometer. Gamma-ray intensities deduced from these spectra by spectral unfolding are presented.

International Nuclear Information System (INIS)

Radionuclide X-ray fluorescence method with Si/Li semiconductor detector and "2"3"8Pu exciting source was used for the determination of Cu, Ni, Zn and Pb in plant samples (Taraxacum officinale) from various localities near the highway D-61 Bratislava-Trnava (SR). (author) 2 refs.; 1 fig.; 1 tab.

Science.gov (United States)

Electrically triggered action potentials in the giant alga Chara corallina are associated with a transient rise in the concentration of free Ca(2)+ in the cytoplasm (Ca(2)+(cyt)). The present measurements of Ca(2)+(cyt) during membrane excitation show that stimulating pulses of low magnitude (subthreshold pulse) had no perceivable effect on Ca(2)+(cyt). When the strength of a pulse exceeded a narrow threshold (suprathreshold pulse) it evoked the full extent of the Ca(2)+(cyt) elevation. This suggests an all-or-none mechanism for Ca(2)+ mobilization. A transient calcium rise could also be induced by one subthreshold pulse if it was after another subthreshold pulse of the same kind after a suitable interval, i.e., not closer than a few 100 ms and not longer than a few seconds. This dependency of Ca(2)+ mobilization on single and double pulses ...

Energy Technology Data Exchange (ETDEWEB)

The low excitation energy spectroscopy of /sup 86/Sr, /sup 88/Sr, /sup 89/Sr, /sup 86/Rb, and /sup 87/Rb nuclear systems was studied via one-nucleon transfer reactions. The strontium isotopes, /sup 87/Sr and /sup 88/Sr, were used as targets in this study. Spectroscopic strengths were extracted from the measured transfer reaction cross sections and the distorted wave Born approximation (DWBA) analysis. Efforts have been made to accomplish a complete detection of spectroscopic strengths through the excitation energy region where levels can be resolved and identified. A shell model sum rule analysis is then made. Diagonal matrix elements for the effective two-nucleon interaction were deduced from empirical energy centroid. Matrix elements normalized by their empirical monopole energy was plotted against the semiclassical angle between two spins. They were compared with various ...

Energy Technology Data Exchange (ETDEWEB)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature. 38 refs.

Science.gov (United States)

The neutron capture cross sections of Sr-88 and Y-89 were measured in a quasi-stellar neutron spectrum for kT = 25 keV via the activation method. Relevant systematic uncertainties were determined experimentally by repeated activations under different conditions and with different samples. Gold was used as a cross section standard. The resulting stellar cross sections for kT = 30 keV are 6.13 + or - 0.18 mbarn for Sr-88 and 19.0 + or - 0.6 mbarn for Y-89. The partial cross section Sr-86(n, gamma) Sr-87m was measured to 48.1 + or - 1.2 mbarn. Compared to previous data, the associated uncertainties are reduced by factors of 3 and 5, respectively. The implications for s-process nucleosynthesis around magic neutron number N = 50 are discussed in the light of new information on neutron density and temperature.

Energy Technology Data Exchange (ETDEWEB)

We have observed a threshold in the electron photodetachment cross section of {sup 88}Sr{sup {minus}} ions at a photon energy {ital h}{nu}=1.820 eV and assign it to a {ital p}-wave transition from the 5{ital s}{sup 2}5{ital p}{sup 2}{ital P} ground state in Sr{sup {minus}} to the 5{ital s}5{ital p}{sup 3}{ital P} state in neutral Sr. The measurement was made with a new technique combining the tunable laser photodetachment threshold method with accelerator mass spectrometry. We determine for the first time the electron affinity of Sr to be 48{plus_minus}6 meV, much smaller than predicted in recent calculations. The {sup 2}{ital P}{sub 1/2}-{sup 2}{ital P}{sub 3/2} fine splitting of the Sr{sup {minus}} ground state is estimated to be 26{plus_minus}8 meV.

