BUC implementation in Slovakia
International Nuclear Information System (INIS)
Chrapciak, V.; Vaclav, J.
2009-01-01
Improved calculation methods allow one to take credit for the reactivity reduction associated with fuel burnup. This means reducing the analysis conservatism while maintaining an adequate criticality safety margin. Application of burnup credit (BUC) requires knowledge of the reactivity state of the irradiated fuel for which BUC is taken. The isotopic inventory and reactivity has to be calculated with validated codes. We use in Slovakia Gd 2 fuel with maximal enrichment of fuel pins 4.4%. Our transport and storage basket KZ-48 with boron steel is licensed for fresh fuel with enrichment 4.4%. In near future (2011 or 2012) we will use a new fuel with maximal enrichment of fuel pins 4.9%. For this fuel we plan to use existing KZ-48 with BUC application. In cooperation with Slovak Nuclear Regulatory Authority (UJD) we have started several years ago process of BUC implementation in Slovakia for VVER-440 reactors. We have already prepared methodology according IAEA methodology. We have validated computational systems (SCALE 5.1 already, SCALE 6 in progress). UJD will prepare regulation about BUC application in Slovakia. Last item is preparation of safety reports (for transport and storage) for the new fuel with average enrichment 4.87% in basket KZ-48 with BUC application.
Expressional and Biochemical Characterization of Rice Disease Resistance Gene Xa3/Xa26 Family
Institute of Scientific and Technical Information of China (English)
Songjie Xu; Yinglong Cao; Xianghua Li; Shiping Wang
2007-01-01
The rice (Oryza sativa L.) Xa3/Xa26 gene, conferring race-specific resistance to bacterial blight disease and encoding a leucine-rich repeat (LRR) receptor kinase-like protein, belongs to a multigene family consisting of tandem clustered homologous genes, colocalizing with several uncharacterized genes for resistance to bacterial blight or fungal blast. To provide more information on the expressional and biochemical characteristics of the Xa3/Xa26 family, we analyzed the family members. Four Xa3/Xa26 family members in the indica rice variety Teqing, which carries a bacterial blight resistance gene with a chromosomal location tightly linked to Xa3/Xa26, and five Xa3/Xa26 family members in the japonica rice variety Nipponbare, which carries at least one uncharacterized blast resistance gene, were constitutively expressed in leaf tissue. The result suggests that some of the family members may be candidates of these uncharacterized resistance genes. At least five putative N-glycosylation sites in the LRR domain of XA3/XA26 protein are not glycosylated. The XA3/XA26 and its family members MRKa and MRKc all possess the consensus sequences of paired cysteines, which putatively function in dimerization of the receptor proteins for signal transduction, immediately before the first LRR and immediately after the last LRR. However, no homo-dimer between the XA3/XA26 molecules or hetero-dimer between XA3/XA26 and MRKa or MRKc were formed, indicating that XA3/XA26 protein might function either as a monomer or a hetero-dimer formed with other protein outside of the XA3/XA26 family. These results provide valuable information for further extensive investigation into this multiple protein family.
XA readout chip characteristics and CdZnTe spectral measurements
International Nuclear Information System (INIS)
Barbier, L.M.; Birsa, F.; Odom, J.
1999-01-01
The authors report on the performance of a CdZnTe (CZT) array readout by an XA (X-ray imaging chip produced at the AMS foundry) application specific readout chip (ASIC). The array was designed and fabricated at NASA/Goddard Space Flight Center (GSFC) as a prototype for the Burst Arc-Second Imaging and Spectroscopy gamma-ray instrument. The XA ASIC was obtained from Integrated Detector and Electronics (IDE), in Norway. Performance characteristics and spectral data for 241 Am are presented both at room temperature and at -20 C. The measured noise (σ) was 2.5 keV at 60 keV at room temperature. This paper represents a progress report on work with the XA ASIC and CZT detectors. Work is continuing and in particular, larger arrays are planned for future NASA missions
Institute of Scientific and Technical Information of China (English)
Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang
2012-01-01
The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99% sequence identity and 94-99% sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.
International Nuclear Information System (INIS)
Boeheim, C.
1990-03-01
The Stanford Linear Accelerator Center has recently completed a conversion to IBM's VM/XA SP Release 2 operating system. The primary physics application had been constrained by the previous 16 megabyte memory limit. Work is underway to enable this application to exploit the new features of VM/XA. This paper presents a brief tutorial on how to convert an application to exploit VM/XA and discusses some of the SLAC experiences in doing so. 13 figs
Caddell, Daniel F; Park, Chang-Jin; Thomas, Nicholas C; Canlas, Patrick E; Ronald, Pamela C
2017-12-01
The rice immune receptor XA21 confers resistance to Xanthomonas oryzae pv. oryzae (Xoo), the causal agent of bacterial leaf blight. We previously demonstrated that an auxilin-like protein, XA21 BINDING PROTEIN 21 (XB21), positively regulates resistance to Xoo. To further investigate the function of XB21, we performed a yeast two-hybrid screen. We identified 22 unique XB21 interacting proteins, including LEUCINE-RICH REPEAT PROTEIN 1 (LRR1), which we selected for further analysis. Silencing of LRR1 in the XA21 genetic background (XA21-LRR1Ri) compromises resistance to Xoo compared with control XA21 plants. XA21-LRR1Ri plants have reduced Xa21 transcript levels and reduced expression of genes that serve as markers of XA21-mediated activation. Overexpression of LRR1 is insufficient to alter resistance to Xoo in rice lines lacking XA21. Taken together, our results indicate that LRR1 is required for wild-type Xa21 transcript expression and XA21-mediated immunity.
Ellur, Ranjith K; Khanna, Apurva; S, Gopala Krishnan; Bhowmick, Prolay K; Vinod, K K; Nagarajan, M; Mondal, Kalyan K; Singh, Nagendra K; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K
2016-07-11
Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India's forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region.
Ellur, Ranjith K.; Khanna, Apurva; S, Gopala Krishnan.; Bhowmick, Prolay K.; Vinod, K. K.; Nagarajan, M.; Mondal, Kalyan K.; Singh, Nagendra K.; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K.
2016-01-01
Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India’s forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region. PMID:27403778
Clinical Scenarios for Discordant Anti-Xa
Directory of Open Access Journals (Sweden)
Jesus Vera-Aguilera
2016-01-01
Full Text Available Anti-Xa test measures the activity of heparin against the activity of activated coagulation factor X; significant variability of anti-Xa levels in common clinical scenarios has been observed. Objective. To review the most common clinical settings in which anti-Xa results can be bias. Evidence Review. Guidelines and current literature search: we used PubMed, Medline, Embase, and MEDION, from 2000 to October 2013. Results. Anti-Xa test is widely used; however the assay underestimates heparin concentration in the presence of significant AT deficiency, pregnancy, end stage renal disease, and postthrombolysis and in patients with hyperbilirubinemia; limited published data evaluating the safety and effectiveness of anti-Xa assays for managing UH therapy is available. Conclusions and Relevance. To our knowledge this is the first paper that summarizes the most common causes in which this assay can be affected, several “day to day” clinical scenarios can modify the outcomes, and we concur that these rarely recognized scenarios can be affected by negative outcomes in the daily practice.
3.10/49 B. GERHARD VON RAD, Das ersfe BucA Mose, Xap. 1-12:9 ...
African Journals Online (AJOL)
Test
3.10/49. B. GERHARD VON RAD, Das ersfe BucA Mose, Xap. 1-12:9. Das Alte. Testament Deutsch, Neues Göttinger Bibelwerk, Nr. 2. Göttingen,. Vandenhoeck und Ruprecht, 1949, 136 bis. Prys 5.40 DM, geb. 7.90 DM. Met hierdie „Teilband" begin 'n besonder welkome verklaring van die Ou Testament in die Duitse taal, ...
Molecular screening of rice ( Oryza sativa L.) germplasm for Xa4 ...
African Journals Online (AJOL)
DNA fingerprinting results indicated the presence of Xa4 gene in 41 entries, while 14 lines were positive for xa5 gene. Only one local line was carrying Xa21 gene along with Xa4. Thus, the present study will not only be helpful for rice breeders to develop new rice varieties carrying disease resistant genes, but will also ...
Lange, L. H.
1974-01-01
Five different methods for determining the maximizing condition for x(a - x) are presented. Included is the ancient Greek version and a method attributed to Fermat. None of the proofs use calculus. (LS)
Activation of human factor V by factor Xa and thrombin
International Nuclear Information System (INIS)
Monkovic, D.D.; Tracy, P.B.
1990-01-01
The activation of human factor V by factor Xa and thrombin was studied by functional assessment of cofactor activity and sodium dodecyl sulfate-polycarylamide gel electrophoresis followed by either autoradiography of 125 I-labeled factor V activation products or Western blot analyses of unlabeled factor V activation products. Cofactor activity was measured by the ability of the factor V/Va peptides to support the activation of prothrombin. The factor Xa catalyzed cleavage of factor V was observed to be time, phospholipid, and calcium ion dependent, yielding a cofactor with activity equal to that of thrombin-activated factor V (factor Va). The cleavage pattern differed markedly from the one observed in the bovine system. The factor Xa activated factor V subunits expressing cofactor activity were isolated and found to consist of peptides of M r 220,000 and 105,000. Although thrombin cleaved the M r 220,000 peptide to yield peptides previously shown to be products of thrombin activation, cofactor activity did not increase. N-Terminal sequence analysis confirmed that both factor Xa and thrombin cleave factor V at the same bond to generate the M r 220,000 peptide. The factor Xa dependent functional assessment of 125 I-labeled factor V coupled with densitometric analyses of the cleavage products indicated that the cofactor activity of factor Xa activated factor V closely paralleled the appearance of the M r 220,000 peptide. The data indicate that factor Xa is as efficient an enzyme toward factor V as thrombin
Wang, Jun; Tian, Dongsheng; Gu, Keyu; Yang, Xiaobei; Wang, Lanlan; Zeng, Xuan; Yin, Zhongchao
2017-06-01
Bacterial blight of rice, caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive bacterial diseases throughout the major rice-growing regions in the world. The rice disease resistance (R) gene Xa10 confers race-specific disease resistance to X. oryzae pv. oryzae strains that deliver the corresponding transcription activator-like (TAL) effector AvrXa10. Upon bacterial infection, AvrXa10 binds specifically to the effector binding element in the promoter of the R gene and activates its expression. Xa10 encodes an executor R protein that triggers hypersensitive response and activates disease resistance. 'Nipponbare' rice carries two Xa10-like genes in its genome, of which one is the susceptible allele of the Xa23 gene, a Xa10-like TAL effector-dependent executor R gene isolated recently from 'CBB23' rice. However, the function of the two Xa10-like genes in disease resistance to X. oryzae pv. oryzae strains has not been investigated. Here, we designated the two Xa10-like genes as Xa10-Ni and Xa23-Ni and characterized their function for disease resistance to rice bacterial blight. Both Xa10-Ni and Xa23-Ni provided disease resistance to X. oryzae pv. oryzae strains that deliver the matching artificially designed TAL effectors (dTALE). Transgenic rice plants containing Xa10-Ni and Xa23-Ni under the Xa10 promoter provided specific disease resistance to X. oryzae pv. oryzae strains that deliver AvrXa10. Xa10-Ni and Xa23-Ni knock-out mutants abolished dTALE-dependent disease resistance to X. oryzae pv. oryzae. Heterologous expression of Xa10-Ni and Xa23-Ni in Nicotiana benthamiana triggered cell death. The 19-amino-acid residues at the N-terminal regions of XA10 or XA10-Ni are dispensable for their function in inducing cell death in N. benthamiana and the C-terminal regions of XA10, XA10-Ni, and XA23-Ni are interchangeable among each other without affecting their function. Like XA10, both XA10-Ni and XA23-Ni locate to the endoplasmic reticulum (ER) membrane
XA23 is an executor R protein and confers broad-spectrum disease resistance in rice.
Wang, Chunlian; Zhang, Xiaoping; Fan, Yinglun; Gao, Ying; Zhu, Qinlong; Zheng, Chongke; Qin, Tengfei; Li, Yanqiang; Che, Jinying; Zhang, Mingwei; Yang, Bing; Liu, Yaoguang; Zhao, Kaijun
2014-11-09
The majority of plant disease resistance (R) genes encode proteins that share common structural features. However, the transcription activator-like effector (TALE) associated executor type R genes show no considerable sequence homology to any known R genes. We adopted a map-based cloning approach and TALE-based technology to isolate and characterize Xa23, a new executor R gene derived from the wild rice (Oryza rufipogon) that confers an extremely broad spectrum of resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo). Xa23 encodes a 113-amino acid protein that shares 50% identity to the known executor R protein XA10. The predicted transmembrane helices in XA23 also overlap with those of XA10. Unlike Xa10, however, Xa23 transcription is specifically activated by AvrXa23, a TALE present in all examined Xoo field isolates. Moreover, the susceptible xa23 allele has an identical open reading frame of Xa23, but differs in promoter region by lacking the TALE binding-element (EBE) for AvrXa23. XA23 can trigger strong hypersensitive response in rice, tobacco and tomato. Our results provide the first evidence that plant genomes have an executor R gene family in which members execute their function and spectrum of disease resistance by recognizing the cognate TALEs in pathogen. © The Author 2014. Published by the Molecular Plant Shanghai Editorial Office in association with Oxford University Press on behalf of CSPB and IPPE, SIBS, CAS.
Theoretical calculation of shakeup intensities using Xa--SW wave functions
International Nuclear Information System (INIS)
Tse, J.S.; Loubriel, G.
1981-01-01
The ground and 1s core hole state molecular wave functions of CH 4 , NH 3 , H 2 O, and HF obtained from Xa--SW calculations using the touching spheres (TS) and overlapping spheres (OS) approximations are used to calculate the intensity of shakeup satellites observed in their ls core level photoelectron spectra. The sudden approximation was assumed in the calculation. In case of TS Xa--SW wave functions, the one electron overlap integral inside the intersphere was calculated via Green's theorem. For OS Xa--SW wave functions, the integration over the awkwardly shaped intersphere region was circumvented by distributing the intersphere charge into the atomic spheres according to the charge partition scheme suggested by Case and Karplus. Our results show that there are no significant differences between the shakeup energies calculated from the TS and OS approximations. However, shakeup intensities calculated from TS Xa--SW wave functions are more reliable and in better numerical agreement with experiment
International Nuclear Information System (INIS)
Blanc-Brude, Olivier P.; Archer, Fabienne; Leoni, Patricia; Derian, Claudia; Bolsover, Steven; Laurent, Geoffrey J.; Chambers, Rachel C.