Energy Technology Data Exchange (ETDEWEB)

In this paper we discuss the results of thermoluminescence (TL) studies carried out on freshly quenched crystals of KBr doped with {approx} 50 ppm of Eu{sup 2+} ions which were X-irradiated at room temperature. The TL glow curve of this phosphor material consists of three glow peaks at 355, 376 and 398 K whose intensities increased as a function of X-irradiation time. The TL glow peaks were analyzed by the total curve-fitting method in order to obtain the characteristic parameters; activation energy, pre-exponential factor and kinetic order. The spectral character of the emission recorded during thermoluminescence was found to be the same for all glow peaks and consists of a broad band centered at {approx} 420 nm. It is proposed that the model of the TL process most consistent with our experimental results is one in which the Eu{sup 2+} impurity acts as an electron trap during the irradiation process and that the radiation induced center ...

International Nuclear Information System (INIS)

Thin films (1-10 ?m thickness) of nanocomposites (NC) based on organic coordinated compound (OCC) Eu(TTA)2(Ph3PO)2NO3 (where TTA is thenoyl trifluoroacetonate (C8H5F3O2S), Ph3PO - triphenylphosphine (C6H5PO) and polymer-polyvinylpyrrolidone ((C6H9NO)n) (PVP)) were obtained by chemical methods and with different molar ratios into organic polymer matrix. NC have been characterized by measurements of optical transmission, excitation spectra of photoluminescence (PL) and photoluminescence of NC at different concentrations of Eu(TTA)2(Ph3PO)2NO3 in NC. In the optical transmission of NC, the characteristic parameters of NC such as threshold absorbance, dependence on the concentration of the organic coordinated compound in NC, etc., have been determined The displacement of threshold absorption to infrared is observed with increasing of the concentration of the coordination material in NC. The excitation spectrum of photoluminescence of NC led the ...

International Nuclear Information System (INIS)

Nitrogen-rich Ca-#alpha#-sialon ceramics, prepared with CaH_2 as one of the starting powders, were compressively deformed in spark plasma sintering equipment. Compared with the oxygen-rich Ca-#alpha#-sialons, increasing onset deformation temperatures (about 150 K higher) were observed for nitrogen-rich Ca-#alpha#-sialons deformed at a rate of 2 x 10"-"3 s"-"1. High hardness (H_V_1_0 = 18-20 GPa) and toughness (K_I_C = 4-7 MPa m"1"/"2) were maintained after the deformation. Anisotropic grain growth was found to take place during deformation, resulting in anisotropic microstructures, containing coarse and elongated grains. The observed differences in deformation behaviour and properties between nitrogen-rich and oxygen-rich Ca-#alpha#-sialons are, as indicated by transmission electron microscopy and electron energy loss spectroscopy analysis, attributed to the presence of reduced ...

Energy Technology Data Exchange (ETDEWEB)

The isomeric and {beta}-decay properties of neutron-rich {sup 53-57}Sc and {sup 53,54}Ca nuclei near neutron number N = 32 are reported, and the low-energy level schemes of {sup 53,54,56}Sc and {sup 53-57}Ti are presented. The low-energy level structures of the {sub 21}Sc isotopes are discussed in terms of the coupling of the valence 1f{sub 7/2} proton to states in the corresponding {sub 20}Ca cores. Implications with respect to the robustness of the N = 32 subshell closure are discussed, as well as the repercussions for a possible N = 34 subshell closure.

International Nuclear Information System (INIS)

The isomeric and ?-decay properties of neutron-rich 53-57Sc and 53,54Ca nuclei near neutron number N=32 are reported, and the low-energy level schemes of 53,54,56Sc and 53-57Ti are presented. The low-energy level structures of the 21Sc isotopes are discussed in terms of the coupling of the valence 1f7/2 proton to states in the corresponding 20Ca cores. Implications with respect to the robustness of the N=32 subshell closure are discussed, as well as the repercussions for a possible N=34 subshell closure.