2005-01-01
Fibroblast proliferation and procollagen production are central features of tissue repair and fibrosis. In addition to its role in blood clotting, the coagulation cascade proteinase thrombin can contribute to tissue repair by stimulating fibroblasts via proteolytic activation of proteinase-activated receptor-1 (PAR 1 ). During hemostasis, the coagulation cascade proteinase factor X is converted into factor Xa. We have previously shown that factor Xa upregulates fibroblast proliferation via production of autocrine PDGF. In this study, we further examined the effects of factor Xa on fibroblast function and aimed to identify its signaling receptor. We showed that factor Xa stimulates procollagen promoter activity and protein production by human and mouse fibroblasts. This effect was independent of PDGF and thrombin production, but dependent on factor Xa proteolytic activity. We also showed that PAR 1 -deficient mouse fibroblasts did not upregulate procollagen production, mobilize cytosolic calcium, or proliferate in response to factor Xa. Desensitization techniques and PAR 1 -specific agonists and inhibitors were used to demonstrate that PAR 1 mediates factor Xa signaling in human fibroblasts. This is the first report that factor Xa stimulates extracellular matrix production. In contrast with endothelial cells and vascular smooth muscle cells, fibroblasts appear to be the only cell type in which the effects of factor Xa are mediated mainly via PAR 1 and not PAR 2 . These findings are critical for our understanding of tissue repair and fibrotic mechanisms, and for the design of novel approaches to inhibit the profibrotic effects of the coagulation cascade without compromising blood hemostasis
Andexanet Alfa for Acute Major Bleeding Associated with Factor Xa Inhibitors
Connolly, Stuart J.; Milling, Truman J.; Eikelboom, John W.; Gibson, C. Michael; Curnutte, John T.; Gold, Alex; Bronson, Michele D.; Lu, Genmin; Conley, Pamela B.; Verhamme, Peter; Schmidt, Jeannot; Middeldorp, Saskia; Cohen, Alexander T.; Beyer-Westendorf, Jan; Albaladejo, Pierre; Lopez-Sendon, Jose; Goodman, Shelly; Leeds, Janet; Wiens, Brian L.; Siegal, Deborah M.; Zotova, Elena; Meeks, Brandi; Nakamya, Juliet; Lim, W. Ting; Crowther, Mark; Connolly, S. C.; Crowther, M.; Eikelboom, J.; Gibson, M.; Milling, T. J.; Albaladejo, P.; Cohen, A.; Lopez-Sendon, J.; Schmidt, J.; Verhamme, P.; Beyer-Westendorf, J.; Wyse, D. G.; Garcia, D.; Prins, M. [=Martin H.; Nakamya, J.; Büller, H. R.; Mahaffey, K.; Alexander, J.; Demchuk, A.; Raskob, G.; Schulman, S.; Meeks, B.; Zotova, E.; Holadyk-Gris, I.; Coppens, M.
2016-01-01
Background Andexanet alfa (andexanet) is a recombinant modified human factor Xa decoy protein that has been shown to reverse the inhibition of factor Xa in healthy volunteers. Methods In this multicenter, prospective, open-label, single-group study, we evaluated 67 patients who had acute major
Skugor, Adrijana; Tveiten, Helge; Johnsen, Hanne; Andersen, Øivind
2016-01-01
Background The primordial germ cells (PGCs) giving rise to gametes are determined by two different mechanisms in vertebrates. While the germ cell fate in mammals and salamanders is induced by zygotic signals, maternally delivered germ cell determinants specify the PGCs in birds, frogs and teleost fish. Assembly of the germ plasm in the oocyte is organized by the single Buc in zebrafish, named Velo1 in Xenopus, and by Oskar in Drosophila. Secondary loss of oskar in several insect lineages coin...
Thomas, Nicholas C; Oksenberg, Nir; Liu, Furong; Caddell, Daniel; Nalyvayko, Alina; Nguyen, Yen; Schwessinger, Benjamin; Ronald, Pamela C
2018-01-01
Rice ( Oryza sativa ) plants expressing the XA21 cell-surface receptor kinase are resistant to Xanthomonas oryzae pv. oryzae (Xoo) infection. We previously demonstrated that expressing a chimeric protein containing the ELONGATION FACTOR Tu RECEPTOR (EFR) ectodomain and the XA21 endodomain (EFR:XA21) in rice does not confer robust resistance to Xoo . To test if the XA21 ectodomain is required for Xoo resistance, we produced transgenic rice lines expressing a chimeric protein consisting of the XA21 ectodomain and EFR endodomain (XA21:EFR) and inoculated these lines with Xoo . We also tested if the XA21:EFR rice plants respond to a synthetic sulfated 21 amino acid derivative (RaxX21-sY) of the activator of XA21-mediated immunity, RaxX. We found that five independently transformed XA21:EFR rice lines displayed resistance to Xoo as measured by lesion length analysis, and showed that five lines share characteristic markers of the XA21 defense response (generation of reactive oxygen species and defense response gene expression) after treatment with RaxX21-sY. Our results indicate that expression of the XA21:EFR chimeric receptor in rice confers resistance to Xoo . These results suggest that the endodomain of the EFR and XA21 immune receptors are interchangeable and the XA21 ectodomain is the key determinant conferring robust resistance to Xoo .
Fine mapping of the rice bacterial blight resistance gene Xa-4 and its co-segregation marker
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
An F2 population developed from the Xa-4 near isogenic lines,IR24 and IRBB4,was used for fine mapping of the rice bacterial blight resistance gene,Xa-4.Some restriction fragment length polymorphism (RFLP) markers on the high-density map constructed by Harushima et al.and the amplified DNA fragments homologous to the conserved domains of plant disease resistance (R) genes were used to construct the genetic linkage map around the gene Xa-4 by scoring susceptible individuals in the population.Xa-4 was mapped between the RFLP marker G181 and the polymerase chain reaction (PCR) marker M55.The R gene homologous fragment marker RS13 was found co-segregating with Xa-4 by analyzing all the plants in the population.This result opened an approach to map-based cloning of this gene,and marker RS13 can be applied to molecular marker-assisted selection of Xa-4 in rice breeding programs.
Hammerstingl, Christoph; Omran, Heyder; Tripp, Christian; Poetzsch, Bernd
2009-02-01
Low-molecular-weight heparins (LMWH) are commonly used as peri-procedural bridging anticoagulants. The usefulness of measurement of anti-factor Xa activity (anti-Xa) to guide bridging therapy with LMWH is unknown. It was the objective of this study to determine levels of anti-Xa during standard bridging therapy with enoxaparin, and to examine predictors for residual anti-Xa. Consecutive patients receiving enoxaparin at a dosage of 1 mg/kg body weight/12 hours for temporary interruption of phenprocoumon were prospectively enrolled to the study. Blood-samples were obtained 14 hours after LMWH-application immediately pre- procedurally. Procedural details, clinical and demographic data were collected and subsequently analyzed. Seventy patients were included (age 75.2 +/- 10.8 years, Cr Cl 55.7 +/- 21.7ml/min, body mass index [BMI] 27.1 +/- 4.9). LMWH- therapy was for a mean of 4.2 +/- 1.6 days; overall anti-Xa was 0.58 +/- 0.32 U/ml. In 37 (52.8%) of patients anti-Xa was > or U/ml, including 10 (14.3%) patients with anti-Xa > 1U/ml. Linear regression analysis of single variables and logistic multivariable regression analysis failed to prove a correlation between anti-Xa and single or combined factors. No major bleeding, no thromboembolism and four (5.7%) minor haemorrhages were observed. When bridging OAC with therapeutic doses of enoxaparin a high percentage of patients undergo interventions with high residual anti-Xa. The levels of anti-Xa vary largely and are independent of single or combined clinical variables. Since the anti-Xa-related outcome of patients receiving bridging therapy with LMWH is not investigated, no firm recommendation on the usefulness of monitoring of anti-Xa can be given at this stage.
Xing, Junhao; Yang, Lingyun; Li, Hui; Li, Qing; Zhao, Leilei; Wang, Xinning; Zhang, Yuan; Zhou, Muxing; Zhou, Jinpei; Zhang, Huibin
2015-05-05
The coagulation enzyme factor Xa (fXa) plays a crucial role in the blood coagulation cascade. In this study, three-dimensional fragment based drug design (FBDD) combined with structure-based pharmacophore (SBP) model and structural consensus docking were employed to identify novel fXa inhibitors. After a multi-stage virtual screening (VS) workflow, two hit compounds 3780 and 319 having persistent high performance were identified. Then, these two hit compounds and several analogs were synthesized and screened for in-vitro inhibition of fXa. The experimental data showed that most of the designed compounds displayed significant in vitro potency against fXa. Among them, compound 9b displayed the greatest in vitro potency against fXa with the IC50 value of 23 nM and excellent selectivity versus thrombin (IC50 = 40 μM). Moreover, the prolongation of the prothrombin time (PT) was measured for compound 9b to evaluate its in vitro anticoagulant activity. As a result, compound 9b exhibited pronounced anticoagulant activity with the 2 × PT value of 8.7 μM. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Kathleen E Brummel-Ziedins
Full Text Available Factor (fXa is a critical enzyme in blood coagulation that is responsible for the initiation and propagation of thrombin generation. Previously we have shown that analysis of computationally generated thrombin profiles is a tool to investigate hemostasis in various populations. In this study, we evaluate the potential of computationally derived time courses of fXa generation as another approach for investigating thrombotic risk. Utilizing the case (n = 473 and control (n = 426 population from the Leiden Thrombophilia Study and each individual's plasma protein factor composition for fII, fV, fVII, fVIII, fIX, fX, antithrombin and tissue factor pathway inhibitor, tissue factor-initiated total active fXa generation was assessed using a mathematical model. FXa generation was evaluated by the area under the curve (AUC, the maximum rate (MaxR and level (MaxL and the time to reach these, TMaxR and TMaxL, respectively. FXa generation was analyzed in the entire populations and in defined subgroups (by sex, age, body mass index, oral contraceptive use. The maximum rates and levels of fXa generation occur over a 10- to 12- fold range in both cases and controls. This variation is larger than that observed with thrombin (3-6 fold in the same population. The greatest risk association was obtained using either MaxR or MaxL of fXa generation; with an ∼2.2 fold increased risk for individuals exceeding the 90(th percentile. This risk was similar to that of thrombin generation(MaxR OR 2.6. Grouping defined by oral contraceptive (OC use in the control population showed the biggest differences in fXa generation; a >60% increase in the MaxR upon OC use. FXa generation can distinguish between a subset of individuals characterized by overlapping thrombin generation profiles. Analysis of fXa generation is a phenotypic characteristic which may prove to be a more sensitive discriminator than thrombin generation among all individuals.
Foinard, A; Perez, M; Barthélémy, C; Lannoy, D; Flamein, F; Storme, L; Tournoys, A; Décaudin, B; Odou, P
2015-07-01
An in vitro study was carried out to determine the anti-Xa activity of heparin in binary parenteral nutrition (BPN) admixtures for premature neonates in our neonatal intensive care unit (NICU) after a 24-hour infusion, as well as to assess drug interaction with a 50% glucose solution. Two types of bags were prepared: (1) BPN admixtures (composition defined in the NICU) including sodium heparin at 77 UI/mL and (2) bags containing only G50% with sodium heparin at 193 UI/mL. The anti-Xa activity of heparin was measured in bags at T0, after the 24-hour infusion and in eluates at the outlet of the infusion line after 24hours, using a validated chromogenic anti-Xa method. Comparisons of the mean concentration observed with the theoretical value for anti-Xa activity were performed with the Student t-test. Mean values of anti-Xa activity do not differ significantly from the values expected for all conditions. We found a slight variation in anti-Xa activity when infused over 24hours for both types of bags, with and without in-line filtration, showing that heparin remains stable during this infusion period in both BPN admixtures and G50%. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3∶1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transformants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.
Institute of Scientific and Technical Information of China (English)
翟文学; 李晓兵; 田文忠; 周永力; 潘学彪; 曹守云; 赵显峰; 赵彬; 章琦; 朱立煌
2000-01-01
A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3 : 1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transfor-mants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.
Role of Factor Xa Inhibitors in Cancer-Associated Thrombosis: Any New Data?
Directory of Open Access Journals (Sweden)
Ali Zalpour
2011-01-01
Full Text Available The association between cancer and venous thromboembolism (VTE has been well documented in the literature. Prevention and treatment of VTE in cancer patients is imperative. Typically, the mainstay regimen for VTE prevention and treatment has been anticoagulation therapy, unless contraindicated. This therapy consists of unfractionated heparin (UFH, low-molecular-weight heparin (LMWH, factor Xa inhibitor, or vitamin K antagonist (VKA. Current guidelines recommend LMWH over VKA for the treatment of VTE in cancer patients. Factor-specific anticoagulants have been proven safe and effective, and recently factor Xa inhibitors have emerged as a treatment alternative to heparins and VKA. Currently, three factor Xa inhibitors have been identified: fondaparinux (the only one approved so far by the US Food and Drug Administration, idraparinux (in clinical trials, and idrabiotaparinux (in clinical trials. This paper will examine the role of these agents, focusing on fondaparinux, for the prevention and treatment of VTE in cancer patients.
3D/3D registration of coronary CTA and biplane XA reconstructions for improved image guidance
Energy Technology Data Exchange (ETDEWEB)
Dibildox, Gerardo, E-mail: g.dibildox@erasmusmc.nl; Baka, Nora; Walsum, Theo van [Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Punt, Mark; Aben, Jean-Paul [Pie Medical Imaging, 6227 AJ Maastricht (Netherlands); Schultz, Carl [Department of Cardiology, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Niessen, Wiro [Quantitative Imaging Group, Faculty of Applied Sciences, Delft University of Technology, 2628 CJ Delft, The Netherlands and Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands)
2014-09-15
Purpose: The authors aim to improve image guidance during percutaneous coronary interventions of chronic total occlusions (CTO) by providing information obtained from computed tomography angiography (CTA) to the cardiac interventionist. To this end, the authors investigate a method to register a 3D CTA model to biplane reconstructions. Methods: The authors developed a method for registering preoperative coronary CTA with intraoperative biplane x-ray angiography (XA) images via 3D models of the coronary arteries. The models are extracted from the CTA and biplane XA images, and are temporally aligned based on CTA reconstruction phase and XA ECG signals. Rigid spatial alignment is achieved with a robust probabilistic point set registration approach using Gaussian mixture models (GMMs). This approach is extended by including orientation in the Gaussian mixtures and by weighting bifurcation points. The method is evaluated on retrospectively acquired coronary CTA datasets of 23 CTO patients for which biplane XA images are available. Results: The Gaussian mixture model approach achieved a median registration accuracy of 1.7 mm. The extended GMM approach including orientation was not significantly different (P > 0.1) but did improve robustness with regards to the initialization of the 3D models. Conclusions: The authors demonstrated that the GMM approach can effectively be applied to register CTA to biplane XA images for the purpose of improving image guidance in percutaneous coronary interventions.
Sieg, Adam; Mardis, B Andrew; Mardis, Caitlin R; Huber, Michelle R; New, James P; Meadows, Holly B; Cook, Jennifer L; Toole, J Matthew; Uber, Walter E
2015-01-01
Because of the complexities associated with anticoagulation in temporary percutaneous ventricular assist device (pVAD) recipients, a lack of standardization exists in their management. This retrospective analysis evaluates current anticoagulation practices at a single center with the aim of identifying an optimal anticoagulation strategy and protocol. Patients were divided into two cohorts based on pVAD implanted (CentriMag (Thoratec; Pleasanton, CA) / TandemHeart (CardiacAssist; Pittsburgh, PA) or Impella (Abiomed, Danvers, MA)), with each group individually analyzed for bleeding and thrombotic complications. Patients in the CentriMag/TandemHeart cohort were subdivided based on the anticoagulation monitoring strategy (activated partial thromboplastin time (aPTT) or antifactor Xa unfractionated heparin (anti-Xa) values). In the CentriMag/TandemHeart cohort, there were five patients with anticoagulation titrated based on anti-Xa values; one patient developed a device thrombosis and a major bleed, whereas another patient experienced major bleeding. Eight patients received an Impella pVAD. Seven total major bleeds in three patients and no thrombotic events were detected. Based on distinct differences between the devices, anti-Xa values, and outcomes, two protocols were created to guide anticoagulation adjustments. However, anticoagulation in patients who require pVAD support is complex with constantly evolving anticoagulation goals. The ideal level of anticoagulation should be individually determined using several coagulation laboratory parameters in concert with hemodynamic changes in the patient's clinical status, the device, and the device cannulation.
Identification of bacterial blight resistance genes Xa4 in Pakistani ...
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... Bacterial blight (BB) caused by Xanthomonas oryzae pv oryzae (Xoo) is a major biotic constraint in the irrigated rice belts. Genetic resistance is the most effective and economical control for bacterial blight. Molecular survey was conducted to identify the rice germplasm/lines for the presence of Xa4, a.
Tariq, Rezwan; Wang, Chunlian; Qin, Tengfei; Xu, Feifei; Tang, Yongchao; Gao, Ying; Ji, Zhiyuan; Zhao, Kaijun
2018-03-02
Bacterial blight, caused by Xanthomonas oryzae pv. oryzae ( Xoo ), is an overwhelming disease in rice-growing regions worldwide. Our previous studies revealed that the executor R gene Xa23 confers broad-spectrum disease resistance to all naturally occurring biotypes of Xoo . In this study, comparative transcriptomic profiling of two near-isogenic lines (NILs), CBB23 (harboring Xa23 ) and JG30 (without Xa23 ), before and after infection of the Xoo strain, PXO99 A , was done by RNA sequencing, to identify genes associated with the resistance. After high throughput sequencing, 1645 differentially expressed genes (DEGs) were identified between CBB23 and JG30 at different time points. Gene Ontlogy (GO) analysis categorized the DEGs into biological process, molecular function, and cellular component. KEGG analysis categorized the DEGs into different pathways, and phenylpropanoid biosynthesis was the most prominent pathway, followed by biosynthesis of plant hormones, flavonoid biosynthesis, and glycolysis/gluconeogenesis. Further analysis led to the identification of differentially expressed transcription factors (TFs) and different kinase responsive genes in CBB23, than that in JG30. Besides TFs and kinase responsive genes, DEGs related to ethylene, jasmonic acid, and secondary metabolites were also identified in both genotypes after PXO99 A infection. The data of DEGs are a precious resource for further clarifying the network of Xa23 -mediated resistance.
Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E
2015-06-30
Deep vein thrombosis (DVT) is a condition in which a clot forms in the deep veins, most commonly of the leg. It occurs in approximately 1 in 1,000 people. If left untreated, the clot can travel up to the lungs and cause a potentially life-threatening pulmonary embolism (PE). Previously, a DVT was treated with the anticoagulants heparin and vitamin K antagonists. However, two forms of novel oral anticoagulants (NOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the treatment of DVT. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the treatment of DVT. The Cochrane Peripheral Vascular Diseases Group Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). We searched clinical trials databases for details of ongoing or unpublished studies and the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which people with a DVT confirmed by standard imaging techniques, were allocated to receive an oral DTI or an oral factor Xa inhibitor for the treatment of DVT. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third review author (PK). We performed meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent VTE and PE. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes using an odds ratio (OR) with a 95% confidence interval (CI). We included
Wang, Xiaotian; Cheng, Zhenxiang; Wang, Wenhong
2017-10-20
For theoretical designing of full-Heusler based spintroinc materials, people have long believed in the so-called Site Preference Rule (SPR). Very recently, according to the SPR, there are several studies on XA-type Hafnium-based Heusler alloys X₂YZ, i.e., Hf₂VAl, Hf₂CoZ (Z = Ga, In) and Hf₂CrZ (Z = Al, Ga, In). In this work, a series of Hf₂-based Heusler alloys, Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb), were selected as targets to study the site preferences of their atoms by first-principle calculations. It has been found that all of them are likely to exhibit the L2₁-type structure instead of the XA one. Furthermore, we reveal that the high values of spin-polarization of XA-type Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb) alloys have dropped dramatically when they form the L2₁-type structure. Also, we prove that the electronic, magnetic, and physics nature of these alloys are quite different, depending on the L2₁-type or XA-type structures.
Institute of Scientific and Technical Information of China (English)
Hue Thi NGUYEN; Trung Nguyen DINH; Nakano TOSHITSUGU; Liet Van VU; Quang Hong VU; Tan Van MAI; Thu Thi NGUYEN; Lam Duc VU; Tung Thanh NGUYEN; Long Viet NGUYEN; Hien Thu Thi VU; Hue Thi NONG
2018-01-01
Bacterial leaf blight of rice (BLB), caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F35.1.5.1, BC3F35.1.5.12, BC3F38.5.6.44, BC3F3 9.5.4.1 and BC3F39.5.4.23) were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.
Directory of Open Access Journals (Sweden)
Hue Thi Nguyen
2018-01-01
Full Text Available Bacterial leaf blight of rice (BLB, caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3 lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F3 5.1.5.1, BC3F3 5.1.5.12, BC3F3 8.5.6.44, BC3F3 9.5.4.1 and BC3F3 9.5.4.23 were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.
Directory of Open Access Journals (Sweden)
Stephen P Cohen
Full Text Available Plant disease is a major challenge to agriculture worldwide, and it is exacerbated by abiotic environmental factors. During some plant-pathogen interactions, heat stress allows pathogens to overcome host resistance, a phenomenon which could severely impact crop productivity considering the global warming trends associated with climate change. Despite the importance of this phenomenon, little is known about the underlying molecular mechanisms. To better understand host plant responses during simultaneous heat and pathogen stress, we conducted a transcriptomics experiment for rice plants (cultivar IRBB61 containing Xa7, a bacterial blight disease resistance (R gene, that were infected with Xanthomonas oryzae, the bacterial blight pathogen of rice, during high temperature stress. Xa7-mediated resistance is unusual relative to resistance mediated by other R genes in that it functions better at high temperatures. Using RNA-Seq technology, we identified 8,499 differentially expressed genes as temperature responsive in rice cultivar IRBB61 experiencing susceptible and resistant interactions across three time points. Notably, genes in the plant hormone abscisic acid biosynthesis and response pathways were up-regulated by high temperature in both mock-treated plants and plants experiencing a susceptible interaction and were suppressed by high temperature in plants exhibiting Xa7-mediated resistance. Genes responsive to salicylic acid, an important plant hormone for disease resistance, were down-regulated by high temperature during both the susceptible and resistant interactions, suggesting that enhanced Xa7-mediated resistance at high temperature is not dependent on salicylic acid signaling. A DNA sequence motif similar to known abscisic acid-responsive cis-regulatory elements was identified in the promoter region upstream of genes up-regulated in susceptible but down-regulated in resistant interactions. The results of our study suggest that the plant
Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E
2015-12-04
Pulmonary embolism is a potentially life-threatening condition in which a clot can travel from the deep veins, most commonly in the leg, up to the lungs. Previously, a pulmonary embolism was treated with the anticoagulants heparin and vitamin K antagonists. Recently, however, two forms of direct oral anticoagulants (DOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the long-term treatment (minimum duration of three months) of pulmonary embolism. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the long-term treatment of pulmonary embolism. The Cochrane Vascular Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). Clinical trials databases were also searched for details of ongoing or unpublished studies. We searched the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which patients with a pulmonary embolism confirmed by standard imaging techniques were allocated to receive an oral DTI or an oral factor Xa inhibitor for the long-term (minimum duration three months) treatment of pulmonary embolism. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third author (PK). We used meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent venous thromboembolism and pulmonary embolism. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes
Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena
2014-08-01
Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.
78 FR 24677 - Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY
2013-04-26
... Final Rule This rule establishes a temporary safety zone on the navigable waters of the East River, in... Fireworks, Pier 34, East River, NY. (a) Regulated Area. The following area is a temporary safety zone: all... 1625-AA00 Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY AGENCY: Coast...
Cyr, Normand; de la Fuente, Cynthia; Lecoq, Lauriane; Guendel, Irene; Chabot, Philippe R; Kehn-Hall, Kylene; Omichinski, James G
2015-05-12
Rift Valley fever virus (RVFV) is a single-stranded RNA virus capable of inducing fatal hemorrhagic fever in humans. A key component of RVFV virulence is its ability to form nuclear filaments through interactions between the viral nonstructural protein NSs and the host general transcription factor TFIIH. Here, we identify an interaction between a ΩXaV motif in NSs and the p62 subunit of TFIIH. This motif in NSs is similar to ΩXaV motifs found in nucleotide excision repair (NER) factors and transcription factors known to interact with p62. Structural and biophysical studies demonstrate that NSs binds to p62 in a similar manner as these other factors. Functional studies in RVFV-infected cells show that the ΩXaV motif is required for both nuclear filament formation and degradation of p62. Consistent with the fact that the RVFV can be distinguished from other Bunyaviridae-family viruses due to its ability to form nuclear filaments in infected cells, the motif is absent in the NSs proteins of other Bunyaviridae-family viruses. Taken together, our studies demonstrate that p62 binding to NSs through the ΩXaV motif is essential for degrading p62, forming nuclear filaments and enhancing RVFV virulence. In addition, these results show how the RVFV incorporates a simple motif into the NSs protein that enables it to functionally mimic host cell proteins that bind the p62 subunit of TFIIH.
XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles
Directory of Open Access Journals (Sweden)
V.S. Neverov
2017-01-01
Full Text Available XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D diffraction patterns and pair-distribution functions (PDF for amorphous or crystalline nanoparticles (up to ∼107 atoms of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.
XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles
Neverov, V. S.
XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D) diffraction patterns and pair-distribution functions (PDF) for amorphous or crystalline nanoparticles (up to ∼107 atoms) of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.
Bimolata, Waikhom; Kumar, Anirudh; Sundaram, Raman Meenakshi; Laha, Gouri Shankar; Qureshi, Insaf Ahmed; Reddy, Gajjala Ashok; Ghazi, Irfan Ahmad
2013-08-01
Xa27 is one of the important R-genes, effective against bacterial blight disease of rice caused by Xanthomonas oryzae pv. oryzae (Xoo). Using natural population of Oryza, we analyzed the sequence variation in the functionally important domains of Xa27 across the Oryza species. DNA sequences of Xa27 alleles from 27 rice accessions revealed higher nucleotide diversity among the reported R-genes of rice. Sequence polymorphism analysis revealed synonymous and non-synonymous mutations in addition to a number of InDels in non-coding regions of the gene. High sequence variation was observed in the promoter region including the 5'UTR with 'π' value 0.00916 and 'θ w ' = 0.01785. Comparative analysis of the identified Xa27 alleles with that of IRBB27 and IR24 indicated the operation of both positive selection (Ka/Ks > 1) and neutral selection (Ka/Ks ≈ 0). The genetic distances of alleles of the gene from Oryza nivara were nearer to IRBB27 as compared to IR24. We also found the presence of conserved and null UPT (upregulated by transcriptional activator) box in the isolated alleles. Considerable amino acid polymorphism was localized in the trans-membrane domain for which the functional significance is yet to be elucidated. However, the absence of functional UPT box in all the alleles except IRBB27 suggests the maintenance of single resistant allele throughout the natural population.
Energy Technology Data Exchange (ETDEWEB)
Lim, Chan Ju; Lee, Ha Yeon; Kim, Woong Bom; Ahmad, Raza; Moon, Jae Sun; Kwon, Suk Yoon [Korea Research Institute of Beoscience and Biotechnology, Daejeon (Korea, Republic of); Kim, Dong Sub [Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of)
2010-09-15
Bacterial blight is one of the most serious diseases of rice (Oryza sativa L.), and it has been known that Xanthomonas oryzae pv. oryzae (Xoo) causes this disease symptom. To develop resistance rice cultivars against Xoo, 3,000 lines of M{sub 3}, which were irradiated with gamma ray, were tested by 'scissor-dip method' primarily, and 191 putative resistant lines were selected. In M{sub 4} generation, these lines were screened again with various ways such as measuring of symptom of bacterial blight in leaf, number of tiller, fresh weight, and phenotypic segregation ratio in next generation. Finally, six resistance lines were selected. RT-PCR analysis revealed that these lines displayed high level of R-genes such as Xa21, Pi36, and Pi-ta. These results indicate that mutations by gamma ray cause disruptions of regulatory signal transduction systems of these R-genes. Furthermore, these selected mutants could be useful for the development of rice cultivar resistant to Xoo.
Directory of Open Access Journals (Sweden)
Maitreyee Sharma
Full Text Available In the present study a major protein has been purified from the venom of Indian Daboia russelii russelii using gel filtration, ion exchange and Rp-HPLC techniques. The purified protein, named daboxin P accounts for ~24% of the total protein of the crude venom and has a molecular mass of 13.597 kDa. It exhibits strong anticoagulant and phospholipase A2 activity but is devoid of any cytotoxic effect on the tested normal or cancerous cell lines. Its primary structure was deduced by N-terminal sequencing and chemical cleavage using Edman degradation and tandem mass spectrometry. It is composed of 121 amino acids with 14 cysteine residues and catalytically active His48 -Asp49 pair. The secondary structure of daboxin P constitutes 42.73% of α-helix and 12.36% of β-sheet. It is found to be stable at acidic (pH 3.0 and neutral pH (pH 7.0 and has a Tm value of 71.59 ± 0.46°C. Daboxin P exhibits anticoagulant effect under in-vitro and in-vivo conditions. It does not inhibit the catalytic activity of the serine proteases but inhibits the activation of factor X to factor Xa by the tenase complexes both in the presence and absence of phospholipids. It also inhibits the tenase complexes when active site residue (His48 was alkylated suggesting its non-enzymatic mode of anticoagulant activity. Moreover, it also inhibits prothrombinase complex when pre-incubated with factor Xa prior to factor Va addition. Fluorescence emission spectroscopy and affinity chromatography suggest the probable interaction of daboxin P with factor X and factor Xa. Molecular docking analysis reveals the interaction of the Ca+2 binding loop; helix C; anticoagulant region and C-terminal region of daboxin P with the heavy chain of factor Xa. This is the first report of a phospholipase A2 enzyme from Indian viper venom which targets both factor X and factor Xa for its anticoagulant activity.