International Nuclear Information System (INIS)

1984. p. I37. Germany Antonov, AN Christov, CV Petkov, IZ Bylgarska

British Library Electronic Table of Contents (United Kingdom)

The Huqf Supergroup of the Sultanate of Oman provides important information on the geological evolution of the Arabian?Persian Gulf region during a protracted period of continental dispersal and reassembly on the periphery of the Gondwanan supercontinent during the Neoproterozoic, and also provides important constraints on the nature of extreme climate swings during this critical period in the evolution of Earth's biosphere. The Huqf Supergroup spans the period ca. 725?540?Ma, and is composed of three groups. The Abu Mahara Group (ca. 725 to ca.ca. 547?540?Ma), which is known mostly from the subsurface, comprises carbonates, evaporites and organic-rich shales, with interbedded ashes, deposited in a large number of N?S trending troughs and platforms.The three groups of the Huqf Supergroup c...

Science.gov (United States)

Calcium-activated chloride channels (CaCCs) are widely expressed in mammalian tissues, including intestinal epithelia, where they facilitate fluid secretion. Potent, selective CaCC inhibitors have not been available. We established a high-throughput screen for identification of inhibitors of a human intestinal CaCC based on inhibition of ATP/carbachol-stimulated iodide influx in HT-29 cells after lentiviral infection with the yellow fluorescent halide-sensing protein YFP-H148Q/I152L. Screening of 50,000 diverse, drug-like compounds yielded six classes of putative CaCC inhibitors, two of which, 3-acyl-2-aminothiophenes and 5-aryl-2-aminothiazoles, inhibited by >95% iodide influx in HT-29 cells in response to multiple calcium-elevating agonists, including thapsigargin, without inhibition of calcium elevation, calcium-calmodulin kinase II activation, or cystic fibrosis transmembrane conductance ...

Science.gov (United States)

... 60637 BIO-ORGAN U of Chicago/IL U of Michigan Ash, Marcus Alan 19C Escondido Village , Stanford CA ...

Science.gov (United States)

... DV Holliday BAE SYSTEMS Applied Technologies, IES/ITS Analysis and Applied Research 4545A Viewridge Avenue San Diego, CA 92123 phone ...

British Library Electronic Table of Contents (United Kingdom)

This study examined whether elevated intravascular pressure stimulates asynchronous Ca2+ waves in cerebral arterial smooth muscle cells and if their generation contributes to myogenic tone development. The endothelium was removed from rat cerebral arteries, which were then mounted in an arteriograph, pressurized (20 100 mmHg) and examined under a variety of experimental conditions. Diameter and membrane potential (VM) were monitored using conventional techniques; Ca2+ wave generation and myosin light chain (MLC20)/MYPT1 (myosin phosphatase targeting subunit) phosphorylation were assessed by confocal microscopy and Western blot analysis, respectively. Elevating intravascular pressure increased the proportion of smooth muscle cells firing asynchronous Ca2+ waves as well as event frequency. C...

Science.gov (United States)

May 1, 2011 ... Abstract: Diatek Corporation, San Diego, CA and the Jet Propulsion Lab developed the Diatek Model 7000 aural thermometer which weighs ...

International Nuclear Information System (INIS)

The role of dietary calcium and phosphorus in modifying the intestinal absorption of lead and also the effect of lead ingestion on the metabolism of cholecalciferol were studied in chicks. The efficiency of absorption of "2"0"3Pb and "4"7Ca was increased when the animals were fed a low calcium diet and treated with cholecalciferol. The synthesis of the vitamin D-induced calcium-binding protein (CaBP) was correspondingly increased. When the chicks were depleted of vitamin D and repleted with 1,25-dihydroxycholecalciferol [1,25(OH)_2D_3] as their only source of the vitamin, the absorption of both "4"7Ca and "2"0"3Pb was unaffected by dietary calcium levels, and no change in CaBP levels occurred. Low dietary intake of phosphorus resulted in an increase in "4"7Ca and "2"0"3Pb absorption and in CaBP synthesis when the animals were treated with cholecalciferol. ...