Ishihara, Tsukasa; Koga, Yuji; Iwatsuki, Yoshiyuki; Hirayama, Fukushi
2015-01-15
Anticoagulant agents have emerged as a promising class of therapeutic drugs for the treatment and prevention of arterial and venous thrombosis. We investigated a series of novel orally active factor Xa inhibitors designed using our previously reported conjugation strategy to boost oral anticoagulant effect. Structural optimization of anthranilamide derivative 3 as a lead compound with installation of phenolic hydroxyl group and extensive exploration of the P1 binding element led to the identification of 5-chloro-N-(5-chloro-2-pyridyl)-3-hydroxy-2-{[4-(4-methyl-1,4-diazepan-1-yl)benzoyl]amino}benzamide (33, AS1468240) as a potent factor Xa inhibitor with significant oral anticoagulant activity. We also reported a newly developed Free-Wilson-like fragment recommender system based on the integration of R-group decomposition with collaborative filtering for the structural optimization process. Copyright © 2014 Elsevier Ltd. All rights reserved.
First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa
Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.
2009-01-01
Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of...
Directory of Open Access Journals (Sweden)
Nouf Al Otaib
2017-01-01
Conclusions: Weight-based enoxaparin dose led to the anticipated peak anti-Xa levels (0.2–0.6 IU/mL in most of the morbidly obese study patients undergoing surgery without any evidence of major side effects. The weight-based dosing of enoxaparin was also effective in preventing VTE in all patients. Although these results are promising, further comparative trials are needed in the setting of morbidly obese surgical patients.
Czech Academy of Sciences Publication Activity Database
Calvo, E.; Mizurini, D.M.; Sa-Nunes, A.; Ribeiro, J.M.C.; Andersen, J. F.; Mans, B.J.; Monteiro, R.Q.; Kotsyfakis, Michalis; Francischetti, I.M.B.
2011-01-01
Roč. 286, č. 32 (2011), 27998-28010 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z60220518 Keywords : serpin * mosquito * Aedes albopictus * phospholipids * Factor Xa * heparin * binding affinity * coagulation * thrombus * bleeding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.773, year: 2011
First steps in the direction of synthetic, allosteric, direct inhibitors of thrombin and factor Xa.
Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R
2009-08-01
Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that (i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; (ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and (iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes.
First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa
Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.
2009-01-01
Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes. PMID:19540113
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-10-01
The International Atomic Energy Agency convened a technical committee Meeting on Requirements, Practices and Developments in Burnup Credit (BUC) Applications in Madrid, Spain, from 22 to 26 April 2002. The purpose of this meeting was to explore the progress and status of international activities related to the BUC applications for spent nuclear fuel. This meeting was the third major meeting on the uses of BUC for spent fuel management systems held since the IAEA began to monitor the uses of BUC in spent fuel management systems in 1997. The first major meeting was an Advisory Group meeting (AGM), which was held in Vienna, in October 1997. The second major meeting was a technical committee meeting (TCM), which was held in Vienna, in July 2000. Several consultants meetings were held since 1997 to advise and assist the IAEA in planning and conducting its BUC activities. The proceedings of the 1997 AGM were published as IAEA-TECDOC-1013, and the proceedings of the 2000 TCM as IAEA-TECDOC-1241. BUC for wet and dry storage systems, spent fuel transport, reprocessing and final disposal is needed in many Member States to allow for increased enrichment, and to increase storage capacities, cask capacities and dissolver capacities avoiding the need for extensive modifications. The use of BUC is a necessity for spent fuel disposal.
DEFF Research Database (Denmark)
Steg, Ph Gabriel; Mehta, Shamir R; Jukema, J Wouter
2011-01-01
To establish the safety, tolerability and most promising regimen of darexaban (YM150), a novel, oral, direct factor Xa inhibitor, for prevention of ischaemic events in acute coronary syndrome (ACS)....
Xie, Dalong; Zhang, Hui; Hu, Xuanhao; Shang, Chao
2017-10-24
In genitourinary system, bladder cancer (BC) is the most common and lethal malignant tumor, which most common type is bladder urothelial carcinoma (BUC). Long non-coding RNA (lncRNA) Taurine Up-Regulated 1 (TUG1) gene is high-expressed in several malignant tumors, including BC. In this study, over-expression of TUG1 was found in BUC tissues and cell line resistant to doxorubicin (Dox). Knockdown of TUG1 inhibited the Dox resistance and promoted the cytotoxicity induced by Dox in T24/Dox cells. TUG1 knockdown also depressed the Wnt/β-catenin pathway, and the activation the Wnt/β-catenin pathway partly reversed the inhibitory effects of TUG1 knockdown on Dox resistance in T24/Dox cells. In conclusion, up-regulation of lncRNA TUG1 was related with the poor response of BUC patients to Dox chemotherapy, knockdown of TUG1 inhibited the Dox resistance of BUC cells via Wnt/β-catenin pathway. These findings might assist in the discovery of novel potential diagnostic and therapeutic target for BUC, thereby improve the effects of clinical treatment in patients.
Hepatoprotective Effects of Chinese Medicine Herbs Decoction on Liver Cirrhosis in Rats
Directory of Open Access Journals (Sweden)
Nor Aziyah Mat-Rahim
2017-01-01
Full Text Available Hepatoprotective and curative activities of aqueous extract of decoction containing 10 Chinese medicinal herbs (HPE-XA-08 were evaluated in Sprague–Dawley albino rats with liver damage induced by thioacetamide (TAA. These activities were assessed by investigating the liver enzymes level and also histopathology investigation. Increases in alkaline phosphatase (ALP and gamma-glutamyl transferase (GGT levels were observed in rats with cirrhotic liver. No significant alterations of the liver enzymes were observed following treatment with HPE-XA-08. Histopathology examination of rats treated with HPE-XA-08 at 250 mg/kg body weight, however, exhibited moderate liver protective effects. Reduced extracellular matrix (ECM proteins within the hepatocytes were noted in comparison to the cirrhotic liver. The curative effects of HPE-XA-08 were observed with marked decrease in the level of ALP (more than 3x and level of GGT (more than 2x in cirrhotic rat treated with 600 mg/kg body weight HPE-XA-08 in comparison to cirrhotic rat treated with just water diluent. Reversion of cirrhotic liver to normal liver condition in rats treated with HPE-XA-08 was observed. Results from the present study suggest that HPE-XA-08 treatment assisted in the protection from liver cirrhosis and improved the recovery of cirrhotic liver.
Buller, HR; Cariou, R; Gallus, A; Gent, M; Ginsberg, J; Prins, MH; Lensing, A; Levi, M; Nurmohammed, N; Hirsh, J; Roberts, R; ten Cate, JW; Decousus, H; Mismetti, P; Buchmuller, A; Charlet, [No Value; Viallon, A; van der Meer, J; Meinardi, [No Value; Meijer, K; Piovella, F; Barone, M; Beltrametti, C; Serafini, S; Kraaijenhagen, RA; Koopman, MMW; Jagt, HHT; Muller, MBR; Kooy, MV; Nauta, S; Gallus, AS; Coghlan, D; Rich, C; Prandoni, P; Scudeller, A; Scarano, L; Girolami, A; Baker, R; Tan, E; Cooney, J; Eikelboom, J; Ninet, J; Dolmazon, C; Madoux, MHG; Coppere, B; Nenci, GG; Agnelli, G; Falcinelli, F; Morini, M; d'Angelo, A
2000-01-01
Background-Patients with venous thromboembolism require initial treatment with an immediate-acting anticoagulant, low-molecular-weight heparin. We evaluated a novel synthetic factor Xa inhibitor (SR90107a/ORG31540) as an alternative treatment. Methods and Results-A randomized-parallel-group, phase
Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos
2017-01-01
Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels. PMID:28170419
Análise e identificação das antocianinas de couve rôxa (Brassica spp.)
Lopes, Dulce; Jesus, Benvinda; Cabrita, Luís
2004-01-01
A couve rôxa é uma espécie comestível com uma composição em antocianinas rica e complexa. Sabe-se que contem antocianinas poliglicosiladas, aciladas com um ou mesmo dois grupos acilo aromáticos, nomeadamente com ácidos coumárico e caféico. Este padrão de acilação é particularmente interessante, porque confere estabilidade às antocianinas e aumenta o seu potencial de utilização em aplicações famacêuticas, alimentares e cosméticas. Este estudo tem por objectivo determinar a...
Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo Dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos
2017-01-01
Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p plasma samples for rivaroxaban measurement by HPLC-MS/MS without interferences. The chromogenic and HPLC-MS/MS methods were highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels.
Zhang, Jia; Wang, Chong-Chen
2017-02-01
Three novel coordination polymers based on transition metals like Co(II), Cu(II) and Mn(II), namely [Co2(bpy)2(nbda)2(H2O)2]·2H2O (denoted as BUC-1), [Cu2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-2), [Mn2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-3), (where bpy = 4,4‧-bipyridine, H2nbda = 2,3-norbornanedicarboxylic acid, BUC = Beijing University of Civil Engineering and Architecture), were synthesized under hydrothermal conditions, and characterized by CNH elemental analyses (EA), Fourier Transform infrared spectroscopy (FTIR), and single crystal X-ray diffraction (SCXRD). BUC 1-3 were isostructural and crystallized in the monoclinic space group C2/c, in which the corresponding metal atoms were linked by typical bidentate bpy ligands into two adjacent 1D [M1(bpy)]n2n+ and [M2(bpy)]n2n+ (M = Co(II), Cu(II), Mn(II)), further joined by versatile nbda2- ligands into 2D [M2(bpy)2(nbda)2]n sheets. Finally, three-dimensional supramolecular frameworks were constructed with the aid of the intermolecular hydrogen bonding interactions. BUC 1-3 exhibited different photocatalytic degradation ability to decompose methylene blue (MB) and methyl orange (MO) under UV light irradiation. Additionally, a possible photocatalytic mechanism HOMO-LUMO was proposed and discussed, which was further confirmed by radicals trapping experiments using isopropanol as radical scavenger.
International Nuclear Information System (INIS)
Osmera, B.; Posta, S.; Jansky, B.
2004-01-01
The project consisted of the following stages (Stage symbol; Stage name; Stage output; Fields of application): E01; Neutron detection and spectrometry using doped scintillators; A spectrometry system for fast neutron measurements in low neutron intensity fields; Fuel storage facilities, analysis of samples contaminated by uranium and transuranium elements, university teaching. E02; Neutron and gamma spectrometry in mixed neutron/gamma fields; A system for the spectrometry of mixed neutron/gamma fields; Neutron and gamma spectrometry in working environment, radiation protection of military equipment, metrology in neutron/gamma fields, university teaching. E03; Neutron detection methods based on fission fragment track counting; A system for neutron fluence determination based on fission fragment track counting; Storage cask monitoring, radiation protection, university teaching. E04; Calibration methods for gamma scanning of fuel assemblies; A calibration system for fuel pin inspection via gamma distribution measurement; Nuclear fuel burnup assessment, BUC technology implementation, spent fuel processing. E05; Optimization of the neutron capture therapy method at the LVR-15 reactor; Treatment of selected tumorous and non-tumorous diseases; Radiotherapy - novel therapy methods in oncology, novel methods of non-tumorous disease therapy, operation of the irradiation facilities of the LVR-15 reactor with simultaneous neutron capture therapy procedures. Details of each of the stages are given. (P.A.)
International Nuclear Information System (INIS)
Valenzuela, Olga L.; Germolec, Dori R.; Borja-Aburto, Victor H.; Contreras-Ruiz, Jose; Garcia-Vargas, Gonzalo G.; Razo, Luz M. del
2007-01-01
Inorganic arsenic (iAs) is a well-established carcinogen and human exposure has been associated with a variety of cancers including those of skin, lung, and bladder. High expression of transforming growth factor alpha (TGF-α) has associated with local relapses in early stages of urinary bladder cancer. iAs exposures are at least in part determined by the rate of formation and composition of iAs metabolites (MAs III , MAs V , DMAs III , DMAs V ). This study examines the relationship between TGF-α concentration in exfoliated bladder urothelial cells (BUC) separated from urine and urinary arsenic species in 72 resident women (18-51 years old) from areas exposed to different concentrations of iAs in drinking water (2-378 ppb) in central Mexico. Urinary arsenic species, including trivalent methylated metabolites were measured by hydride generation atomic absorption spectrometry method. The concentration of TGF-α in BUC was measured using an ELISA assay. Results show a statistically significant positive correlation between TGF-α concentration in BUC and each of the six arsenic species present in urine. The multivariate linear regression analyses show that the increment of TGF-α levels in BUC was importantly associated with the presence of arsenic species after adjusting by age, and presence of urinary infection. People from areas with high arsenic exposure had a significantly higher TGF-α concentration in BUC than people from areas of low arsenic exposure (128.8 vs. 64.4 pg/mg protein; p < 0.05). Notably, exfoliated cells isolated from individuals with skin lesions contained significantly greater amount of TGF-α than cells from individuals without skin lesions: 157.7 vs. 64.9 pg/mg protein (p = 0.003). These results suggest that TGF-α in exfoliated BUC may serve as a susceptibility marker of adverse health effects on epithelial tissue in arsenic-endemic areas
DEFF Research Database (Denmark)
NN, NN
2010-01-01
BACKGROUND: Atrial fibrillation (AF), the most common significant cardiac arrhythmia, increases the risk of stroke, particularly in the elderly. Warfarin is effective in reducing stroke risk but is burdensome to patients and is difficult to control. Rivaroxaban is an oral direct factor Xa inhibit...
Contemporary developments in the discovery of selective factor Xa inhibitors: A review.
Patel, Nirav R; Patel, Dushyant V; Murumkar, Prashant R; Yadav, Mange Ram
2016-10-04
Thrombosis is a leading cause of death in cardiovascular diseases such as myocardial infarction (MI), unstable angina and acute coronary syndrome (ACS) in the industrialized world. Venous thromboembolism is observed in about 1 million people every year in United States causing significant morbidity and mortality. Conventional antithrombotic therapy has been reported to have several disadvantages and limitations like inconvenience in oral administration, bleeding risks (heparin analogs), narrow therapeutic window and undesirable interactions with food and drugs (vitamin K antagonist-warfarin). The unmet medical demand for orally active safe anticoagulants has generated widespread interest among the medicinal chemists engaged in this field. To modulate blood coagulation, various enzymes involved in the coagulation process have received great attention as potential targets by various research groups for the development of oral anticoagulants. Among these enzymes, factor Xa (FXa) has remained the centre of attention in the last decade. Intensive research efforts have been made by various research groups for the development of small, safe and orally bioavailable FXa inhibitors. This review is an attempt to compile the research work of various researchers in the direction of development of FXa inhibitors reported since 2010 onward. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
BUC implementation in Slovakia
International Nuclear Information System (INIS)
Chrapciak, V.; Vaclav, J.
2009-01-01
Improved calculation methods allow one to take credit for the reactivity reduction associated with fuel burnup. This means reducing the analysis conservatism while maintaining an adequate criticality safety margin. Application of burnup credit requires knowledge of the reactivity state of the irradiated fuel for which application of burnup credit is taken. The isotopic inventory and reactivity has to be calculated with validated codes. We use in Slovakia Gd2 fuel with maximal enrichment of fuel pins 4.4%. Our transport and storage basket KZ-48 with boron steel is licensed for fresh fuel with enrichment 4.4%. In near future (2011 or 2012) we will use a new fuel with maximal enrichment of fuel pins 4.9%. For this fuel we plan to use existing KZ-48 with application of burnup credit application. In cooperation with Slovak Nuclear Regulatory Authority we have started several years ago process of application of burnup credit implementation in Slovakia for WWER-440 reactors. We have already prepared methodology according IAEA methodology. We have validated computational systems (SCALE 5.1 already, SCALE 6 in progress). Slovak Nuclear Regulatory Authority will prepare regulation about application of burnup credit application in Slovakia. Last item is preparation of safety reports (for transport and storage) for the new fuel with average enrichment 4.87% in basket KZ-48 with application of burnup credit application. (Authors)
Directory of Open Access Journals (Sweden)
Huang CK
2018-04-01
Full Text Available Changkun Huang,* Zhichao Huang,* Xiaokun Zhao, Yinhuai Wang, Hongqing Zhao, Zhaohui Zhong, Lang Wang Department of Urology, The Second Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China *These authors contributed equally to this work Background: High mobility group box 1 (HMGB1, a versatile protein with intranuclear and extracellular functions, plays an important role in a variety of human cancers. However, the clinical/prognostic significance of HMGB1 expression in human bladder urothelial carcinoma (BUC remains unclear. The aim of this study was to investigate the HMGB1 expression in human BUC with regard to its clinical and prognostic significance.Patients and methods: HMGB1 mRNA and protein expressions in tumor and paired normal bladder tissues were detected in 20 BUC cases by quantitative real-time polymerase chain reaction (qRT-PCR and Western blot. HMGB1 protein expression in 165 primary BUC tissues was evaluated by immunohistochemistry (IHC, and its correlations with clinicopathological characteristics and prognosis were also analyzed. Student’s t-test, χ2 test, Kaplan–Meier plots, and Cox proportional hazard regression model were performed to analyze the data. Results: By using qRT-PCR and Western blot, the upregulated expression of HMGB1 mRNA and protein was detected in BUC, compared with paired normal tissue (P<0.05. By using IHC, high HMGB1 expression was examined in 84 of 165 (51.0% BUC cases. High HMGB1 expression was significantly correlated with poorer differentiation and higher T and N classification (all P<0.05. Univariate analysis showed that high HMGB1 expression was significantly associated with a shortened patients’ overall survival (OS and disease-free survival (DFS; both P<0.001. In different subgroups of BUC patients, HMGB1 expression was a prognostic factor in patients with different histological grades or T classification (all P<0.05, pN− (both P<0.001 for OS and DFS, and
Trivial topological phase of CaAgP and the topological nodal-line transition in CaAg (P1 -xA sx)
Xu, N.; Qian, Y. T.; Wu, Q. S.; Autès, G.; Matt, C. E.; Lv, B. Q.; Yao, M. Y.; Strocov, V. N.; Pomjakushina, E.; Conder, K.; Plumb, N. C.; Radovic, M.; Yazyev, O. V.; Qian, T.; Ding, H.; Mesot, J.; Shi, M.
2018-04-01
By performing angle-resolved photoemission spectroscopy and first-principles calculations, we address the topological phase of CaAgP and investigate the topological phase transition in CaAg (P1 -xA sx) . We reveal that in CaAgP, the bulk band gap and surface states with a large bandwidth are topologically trivial, in agreement with hybrid density functional theory calculations. The calculations also indicate that application of "negative" hydrostatic pressure can transform trivial semiconducting CaAgP into an ideal topological nodal-line semimetal phase. The topological transition can be realized by partial isovalent P/As substitution at x =0.38 .
International Nuclear Information System (INIS)
Du, Lanying; Kao, Richard Y.; Zhou, Yusen; He, Yuxian; Zhao, Guangyu; Wong, Charlotte; Jiang, Shibo; Yuen, Kwok-Yung; Jin, Dong-Yan; Zheng, Bo-Jian
2007-01-01
The spike (S) protein of SARS coronavirus (SARS-CoV) has been known to recognize and bind to host receptors, whose conformational changes then facilitate fusion between the viral envelope and host cell membrane, leading to viral entry into target cells. However, other functions of SARS-CoV S protein such as proteolytic cleavage and its implications to viral infection are incompletely understood. In this study, we demonstrated that the infection of SARS-CoV and a pseudovirus bearing the S protein of SARS-CoV was inhibited by a protease inhibitor Ben-HCl. Also, the protease Factor Xa, a target of Ben-HCl abundantly expressed in infected cells, was able to cleave the recombinant and pseudoviral S protein into S1 and S2 subunits, and the cleavage was inhibited by Ben-HCl. Furthermore, this cleavage correlated with the infectivity of the pseudovirus. Taken together, our study suggests a plausible mechanism by which SARS-CoV cleaves its S protein to facilitate viral infection
$\\gamma$-$\\gamma$ and $\\gamma$-p events at high energies
Schuler, Gerhard A.; Gerhard A Schuler; Torbjorn Sjostrand
1994-01-01
A real photon has a complicated nature, whereby it may remain unresolved or fluctuate into a vector meson or a perturbative q-qbar pair. Based on this picture, we previously presented a model for gamma-p events that is based on the presence of three main event classes: direct, VMD and anomalous. In gamma-gamma events, a natural generalization gives three-by-three combinations of the nature of the two incoming photons, and thus six distinct event classes. The properties of these classes are constrained by the choices already made, in the gamma-p model, of cut-off procedures and other aspects. It is therefore possible to predict the energy-dependence of the cross section for each of the six components separately. The total cross section thus obtained is in good agreement with data, and also gives support to the idea that a simple factorized ansatz with a pomeron and a reggeon term can be a good approximation. Event properties undergo a logical evolution from p-p to gamma-p to gamma-gamma events, with larger cha...
Energy Technology Data Exchange (ETDEWEB)
Ambrosino, F.; Massarotti, P.; Meola, S.; Napolitano, M. [Dipartimento di Scienze Fisiche dell' Universita ' ' Federico II' ' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bloise, C.; Bossi, F.; Capon, G.; Capussela, T.; Ciambrone, P.; De Lucia, E.; De Simone, P.; Dreucci, M.; Felici, G.; Gatti, C.; Giovannella, S.; Jacewicz, M.; Lanfranchi, G.; Miscetti, S.; Moulson, M.; Murtas, F.; Palutan, M.; Santangelo, P.; Sciascia, B.; Sibidanov, A.; Spadaro, T.; Venanzoni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' ' Tor Vergata' ' , Rome (Italy); INFN Sezione di Roma Tor Vergata, Rome (Italy); Beltrame, P.; Denig, A.; Mueller, S. [Johannes Gutenberg-Universitaet, Institut fuer Kernphysik, Mainz (Germany); Bini, C.; De Santis, A.; De Zorzi, G.; Di Domenico, A.; Fiore, S.; Franzini, P.; Gauzzi, P. [Dipartimento di Fisica dell' Universita ' ' La Sapienza' ' , Rome (Italy); INFN Sezione di Roma, Rome (Italy); Bocchetta, S.; Ceradini, F.; Di Micco, B.; Nguyen, F. [Dipartimento di Fisica dell' Universita ' ' Roma Tre' ' , Rome (Italy); INFN Sezione di Roma Tre, Rome (Italy); Branchini, P.; Graziani, E.; Passeri, A.; Tortora, L. [INFN Sezione di Roma Tre, Rome (Italy); Capriotti, D. [Dipartimento di Fisica dell' Universita ' ' Roma Tre' ' , Rome (Italy); Di Donato, C. [INFN Sezione di Napoli, Napoli (Italy); Kulikov, V. [Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Lee-Franzini, J. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); State University of New York, Physics Department, Stony Brook (United States); Martini, M.; Patera, V.; Versaci, R. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Dipartimento di Energetica dell' Universita ' ' La Sapienza' ' , Rome (Italy); Valente, P. [INFN Sezione di Roma, Rome (Italy)
2009-12-15
We present a precise measurement of the ratio R{sub K}={gamma}(K{yields}e{nu}({gamma}))/{gamma}(K{yields}{mu}{nu}({gamma})) and a study of the radiative process K{yields}e{nu}{gamma}, performed with the KLOE detector. The results are based on data collected at the Frascati e{sup +}e{sup -} collider DA {phi}NE for an integrated luminosity of 2.2 fb{sup -1}. We find R{sub K}=(2.493{+-}0.025{sub stat}{+-}0.019{sub syst}) x 10{sup -5}, in agreement with the Standard Model expectation. This result is used to improve constraints on parameters of the Minimal Supersymmetric Standard Model with lepton flavor violation. We also measured the differential decay rate d {gamma}(K{yields}e{nu}{gamma})/dE{sub {gamma}} for photon energies 10
Energy Technology Data Exchange (ETDEWEB)
Efimov, G V; Ivanov, M A; Nogovitsyn, E A [Joint Inst. for Nuclear Research, Dubna (USSR)
1981-07-01
P..--> gamma gamma.. (P=..pi../sup 0/, eta, eta'), eta..--> pi../sup +/..pi../sup -/..gamma.., eta..--> pi../sup 0/..gamma gamma.., eta/sup 1/..-->..V..gamma.. (V=rho/sup 0/, ..omega..), p..--> gamma..l/sup +/l/sup -/ (p=..pi../sup 0/, eta, eta') radiation decays are studied for testing the applicability of the non-local quark model for description of the experimental data. The Feynman diagrams of these decays are presented, values of the widths of the Veta..--> gamma gamma.., eta..--> pi../sup +/..pi../sup -/..gamma.., eta..--> pi../sup 0/..gamma gamma.., eta'..--> gamma gamma.., eta'..-->..rho/sup 0/..gamma.., eta'..--> omega gamma.. decays are calculated and given in the form of a table. Calculations are carried out for two values of the eta eta'-crossing angle: THETA=-11 deg and -18 deg. Values of invariant amplitudes of these decays are determined for ..pi../sup 0/..--> gamma..e/sup +/e/sup -/, eta..--> gamma mu../sup +/..mu../sup -/, eta'..--> gamma mu../sup +/..mu../sup -/ decays at THETA=-11 deg and -18 deg. The best agreement with the experimental data is noted to take place at THETA=-11 deg, the determined width of the eta..--> pi../sup 0/..gamma gamma.. decays is underestimated as compared with the experimental one.
Directory of Open Access Journals (Sweden)
Tan Yin-Feng
2018-03-01
Full Text Available Thrombosis is a major cause of morbidity and mortality worldwide and plays a pivotal role in the pathogenesis of several cardiovascular disorders, including acute coronary syndrome, unstable angina, myocardial infarction, sudden cardiac death, peripheral arterial occlusion, ischemic stroke, deep-vein thrombosis, and pulmonary embolism. Anticoagulants, antiplatelet agents, and fibrinolytics can reduce the risks of these clinical events. Especially, the blood coagulation factor Xa (FXa inhibitor is a proven anticoagulant. Promoting blood circulation, using traditional Chinese medicine (TCM, for the treatment of these diseases has been safely used for thousands of years in clinical practice. Therefore, highly safe and effective anticoagulant ingredients, including FXa inhibitors, could be found in TCM for activating the blood circulation. One FXa inhibitor, a pentacyclic triterpene (compound 1, betulinic acid characterized by IR, MS and NMR analyses, was isolated from the ethyl acetate fraction of Lycopus lucidus by bioassay-directed fractionation. Compound 1 exhibited an inhibitory effect on FXa with IC50 25.05 μmol/L and reduced the thrombus weight in an animal model at 25-100 mg/kg. These results indicate that betulinic acid could be the potential for anticoagulant therapy.
Identification of key pathways and genes influencing prognosis in bladder urothelial carcinoma
Directory of Open Access Journals (Sweden)
Ning X
2017-03-01
Full Text Available Xin Ning, Yaoliang Deng Department of Urology, The First Affiliated Hospital of Guangxi Medical University, Nanning, Guangxi Province, People’s Republic of China Background: Genomic profiling can be used to identify the predictive effect of genomic subsets for determining prognosis in bladder urothelial carcinoma (BUC after radical cystectomy. This study aimed to investigate potential gene and pathway markers associated with prognosis in BUC.Methods: A microarray dataset of BUC was obtained from The Cancer Genome Atlas database. Differentially expressed genes (DEGs were identified by DESeq of the R platform. Kaplan–Meier analysis was applied for prognostic markers. Key pathways and genes were identified using bioinformatics tools, such as gene set enrichment analysis, gene ontology, the Kyoto Encyclopedia of Genes and Genomes, gene multiple association network integration algorithm (GeneMANIA, Search Tool for the Retrieval of Interacting Genes/Proteins, and Molecular Complex Detection.Results: A comparative gene set enrichment analysis of tumor and adjacent normal tissues suggested BUC tumorigenesis resulted mainly from enrichment of cell cycle and DNA damage and repair-related biological processes and pathways, including TP53 and mitotic recombination. Two hundred and fifty-six genes were identified as potential prognosis-related DEGs. Gene ontology and Kyoto Encyclopedia of Genes and Genomes analyses showed that the potential prognosis-related DEGs were enriched in angiogenesis, including the cyclic adenosine monophosphate biosynthetic process, cyclic guanosine monophosphate-protein kinase G, mitogen-activated protein kinase, Rap1, and phosphoinositide-3-kinase-AKT signaling pathway. Nine hub genes, TAGLN, ACTA2, MYH11, CALD1, MYLK, GEM, PRELP, TPM2, and OGN, were identified from the intersection of protein–protein interaction and GeneMANIA networks. Module analysis of protein–protein interaction and GeneMANIA networks mainly showed
Honda, Yuko; Furugohri, Taketoshi; Morishima, Yoshiyuki
2018-01-01
Agents to reverse the anticoagulant effect of edoxaban, an oral direct factor Xa inhibitor, would be desirable in emergency situations. The aim of this study is to determine the effect of tranexamic acid, an antifibrinolytic agent, on the anticoagulant activity and bleeding by edoxaban in rats. A supratherapeutic dose of edoxaban (3 mg/kg) was intravenously administered to rats. Three minutes after dosing, tranexamic acid (100 mg/kg) was given intravenously. Bleeding was induced by making an incision with a blade on the planta 8 min after edoxaban injection and bleeding time was measured. Prothrombin time (PT) and clot lysis were examined. A supratherapeutic dose of edoxaban significantly prolonged PT and bleeding time. Tranexamic acid did not affect PT or bleeding time prolonged by edoxaban, although tranexamic acid significantly inhibited clot lysis in rat plasma. An antifibrinolytic agent tranexamic acid failed to reverse the anticoagulant effect and bleeding by edoxaban in rats. © 2017 S. Karger AG, Basel.