Science.gov (United States)

Wildlife Refuge, CA Rare and endangered endemic plants Diana Anderson Northern Arizona University Geomorphology Kathryn Thomas USGS, Flagstaff, AZ Vegetation dynamics John...

Science.gov (United States)

... E. Liu, D. Soucy and J. Baughn GenCorp Aerojet, POBox 13222 Sacramento, CA 95813 J. Luoma BAE Systems Elk River, MN 55330 ABSTRACT ...

Science.gov (United States)

Two additional earthquakes, magnitudes 6.6 and 6.7 occurred the next morning. The first earthquake was located six miles north of Petrolia, California, ...

International Nuclear Information System (INIS)

The European Union (EU) market integration is leading to increasingly monopolistic electricity market infrastructures, which has opened a debate on the regulation of these so-called power exchanges. In this paper, we start by stating that there are two types of power exchanges in Europe, i.e. 'merchant' and 'cost-of-service regulated' power exchanges. We then discuss how regulation can be used to better align their incentives with the main power exchange tasks. We conclude that adopting the cost-of-service regulated model for all power exchanges in Europe could be counterproductive in the current context, but that regulation can help ensure that the benefits of the EU market integration materialize. Promising regulatory actions include tempering the reinforced market power of power exchanges, and quality-of-service regulation for the ongoing cooperation among power exchanges to organize trade across borders. - Research highlights: #-># ...

International Nuclear Information System (INIS)

Scanning spreading resistance microscopy (SSRM) has been applied to study focused ion beam (FIB) induced damage in silicon in dependence on ion irradiation doses from 10"1"2 cm"-"2 to 2#centre dot#10"1"6 cm"-"2. Starting from the lowest dose, SSRM detects increasing spreading resistance (SR) with increasing dose. For doses from 2#centre dot#10"1"3 cm"-"2 to 4#centre dot#10"1"4 cm"-"2, a slight decrease of SR is measured whereas for higher doses SR again slightly increases. The results are explained by physical effects like decreased carrier mobility due to increased scattering, amorphisation of silicon and precipitation of implanted Ga ions. The results clearly prove that SSRM is well suited for the fast detection of ion beam induced damage with high lateral resolution.

International Nuclear Information System (INIS)

Summary of cyclotron production methods of "2"3"7Pu (45,2 d), "8"8Y (106,65 d) and "8"5Sr (64,84 d) tracers via nuclear reactions with protons and alphas on "2"3"5U, "8"8Sr and "8"5Rb targets in wide energy range is given. Chemical methods of separation and purification of the tracers from the irradiated uranium, strontium and rubidium targets are described. The tracers were used for determination of Pu (239-240), Sr-90 and Am-241 in the samples (soil, plants, underground waters) from Semipalatinsk Test Site. Obtained results are discussed.

Science.gov (United States)

Because of its small cross section, the 88Sr(n,g) reaction is an important bottleneck during s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. We have completed the resonance analysis of our new and improved measurements of the neutron capture and total cross sections for 88Sr made at the Oak Ridge Electron Linear Accelerator (ORELA). We describe our experimental procedures and resonance analysis, compare our results to previous data, and discuss their astrophysical impact.

British Library Electronic Table of Contents (United Kingdom)

SR proteins are essential splicing factors whose function is controlled by multi-site phosphorylation of a C-terminal domain rich in arginine-serine repeats (RS domain). The protein kinase SRPK1 has been shown to polyphosphorylate the N-terminal portion of the RS domain (RS1) of the SR protein ASF/SF2, a modification that promotes nuclear entry of this splicing factor and engagement in splicing function. Later, dephosphorylation is required for maturation of the spliceosome and other RNA processing steps. While phosphates are attached to RS1 in a sequential manner by SRPK1, little is known about how they are removed. To investigate factors that control dephosphorylation, we monitored region-specific mapping of phosphorylation sites in ASF/SF2 as a function of the protein phosphatase PP1. W...