Thrombin and factor Xa link the coagulation system with liver fibrosis.
Dhar, Ameet; Sadiq, Fouzia; Anstee, Quentin M; Levene, Adam P; Goldin, Robert D; Thursz, Mark R
2018-05-08
Thrombin activates hepatic stellate cells via protease-activated receptor-1. The role of Factor Xa (FXa) in hepatic fibrosis has not been elucidated. We aimed to evaluate the impact of FXa and thrombin in vitro on stellate cells and their respective inhibition in vivo using a rodent model of hepatic fibrosis. HSC-LX2 cells were incubated with FXa and/or thrombin in cell culture, stained for αSMA and relative gene expression and gel contraction calculated. C57BL/6 J mice were administered thioacetamide (TAA) for 8 weeks with Rivaroxaban (n = 15) or Dabigatran (n = 15). Control animals received TAA alone (n = 15). Fibrosis was scored and quantified using digital image analysis and hepatic tissue hydroxyproline estimated. Stellate cells treated with FXa and thrombin demonstrated upregulation of procollagen, TGF-beta, αSMA and significant cell contraction (43.48%+/- 4.12) compared to culturing with FXa or thrombin alone (26.90%+/- 8.90, p = 0.02; 13.1%+/- 9.84, p < 0.001). Mean fibrosis score, percentage area of fibrosis and hepatic hydroxyproline content (2.46 vs 4.08, p = 0.008; 2.02% vs 3.76%, p = 0.012; 276.0 vs 651.3, p = 0.0001) were significantly reduced in mice treated with the FXa inhibitor compared to control mice. FXa inhibition was significantly more effective than thrombin inhibition in reducing percentage area of fibrosis and hepatic hydroxyproline content (2.02% vs 3.70%,p = 0.031; 276.0 vs 413.1,p = 0.001). FXa promotes stellate cell contractility and activation. Early inhibition of coagulation using a FXa inhibitor significantly reduces TAA induced murine liver fibrosis and may be a viable treatment for liver fibrosis in patients.
Energy Technology Data Exchange (ETDEWEB)
Czubek, J A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires. Departement d' Electronique Generale, Service d' Electronique Industrielle; Institut de Recherches Nucleaires, Dep. VI, Cracow (Poland)
1966-07-01
The work presented here deals with the problem of the application of the similitude principle to rock density measurements by the gamma-gamma method. A formula is presented which makes it possible to transform results of gamma-gamma measurements carried out on models in order to make them suitable for comparison with results obtained under actual field conditions. Both the space coordinates and the densities are transformed. This transformation makes it possible to obtain a calibration curve as a function of the density for a gamma-gamma probe using only a single model of given density. The influence has also been studied of the chemical composition on the results obtained from gamma-gamma measurements. A method has been developed for estimating the equivalent Z parameter of the medium; the possibility of completely eliminating the influence of the chemical composition of the medium on the measurement results has been studied. (author) [French] L'etude presentee ci-dessous traite le probleme de l'application du principe de similitude aux mesures de densite des roches par la methode gamma-gamma. Nous indiquons une formule qui permet de transformer les resultats des mesures gamma-gamma effectuees sur les modeles pour les comparer aux resultats obtenus dans les conditions reelles sur le terrain. On transforme les coordonnees spatiales ainsi que les densites. Cette transformation donne la possibilite d'obtenir une courbe d'etalonnage (en fonction de la densite) pour une sonde gamma-gamma en utilisant un seul modele de densite donnee. On a etudie aussi l'influence de la composition chimique sur les resultats obtenus des mesures gamma-gamma. On a etabli une methode d'estimation du parametre Z equivalent du milieu, ainsi que la possibilite d'eliminer completement l'influence de la composition chimique du milieu sur les resultats des mesures de densite. (auteur)
French fission products experiments performed in Cadarache and Valduc. Results comparison
International Nuclear Information System (INIS)
Anno, Jacques; Barreau, Anne; Hudelot, Jean Pascal; Girault, Emmanuel; Fouillaud, Patrick; Toubon, Herve
2003-01-01
Cofunded by Cogema, two complementary experimental programmes on burn up credit (BUC) related to fission products (FPs) are performed by CEA and IRSN at Cadarache and Valduc. After shortly recalling the main characteristics of each experiment, a first comparison of some results is presented, especially the energy range in which most part of cross section absorption are qualified. Both experiments exhibit great quality and accurate results, giving a high degree of confidence to the whole experimental French process of qualification devoted to BUC. (author)
International Nuclear Information System (INIS)
Chambon, A.
2013-01-01
Considering spent fuel management (storage, transport and reprocessing), the approach using 'fresh fuel assumption' in criticality-safety studies results in a significant conservatism in the calculated value of the system reactivity. The concept of Burnup Credit (BUC) consists in considering the reduction of the spent fuel reactivity due to its burnup. A careful BUC methodology, developed by CEA in association with AREVA-NC was recently validated and written up for PWR-UOx fuels. However, 22 of 58 French reactors use MOx fuel, so more and more irradiated MOx fuels have to be stored and transported. As a result, why industrial partners are interested in this concept is because taking into account this BUC concept would enable for example a load increase in several fuel cycle devices. Recent publications and discussions within the French BUC Working Group highlight the current interest of the BUC concept in PWR-MOx spent fuel industrial applications. In this case of PWR-MOx fuel, studies show in particular that the 15 FPs selected thanks to their properties (absorbing, stable, non-gaseous) are responsible for more than a half of the total reactivity credit and 80% of the FPs credit. That is why, in order to get a conservative and physically realistic value of the application k eff and meet the Upper Safety Limit constraint, calculation biases on these 15 FPs inventory and individual reactivity worth should be considered in a criticality-safety approach. In this context, thanks to an exhaustive literature study, PWR-MOx fuels particularities have been identified and by following a rigorous approach, a validated and physically representative BUC methodology, adapted to this type of fuel has been proposed, allowing to take fission products into account and to determine the biases related to considered isotopes inventory and to reactivity worth. This approach consists of the following studies: - isotopic correction factors determination to guarantee the criticality
International Nuclear Information System (INIS)
2007-05-01
Given a trend towards higher burnup power reactor fuel, the IAEA began an active programme in burnup credit (BUC) with major meetings in 1997 (IAEA-TECDOC-1013), 2000 (IAEA-TECDOC-1241) and 2002 (IAEA-TECDOC-1378) exploring worldwide interest in using BUC in spent fuel management systems. This publication contains the proceedings of the IAEA's 4th major BUC meeting, held in London. Sixty participants from 18 countries addressed calculation methodology, validation and criticality, safety criteria, procedural compliance with safety criteria, benefits of BUC applications, and regulatory aspects in BUC. This meeting encouraged the IAEA to continue its activities on burnup credit including dissemination of related information, given the number of Member States having to deal with increased spent fuel quantities and extended durations. A 5th major meeting on burnup credit is planned 2008. Burnup credit is a concept that takes credit for the reduced reactivity of fuel discharged from the reactor to improve loading density of irradiated fuel assemblies in storage, transportation, and disposal applications, relative to the assumption of fresh fuel nuclide inventories in loading calculations. This report has described a general four phase approach to be considered in burnup credit implementation. Much if not all of the background research and data acquisition necessary for successful burnup credit development in preparation for licensing has been completed. Many fuel types, facilities, and analysis methods are encompassed in the public knowledge base, such that in many cases this guidance will provide a means for rapid development of a burnup credit program. For newer assembly designs, higher enrichment fuels, and more extensive nuclide credit, additional research and development may be necessary, but even this work can build on the foundation that has been established to date. Those, it is hoped that this report will serve as a starting point with sufficient reference to
Lee, Wonhwa; Kim, Mi-Ae; Park, InWha; Hwang, Jae Sam; Na, MinKyun; Bae, Jong-Sup
2017-11-01
Tenebrio molitor is an edible insect that has antimicrobial, anticancer, and antihypertensive effects. The aim of this study was to identify the unreported bioactive compounds from T. molitor larvae with inhibitory activities against factor Xa (FXa) and platelet aggregation. Isolated compounds were evaluated for their anti-FXa and anti-platelet aggregation properties by monitoring clotting time, platelet aggregation, FXa activity, and thrombus formation. A diketopiperazine (1, cyclo( L -Pro- L -Tyr)) and a phenylethanoid (2, N-acetyltyramine) were isolated and inhibited the catalytic activity of FXa in a mixed inhibition model and inhibited platelet aggregation induced by adenosine diphosphate (ADP) and U46619. They inhibited ADP- and U46619-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) and the expression of P-selectin and PAC-1 in platelets. They also improved the production of nitric oxide and inhibited the oversecretion of endothelin-1 compared to that of the ADP- or U46619-treated group. In an animal model of arterial and pulmonary thrombosis, the isolated compounds showed enhanced antithrombotic effects. They also elicited anticoagulant effects in mice. Compounds 1-2 inhibited ADP-, collagen-, or U46619-induced platelet aggregation and showed similar anti-thrombotic efficacy to rivaroxaban, a positive control. Therefore, 1-2 could serve as candidates and provide scaffolds for the development of new anti-FXa and anti-platelet drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.
Study of the $e^+ e^- \\to Z\\gamma\\gamma \\to q\\overline{q}\\gamma\\gamma$ Process at LEP
Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.
2001-01-01
The process e^+e^- -> Z gamma gamma -> q q~ gamma gamma$ is studied in 0.5\\,fb-1$ of data collected with the L3 detector at centre-of-mass energies between 130.1 GeV and 201.7 GeV. Cross sections are measured and found to be consistent with the Standard Model expectations. The study of the least energetic photon constrains the quartic gauge boson couplings to -0.008 GeV-2 < a_0/\\Lambda^2 < 0.005 GeV-2 and -0.007 GeV-2 < a_c/\\Lambda^2 < 0.011 GeV-2, at 95% confidence level.
System for gamma-gamma formation density logging while drilling
International Nuclear Information System (INIS)
Paske, W.C.
1991-01-01
The patent relates to a system for logging subterranean formations for the determination of formation density by using gamma radiation. Gamma ray source and detection means are disposed within a housing adapted for positioning within a borehole for the emission and detection of gamma rays propagating through earth formations and borehole drilling fluid. The gamma ray detection means comprises first and second gamma radiation sensors geometrically disposed within the housing, the same longitudinal distance from the gamma ray source and diametrically opposed in a common plane. A formation matrix density output signal is produced in proportion to the output signal from each of the gamma ray sensors and in conjunction with certain constants established by the geometrical configuration of the sensors relative to the gamma ray source and the borehole diameter. Formation density is determined without regard to the radial position of the logging probe within the borehole in a measuring while drilling mode. 6 figs
The Factor of Structure and Mechanical Properties in the Production of Critical Fixing Hardware 38XA
Directory of Open Access Journals (Sweden)
G.V. Pachurin
2016-09-01
Full Text Available Fixing hardware made of carbon, high-carbon, and alloyed wires is one of the widespread critical parts in mechanical engineering. The characteristics of fixtures and fasteners and their performance figures are assessed at all stages of steel-making operation, from the choice of burden stock for metal smelting to the method of preparing calibrated rolled metal parts and upsetting end products. Material used for producing long high-duty bolts must be both sufficiently strong and ductile, have homogeneous mechanical properties and chemistry, and no inner or surface defects. When manufacturing fasteners, hot-rolled metal is often plastically deformed by drafting before cold upsetting, and all unacceptable defects are removed by the expensive procedure of lathe-turning. Moreover, this technology of metal processing entails losses of up to 5.5 % in chips. This paper suggests a resource-efficient and environmentally friendlier fabrication method for calibrated rolled metal items made of steel 38XA, 9.65 mm diameter, for cold die-forging of high-duty bolts used in automotive engines, which helps spare expensive lathe-machining processes. Moreover, rolled steel produced using this technology is characterized by high resistance to plastic deformation when cold, which leads to increase n wear-resistance of tools in cold die-forging of bolts.
International Nuclear Information System (INIS)
Kroger, H.; Reiche, I.
2009-01-01
TN International has applied for a license for the TN 24 E transport and storage cask with the German competent authority using a new Burn-up Credit (BUC) approach for PWR uranium oxide fuel assemblies based on actinides and six selected fission products. In order to enable the use of BUC for fission products, various experimental data have to be provided for the two important aspects of the criticality calculation. Firstly, post-irradiation examination (PIE) experiments for the verification of the calculated fission product concentrations have to be provided for each selected fission product. These data are then used to validate the depletion calculations. Secondly, experimental data for the criticality calculations in the form of critical benchmark experiments have to be provided. The submitted data will be investigated for their applicability to the TN 24 E transport and storage cask. Since the application is limited to six fission products only, the conservatism of the BUC approach can be further justified, as the reduction in reactivity from the remaining fission products (about 190) is not taken credit for. (authors)
Needs of reliable nuclear data and covariance matrices for Burnup Credit in JEFF-3 library
International Nuclear Information System (INIS)
Chambon, A.; Santamarina, A.; Riffard, C.; Lavaud, F.; Lecarpentier, D.
2013-01-01
Burnup Credit (BUC) is the concept which consists in taking into account credit for the reduction of nuclear spent fuel reactivity due to its burnup. In the case of PWR-MOx spent fuel, studies pointed out that the contribution of the 15 most absorbing, stable and non-volatile fission products selected to the credit is as important as the one of the actinides. In order to get a 'best estimate' value of the keff, biases of their inventory calculation and individual reactivity worth should be considered in criticality safety studies. This paper enhances the most penalizing bias towards criticality and highlights possible improvements of nuclear data for the 15 fission products (FPs) of PWR-MOx BUC. Concerning the fuel inventory, trends in function of the burnup can be derived from experimental validation of the DARWIN-2.3 package (using the JEFF- 3.1.1/SHEM library). Thanks to the BUC oscillation programme of separated FPs in the MINERVE reactor and fully validated scheme PIMS, calculation over experiment ratios can be accurately transposed to tendencies on the FPs integral cross sections. (authors)
Very high-energy gamma rays from gamma-ray bursts.
Chadwick, Paula M
2007-05-15
Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.
Transporting existing VSC-24 canisters using a risk-based licensing approach
Energy Technology Data Exchange (ETDEWEB)
Srinivasan, R.; Sisley, S.E.; Hopf, J.E. [BNFL Fuel Solutions, Campbell, CA (United States)
2004-07-01
The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads.
Transporting existing VSC-24 canisters using a risk-based licensing approach
International Nuclear Information System (INIS)
Srinivasan, R.; Sisley, S.E.; Hopf, J.E.
2004-01-01
The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads
Cross-Section of Hadron Production in $\\gamma\\gamma$ Collisions at LEP
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
The reaction $\\mathrm{e}^{+} \\mathrm{e}^{-} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} \\gamma ^{*} \\gamma ^{*} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} $ {\\sl hadrons} is analysed using data collected by the L3 detector during the LEP runs at $\\sqrt {s}$ = 130-140 GeV and $\\sqrt {s}$ = 161 GeV. The cross sections $\\sigma(\\mathrm{e}^{+} \\mathrm{e}^{-} \\rightarrow \\mathrm{e}^{+} \\mathrm{e}^{-} $ {\\sl hadrons}) and $\\sigma (\\gamma\\gamma \\rightarrow $ {\\sl hadrons}) are measured in the interval 5 $\\leq W_{\\gamma\\gamma} \\leq$ 75 GeV. The energy dependence of the $\\sigma (\\gamma\\gamma \\rightarrow $ {\\sl hadrons}) cross section is consistent with the universal Regge behaviour of total hadronic cross sections. %\\end{abstract}
... News Physician Resources Professions Site Index A-Z Gamma Knife Gamma Knife® is a radiation therapy that uses computerized ... If you're scheduled for radiation therapy using Gamma Knife®, a treatment team consisting of a radiation ...
International Nuclear Information System (INIS)
Majorowicz, J.
1973-01-01
In this article, the author presents the possibility of a complex utilization of radiometric logging methods, neutron-gamma profiling and gamma-gamma density logging for determining percentage of iron and establishing geophysical possibilities of identifying zones of economically profitable ores in borehole profiles. Figures present the correlations between indices of neutron-gamma and gamma-gamma logging methods and the percentage of iron, as well as the correlation of neutron-gamma and gamma-gamma indices for zones minerallized with iron ores. The article presents the correlational analyses of the results: the correlational coefficients are given as well as total error in determining iron content on the basis of each of the methods described. Next, a multidimensional statistical analysis is carried out on the results obtained. On the basis of the two-dimensional correlational coefficients calculated and the average standard deviation, an equation of linear regression was formulated, simultaneously involving three parameters - the indices of neutron-gamma and gamma-gamma logging and the percentage of iron. The multiple correlational coefficient obtained markedly exceeds the two-dimentional correlation coefficient (r=0.974>rsub(xz)>rsub(yz)>rsub(xy)). The given method of utilizing multidimensional statistics in borehole geophysics for identifying iron ores is an efficient one. On the basis of several relationships among independent variables which are less obvious (smaller values of correlational coefficient), it is possible to obtain a single distinct relationship involving all variables simultaneously. (author)
Low-temperature magnetic ordering in the perovskites Pr 1-xA xCoO 3 (A=Ca, Sr)
Deac, Iosif G.; Tetean, Romulus; Balasz, Istvan; Burzo, Emil
2010-05-01
The magnetic and electrical properties of polycrystalline Pr 1-xA xCoO 3 cobaltites with A=Ca, Sr and 0≤ x≤0.5 were studied in the temperature range 4 K≤ T≤1000 K and field up to 7 T. The X-ray analyses show the presence of only one phase having monoclinic or orthorhombic symmetry. The magnetic measurements indicate that the Ca-doped samples have at low temperatures, similar properties to the frustrated magnetic materials. PrCoO 3 is a paramagnetic insulator in the range from 4 to 1000 K. The Sr-doped cobaltites exhibit two phase transitions: a paramagnetic-ferromagnetic (or magnetic phase separated state) phase transition at about 240 K and a second one at about 100 K. The magnetic measurements suggest the presence of magnetic clusters and a change in the nature of magnetic coupling between Co ions at low temperatures. A semiconducting type behavior and high negative magnetoresistance was found for the Ca-doped samples, while the Sr-doped ones were metallic and with negligible magnetoresistance. The results are analyzed in the frame of a phase separation scenario in the presence of the spin-state transitions of Co ions.
The high intensity {gamma}-ray source (HI{gamma}S) and recent results
Energy Technology Data Exchange (ETDEWEB)
Tonchev, A.P. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States)]. E-mail: tonchev@tunl.duke.edu; Boswell, M. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Howell, C.R. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Karwowski, H.J. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Kelley, J.H. [North Carolina State University and TUNL, Raleigh, NC 27695 (United States); Tornow, W. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Wu, Y.K. [Duke University and Duke Free Electron Laser Laboratory, Durham, NC 27708-0319 (United States)
2005-12-15
The high intensity {gamma}-ray source (HI{gamma}S) utilizes intra-cavity backscattering of free electron laser photons from the Duke electron storage ring to produce a unique monoenergetic beam of high-flux {gamma}-rays with high polarization and selectable energy resolution. At present, {gamma}-ray beams with energies from 2 to 58 MeV are available with intensities as high as 10{sup 5}-5 x 10{sup 6} {gamma}/s, energy spreads of 3% or better, and nearly 100% linear polarization. The quality and intensity of the {gamma}-ray beams at HI{gamma}S are responsible for the unprecedented performance of this facility in a broad range of research programs in nuclear structure, nuclear astrophysics and nuclear applications. Recent results from excitation of isomeric states in ({gamma}, n) reactions and parity assignments of dipole states determined via the ({gamma}, {gamma}') reaction are presented.
Study of {gamma}'s in Naiade; Etude des gamma de Naiade
Energy Technology Data Exchange (ETDEWEB)
Millot, J P; Rastoin, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
Following a study of the gamma sources, the flux of gamma of different energies in the swimming pool is investigated. The biological dose can thus be obtained by calculation, and compared with the results given by photographic plates. The influence of photoneutrons is estimated by calculation, and research is being carried out on their influence on the thermal neutron flux curve on the axis of the uranium plate, with the plate emitting neutrons and with the plate protected by boral. (author) [French] Apres l'etude des sources de gamma, l'on etudie le flux de gamma de differentes energies dans la piscine. La dose biologique peut etre obtenue ainsi par le calcul et comparee avec les resultats donnes par les plaques photographiques. L'influence des photoneutrons est estimee par le calcul et l'on recherche leur influence sur la courbe de flux de neutrons thermiques sur l'axe de la plaque d'uranium, la plaque emettant des neutrons et la plaque protegee par du boral. (auteur)
Measurement of K{sup {+-}}{yields}{pi}{sup {+-}}{gamma}{gamma} decays
Energy Technology Data Exchange (ETDEWEB)
Morales Morales, Cristina
2009-07-21
The goal of this thesis was an experimental test of an effective theory of strong interactions at low energy, called Chiral Perturbation Theory (ChPT). Weak decays of kaon mesons provide such a test. In particular, K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} decays are interesting because there is no tree-level O(p{sup 2}) contribution in ChPT, and the leading contributions start at O(p{sup 4}). At this order, these decays include one undetermined coupling constant, c. Both the branching ratio and the spectrum shape of K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} decays are sensitive to this parameter. O(p{sup 6}) contributions to K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} ChPT predict a 30-40% increase in the branching ratio. From the measurement of the branching ratio and spectrum shape of K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} decays, it is possible to determine a model dependent value of c and also to examine whether the O(p{sup 6}) corrections are necessary and enough to explain the rate. About 40% of the data collected in the year 2003 by the NA48/2 experiment have been analyzed and 908 K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} candidates with about 8% background contamination have been selected in the region with z=m{sup 2}{sub {gamma}}{sub {gamma}}/m{sub K}{sup 2}{>=}0.2. Using 5,750,121 selected K{sup {+-}} {yields} {pi}{sup {+-}}{pi}{sup 0} decays as normalization channel, a model independent differential branching ratio of K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma} has been measured to be: BR(K{sup {+-}} {yields} {pi}{sup {+-}}{gamma}{gamma}, z{>=}0.2)=(1.018{+-}0.038{sub stat}{+-}0.039{sub syst}{+-}0.004{sub ext}).10{sup -6}. From the fit to the O(p{sup 6}) ChPT prediction of the measured branching ratio and the shape of the z-spectrum, a value of c=1.54{+-}0.15{sub stat}{+-}0.18{sub syst} has been extracted. Using the measured c value and the O(p{sup 6}) ChPT prediction, the branching ratio for z=m{sup 2}{sub
Firestone, Richard B; Reijonen, Jani
2014-05-27
An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.
International Nuclear Information System (INIS)
Ramebaeck, H.; Straelberg, E.; Klemola, S.; Nielsen, Sven P.; Palsson, S.E.
2012-01-01
Due to a sparse interaction during the last years between practioners in gamma ray spectrometry in the Nordic countries, a NKS activity was started in 2009. This GammaSem was focused on seminars relevant to gamma spectrometry. A follow up seminar was held in 2010. As an outcome of these activities it was suggested that the 2011 meeting should be focused on practical issues, e.g. different corrections needed in gamma spectrometric measurements. This three day's meeting, GammaWorkshops, was held in September at Risoe-DTU. Experts on different topics relevant for gamma spectrometric measurements were invited to the GammaWorkshops. The topics included efficiency transfer, true coincidence summing corrections, self-attenuation corrections, measurement of natural radionuclides (natural decay series), combined measurement uncertainty calculations, and detection limits. These topics covered both lectures and practical sessions. The practical sessions included demonstrations of tools for e.g. corrections and calculations of the above meantioned topics. (Author)
Energy Technology Data Exchange (ETDEWEB)
Ramebaeck, H. (ed.) (Swedish Defence Research Agency (Sweden)); Straalberg, E. (Institute for Energy Technology, Kjeller (Norway)); Klemola, S. (Radiation and Nuclear Safety Authority, STUK (Finland)); Nielsen, Sven P. (Technical Univ. of Denmark. Risoe National Lab. for Sustainable Energy, Roskilde (Denmark)); Palsson, S.E. (Icelandic Radiation Safety Authority (Iceland))
2012-01-15
Due to a sparse interaction during the last years between practioners in gamma ray spectrometry in the Nordic countries, a NKS activity was started in 2009. This GammaSem was focused on seminars relevant to gamma spectrometry. A follow up seminar was held in 2010. As an outcome of these activities it was suggested that the 2011 meeting should be focused on practical issues, e.g. different corrections needed in gamma spectrometric measurements. This three day's meeting, GammaWorkshops, was held in September at Risoe-DTU. Experts on different topics relevant for gamma spectrometric measurements were invited to the GammaWorkshops. The topics included efficiency transfer, true coincidence summing corrections, self-attenuation corrections, measurement of natural radionuclides (natural decay series), combined measurement uncertainty calculations, and detection limits. These topics covered both lectures and practical sessions. The practical sessions included demonstrations of tools for e.g. corrections and calculations of the above meantioned topics. (Author)
ATLAS searches for VH, HH, VV, V+$\\gamma$/$\\gamma\\gamma$ resonances
AUTHOR|(INSPIRE)INSPIRE-00441490; The ATLAS collaboration
2017-01-01
The discovery of a Higgs boson at the Large Hadron Collider motivates searches for physics beyond the Standard Model in channels involving coupling to the Higgs boson. A search for massive resonances decaying into couples of bosons is described. The considered final states are: $HH$, $VH$, $VV$, $V\\gamma$ and $\\gamma\\gamma$ with $V$ indicating either the $W$ or the $Z$ boson. Final states with different number of leptons or photons and where, in many cases, at least one Higgs decays into a b-quark pair are studied using different jet reconstruction techniques which allow to optimize the signal acceptance for low or high Higgs boson transverse momentum. The most recent diboson resonance searches using LHC Run 2 data are described.
International Nuclear Information System (INIS)
Kheymits, M D; Leonov, A A; Zverev, V G; Galper, A M; Arkhangelskaya, I V; Arkhangelskiy, A I; Yurkin, Yu T; Bakaldin, A V; Suchkov, S I; Topchiev, N P; Dalkarov, O D
2016-01-01
The GAMMA-400 gamma-ray space-based telescope has as its main goals to measure cosmic γ-ray fluxes and the electron-positron cosmic-ray component produced, theoretically, in dark-matter-particles decay or annihilation processes, to search for discrete γ-ray sources and study them in detail, to examine the energy spectra of diffuse γ-rays — both galactic and extragalactic — and to study gamma-ray bursts (GRBs) and γ-rays from the active Sun. Scientific goals of GAMMA-400 telescope require fine angular resolution. The telescope is of a pair-production type. In the converter-tracker, the incident gamma-ray photon converts into electron-positron pair in the tungsten layer and then the tracks are detected by silicon- strip position-sensitive detectors. Multiple scattering processes become a significant obstacle in the incident-gamma direction reconstruction for energies below several gigaelectronvolts. The method of utilising this process to improve the resolution is proposed in the presented work. (paper)
Observations of the highest energy gamma-rays from gamma-ray bursts
International Nuclear Information System (INIS)
Dingus, Brenda L.
2001-01-01
EGRET has extended the highest energy observations of gamma-ray bursts to GeV gamma rays. Such high energies imply the fireball that is radiating the gamma-rays has a bulk Lorentz factor of several hundred. However, EGRET only detected a few gamma-ray bursts. GLAST will likely detect several hundred bursts and may extend the maximum energy to a few 100 GeV. Meanwhile new ground based detectors with sensitivity to gamma-ray bursts are beginning operation, and one recently reported evidence for TeV emission from a burst
Design and Performance of the GAMMA-400 Gamma-Ray Telescope for Dark Matter Searches
Galper, A. M.; Adriani, O.; Aptekar, R. L.; Arkhangelskaja, I. V.; Arkhangelskiy, A. I.; Boezio, M.; Bonvicini, V.; Boyarchuk, K. A.; Fradkin, M. I.; Gusakov, Yu V.;
2012-01-01
The GAMMA-400 gamma-ray telescope is designed to measure the fluxes of gamma-rays and cosmic-ray electrons (+) positrons, which can be produced by annihilation or decay of the dark matter particles, as well as to survey the celestial sphere in order to study point and extended sources of gamma-rays, measure energy spectra of Galactic and extragalactic diffuse gamma-ray emission, gamma-ray bursts, and gamma-ray emission from the Sun. GAMMA-400 covers the energy range from 100 MeV to 3000 GeV. Its angular resolution is approximately 0.01deg (E(sub gamma) greater than 100 GeV), the energy resolution approximately 1% (E(sub gamma) greater than 10 GeV), and the proton rejection factor approximately 10(exp 6). GAMMA-400 will be installed on the Russian space platform Navigator. The beginning of observations is planned for 2018.