International Nuclear Information System (INIS)

A nuclear resonance fluorescence experiment on "8"8Sr has been performed with bremsstrahlung of 6.7 MeV endpoint energy. The #gamma#-ray linear polarisation has been measured with a EUROBALL CLUSTER detector used as a Compton polarimeter. The results indicate positive parity for the J=1 state at 4.742 MeV in "8"8Sr, in contrast to the previous interpretation as a 1"- two-phonon (2"+_1 x 3"-_1) state and in conflict with the predictions of the quasiparticle-phonon model. On the basis of such calculations the 1"+ state at 3.486 MeV may be considered as the 1"+_1 one-phonon state and the very strong 1"+_1#->#0"+_1 deexcitation as proton spin-flip 2p_1_/_2#->#2p_3_/_2 transition. (orig.)

International Nuclear Information System (INIS)

We have measured the isotope shifts of some dipole transitions between excited states of the even strontium isotopes 88 and 86 by applying the technique of Doppler-free intermodulated optogalvanic spectrocopy to a heat-pipe discharge. We were also able to investigate the isotope shift of the Sr II resonance line at 4216.6 A optogalvanically in the mentioned pair of isotopes. Because the 5 snf"1F_3 series appear to have zero level isotope shifts for n>=6, we can give residual level isotope shifts (RLIS) of several odd-parity states of sup(88,86) Sr I. The RLIS of the 5 snp "1P_1 series show pronounced configuration mixing around n=7. (orig.).

International Nuclear Information System (INIS)

This paper overviews the curricula of nuclear medicine (NM) undergraduate training in 34 Central and Eastern European (CEE) and 37 European Union (EU) medical faculties. The data show enormous variation in the number of hours devoted to nuclear medicine, varying between 1-2 to 40 hours and highly differentiated concepts/ideas of nuclear medicine training in particular countries. In most EU countries this teaching is integrated with that of radiology or clinical modules, also with training in clinical physiology. In many CEE countries teaching and testing of NM are independent, although integration with other teaching modules is frequent. The paper discusses the differences in particular approaches to nuclear medicine teaching. (author)

Energy Technology Data Exchange (ETDEWEB)

This task within the EU R and D for ITER was aimed at the development of basic manufacturing solutions for the high heat flux plasma facing components such as the divertor targets, the baffles and limiters. More than 50 representative small-scale mock-ups have been manufactured with beryllium, carbon and tungsten armour using various joining technologies. High heat flux testing of 20 of these mock-ups showed the carbon mono-blocks to be the most robust solution, surviving 2000 cycles at absorbed heat fluxes of up to 24 MW m{sup -2}. With flat armour tiles rapid joint failures occurred at 5-16 MW m{sup -2} depending on joining technology and armour material. These test results serve as a basis for the selection of manufacturing options and materials for the prototypes now being ordered. (orig.) 11 refs.

International Nuclear Information System (INIS)

The energy level schemes of "1"5"2Gd and "1"5"2Sm have been established on the basis of single #gamma#-spectra, and #gamma#-#gamma# coincidence measurements. Ge(Li) detectors were used to study the gamma spectra produced in the EC/#beta#"+ and #beta#"- decays of "1"5"2Eu to "1"5"2Sm and "1"5"2Gd, respectively. Thirteen new transitions are reported and data from eleven coincidence gates enabled five new levels to be suggested. Relative intensities and log ft values were calculated and spin/parities deduced. Comparisons are made with new predictions of the Interacting Boson Model. (orig.).

Energy Technology Data Exchange (ETDEWEB)

The high-temperature enthalpy increments of the phosphates La{sub 1/3}Zr{sub 2}(PO{sub 4}){sub 3}, Nd{sub 1/3}Zr{sub 2}(PO{sub 4}){sub 3}, Eu{sub 1/3}Zr{sub 2}(PO{sub 4}){sub 3} and Lu{sub 1/3}Zr{sub 2}(PO{sub 4}){sub 3} have been measured by high-temperature drop calorimetry in the temperature range 484.5-1090.7 K. From these results the heat capacity of the studied compounds has been derived.