Total Cross Section in $\\gamma\\gamma$ Collisions at LEP
Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.
2001-01-01
The reaction e+e- -> e+e- gamma* gamma* -> e+e- hadrons for quasi-real photons is studied using data from root(s) = 183 GeV up to 202 GeV. Results on the total cross sections sigma(e+e- -> e+e- hadrons) and sigma(+e- gamma* gamma* -> e+e- hadrons) are given for the two-photon centre-of-mass energies 5 GeV < Wgammagamma < 185 GeV. The total cross section of two real photons is described by a Regge parametrisation. We observe a steeper rise with the two-photon centre-of-mass energy as compared to the hadron-hadron and the photon-proton cross sections. The data are also compared to the expectations of different theoretical models.
International Nuclear Information System (INIS)
Broomhead, Laurent.
1980-01-01
The nuclear gamma astronomy is presented, in particular the Gamma Ray Observatory, an enormous eight tonnes machine fitted with gamma telescopes, scheduled for launching around 1985. It is thereby hoped to study the natural nuclear reactions which occur when stars explode [fr
Doubly heavy baryon production at {gamma}{gamma} collider
Energy Technology Data Exchange (ETDEWEB)
Li Shiyuan [Department of Physics, Shandong University, Jinan 250100 (China)]. E-mail: lishy@sdu.edu.cn; Si Zongguo [Department of Physics, Shandong University, Jinan 250100 (China)]. E-mail: zgsi@sdu.edu.cn; Yang Zhongjuan [Department of Physics, Shandong University, Jinan 250100 (China)]. E-mail: yangzhongjuan@mail.sdu.edu.cn
2007-05-10
The inclusive production of doubly heavy baryons {xi}{sub cc} and {xi}{sub bb} at {gamma}{gamma} collider is investigated. It is found that the contribution from the heavy quark pair QQ in color triplet and color sextet are important.
GammaSem Proceedings. A Nordic seminar for users of gamma spectrometry
Energy Technology Data Exchange (ETDEWEB)
Straalberg, E. (ed.) (Institute for Energy Technolgy (Norway)); Berg, K. (National Institute of Radiation Protection (Denmark)); Dowdall, M. (Norwegian Radiation Protection Authority (Norway)) (and others)
2010-11-15
The project GammaSem was proposed to the NKS in 2008. The aim of the project was to arrange two seminars for users of gamma spectrometry, in 2009 and 2010. The seminars were meant to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and initiate a network of gamma spectrometry users in the Nordic countries. Such a Nordic network should strengthen the collaboration between laboratories and improve all participants' competence in practical gamma spectrometry. Both seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 65 people signed up for GammaSem 2010; representing 30 different universities, commercial companies, research institutes and authorities. The working group concept as presented at last year's GammaSem, has not worked out as intended. The reason for this is probably because most of the laboratories that signed up to join the working groups, signed up because they wanted to learn more about the different subjects. In combination with the fact that no funding was made available for the working groups, it was difficult to establish goals on what to achieve. None of the working groups applied for funding from the NKS (or elsewhere) to establish separate projects. There is a big need for more cooperation and for training within the field of gamma spectrometry. This fact has been proved through these two seminars, both by the many different topics that have been discussed, but also by the huge interest for participating in the suggested series of workshop. The GammaSem seminars have thus provided a much welcomed starting point for a broader Nordic collaboration. (Author)
GammaSem Proceedings. A Nordic seminar for users of gamma spectrometry
International Nuclear Information System (INIS)
Straelberg, E.; Berg, K.; Dowdall, M.
2010-11-01
The project GammaSem was proposed to the NKS in 2008. The aim of the project was to arrange two seminars for users of gamma spectrometry, in 2009 and 2010. The seminars were meant to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and initiate a network of gamma spectrometry users in the Nordic countries. Such a Nordic network should strengthen the collaboration between laboratories and improve all participants' competence in practical gamma spectrometry. Both seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 65 people signed up for GammaSem 2010; representing 30 different universities, commercial companies, research institutes and authorities. The working group concept as presented at last year's GammaSem, has not worked out as intended. The reason for this is probably because most of the laboratories that signed up to join the working groups, signed up because they wanted to learn more about the different subjects. In combination with the fact that no funding was made available for the working groups, it was difficult to establish goals on what to achieve. None of the working groups applied for funding from the NKS (or elsewhere) to establish separate projects. There is a big need for more cooperation and for training within the field of gamma spectrometry. This fact has been proved through these two seminars, both by the many different topics that have been discussed, but also by the huge interest for participating in the suggested series of workshop. The GammaSem seminars have thus provided a much welcomed starting point for a broader Nordic collaboration. (Author)
Directory of Open Access Journals (Sweden)
Yahia Ashour Mohammed AlKhoudary
2015-11-01
Full Text Available This study explores the role of writing in developing students’ critical thinking. It also sheds light on traditional writing assignments which fail to help students develop their comprehension of course content and evaluate their writing products critically. Moreover, this probe is to discover learners and teachers’ attitude towards the role of critical thinking in promoting the writing skills at AlBuraimi University College (BUC. The result of this study focuses on the effect of integrating critical thinking on learners’ performance. The procedure of this investigation is based on a combination of qualitative, quantitative (1 one hundred students who are taking writing course are selected randomly and divided into two groups; (2 pre- and posttests conducted to both groups; (3 twenty teachers were selected randomly (10 males and 10 females; questionnaires are administered to EFL teachers at BUC. The findings of this study illustrate that students who write critically are mostly motivated and their performance is affected positively. It also reveals that there are significant differences in posttest scores between treatment and controlled group. Moreover, teachers’ response to questionnaire supports the idea of integrating critical thinking in teaching the writing skills at BUC. Thus, is recommended that teachers should use thinking skills to enhance students’ writing performance and creativity.
Pathotype profile of Xanthomonas oryzae pv. oryzae isolates from North Sumatera
Noer, Z.; Hasanuddin; Lisnawita; Suryanto, D.
2018-02-01
The Bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo) is one of the most important diseases and has caused crop failure in rice crops. This pathogen infects the leaves in all plant growth phases. The purpose of this study is to investigation 10 Xoo isolates pathotype obtained from North Sumatra based on their interactions with 10 near-isogenic rice lines (NIL) of IRRI. The results showed that there are 6 pathotypes of virulence in North Sumatra, they are; pathotype I with incompatible interaction to all Xa genes, pathotype II with compatible interaction to Xa1 and Xa3 genes, while it has incompatible interaction to other genes, pathotype III with compatible interaction to Xa1, Xa5, Xa7, Xa8, Xa10 and Xa11 genes, but it has incompatible interaction to other genes, pathotype IV with compatible interaction to all Xa genes, pathotype V with compatible interaction to Xa1 gene and incompatible interaction to other genes, and pathotype VI with compatible interaction to Xa3 gene and incompatible interaction to other genes. Based on the resistant genes in each individual Xa2, Xa4, and Xa21 genes are the combination of Xa genes which are most suitable for use in the development of rice cultivars in North Sumatra.
Goulding, N J; Knight, S M; Godolphin, J L; Guyre, P M
1992-04-01
The therapeutic potential of interferon gamma (IFN gamma) in a number of disease states is still being explored, but progress is hampered by the lack of a suitable measure of in vivo biological activity. To assess the in vivo biological effects of recombinant human IFN gamma (rhIFN gamma), 14 patients were studied in a randomised, prospective, double blind, placebo controlled trial of this cytokine for the treatment of rheumatoid arthritis. The levels of Fc gamma receptors on peripheral blood neutrophils were measured at baseline and after 21 days of once daily, subcutaneous injections of rhIFN gamma or placebo. An induction of neutrophil Fc gamma receptor type I (Fc gamma RI) was seen in the group of patients receiving recombinant human rhIFN gamma but not in those receiving placebo. No change in the expression of Fc gamma RII or Fc gamma RIII was detected. The amount of induction of Fc gamma RI detected on the neutrophils of patients receiving rhIFN gamma did not correlate with clinical measures of response at either 21 days or at the end of the study (24 weeks). No significant clinical responses were observed in the rhIFN gamma group at these times. These data confirm that the reported in vitro effect of IFN gamma on human neutrophil Fc receptor expression can be reproduced in vivo.
Energy Technology Data Exchange (ETDEWEB)
Afanasev, A. [Continuous Electron Beam Accelerator Facility, Newport News, VA (United States)
1994-04-01
The author discusses possibilities to study {gamma}*{pi}{sup 0} and {gamma}*{eta} {r_arrow} {gamma} transition form factors at CEBAF energies. The author shows that for 4 GeV electron beam, these form factors can be measured at CEBAF for the 4-momentum transfers Q{sup 2} {le} 2.5 (GeV/c){sup 2} using virtual Compton scattering on the proton and nuclear target in the kinematic regime of low momentum transfers to the target. These measurements can be extended to Q{sup 2} {le} 4.0 (GeV/c){sup 2} using the electron beam with the energy 6 GeV.
Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, Michael; Doria, A; Dova, M T; Duchesneau, D; Echenard, B; Eline, A; El-Mamouni, H; Engler, A; Eppling, F J; Ewers, A; Extermann, Pierre; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hakobyan, R S; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Latt, J; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Palomares, C; Pandoulas, D; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R P; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wallraff, W; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M
2002-01-01
The cross section of the process e^+ e^- -> Z \\gamma\\gamma -> qq~ \\gamma \\gamma is measured with 215 pb^-1 of data collected with the L3 detector during the final LEP run at centre-of-mass energies around 205 GeV and 207 GeV. No deviation from the Standard Model expectation is observed. The full data sample of 713 pb^-1, collected above the Z resonance, is used to constrain the coefficients of anomalous quartic gauge boson couplings to: -0.02 GeV^-2 < a_0/\\Lambda^2 < 0.03 GeV^-2 and -0.07 GeV^-2 < a_c/\\Lambda^2 < 0.05 GeV^-2, at 95% confidence level.
QCD and $\\gamma\\,\\gamma$ studies at FCC-ee
Skands, Peter
2016-10-20
The Future Circular Collider (FCC) is a post-LHC project aiming at searches for physics beyond the SM in a new 80--100~km tunnel at CERN. Running in its first phase as a very-high-luminosity electron-positron collider (FCC-ee), it will provide unique possibilities for indirect searches of new phenomena through high-precision tests of the SM. In addition, by collecting tens of ab$^{-1}$ integrated luminosity in the range of center-of-mass energies $\\sqrt{s}$~=90--350~GeV, the FCC-ee also offers unique physics opportunities for precise measurements of QCD phenomena and of photon-photon collisions through, literally, billions of hadronic final states as well as unprecedented large fluxes of quasireal $\\gamma$'s radiated from the $\\rm e^+e^-$ beams. We succinctly summarize the FCC-ee perspectives for high-precision extractions of the QCD coupling, for detailed analyses of parton radiation and fragmentation, and for SM and BSM studies through $\\gamma\\gamma$ collisions.
Manion, Jill S; Thomason, John M; Langston, Vernon C; Claude, Andrew K; Brooks, Marjory B; Mackin, Andrew J; Lunsford, Kari V
2016-01-01
To evaluate the anticoagulant effects of inhaled heparin in dogs. This study was conducted in 3 phases. In phase 1, bronchoalveolar lavage fluid (BALf) was collected to generate an in vitro calibration curve to relate heparin concentration to the activated partial thromboplastin time (aPTT). In phase 2, heparin was administered via nebulization to determine the threshold dose needed to prolong systemic aPTT. In phase 3, the local anticoagulant activity of inhaled heparin was determined by measurement of BALf anti-Xa activity and aPTT. University teaching hospital. Six healthy intact female Walker Hounds were used in this study. Two dogs were used for each phase. Inhaled unfractionated sodium heparin was administered in doses ranging from 50,000 to 200,000 IU. In vitro addition of heparin to BALf caused a prolongation in aPTT. Inhaled heparin at doses as high as 200,000 IU failed to prolong systemic aPTT, and a threshold dose could not be determined. No significant local anticoagulant effects were detected. Even at doses higher than those known to be effective in people, inhaled heparin appears to have no detectable local or systemic anticoagulant effects in dogs with the current delivery method. © Veterinary Emergency and Critical Care Society 2015.
Graw, J; Liebstein, A; Pietrowski, D; Schmitt-John, T; Werner, T
1993-12-22
The murine genes, gamma B-cry and gamma C-cry, encoding the gamma B- and gamma C-crystallins, were isolated from a genomic DNA library. The complete nucleotide (nt) sequences of both genes were determined from 661 and 711 bp, respectively, upstream from the first exon to the corresponding polyadenylation sites, comprising more than 2650 and 2890 bp, respectively. The new sequences were compared to the partial cDNA sequences available for the murine gamma B-cry and gamma C-cry, as well as to the corresponding genomic sequences from rat and man, at both the nt and predicted amino acid (aa) sequence levels. In the gamma B-cry promoter region, a canonical CCAAT-box, a TATA-box, putative NF-I and C/EBP sites were detected. An R-repeat is inserted 366 bp upstream from the transcription start point. In contrast, the gamma C-cry promoter does not contain a CCAAT-box, but some other putative binding sites for transcription factors (AP-2, UBP-1, LBP-1) were located by computer analysis. The promoter regions of all six gamma-cry from mouse, rat and human, except human psi gamma F-cry, were analyzed for common sequence elements. A complex sequence element of about 70-80 bp was found in the proximal promoter, which contains a gamma-cry-specific and almost invariant sequence (crygpel) of 14 nt, and ends with the also invariant TATA-box. Within the complex sequence element, a minimum of three further features specific for the gamma A-, gamma B- and gamma D/E/F-cry genes can be defined, at least two of which were recently shown to be functional. In addition to these four sequence elements, a subtype-specific structure of inverted repeats with different-sized spacers can be deduced from the multiple sequence alignment. A phylogenetic analysis based on the promoter region, as well as the complete exon 3 of all gamma-cry from mouse, rat and man, suggests separation of only five gamma-cry subtypes (gamma A-, gamma B-, gamma C-, gamma D- and gamma E/F-cry) prior to species separation.
Directory of Open Access Journals (Sweden)
Pamela C. Ronald
2014-01-01
Full Text Available Tyrosine sulfation is an important posttranslational modification that determines the outcome of serious diseases in plants and animals. We have recently demonstrated that the plant pathogen Xanthomonas oryzae pv. oryzae (Xoo carries a functional sulfotransferase (RaxST. raxST is required for activation of rice Xa21-mediated immunity indicating the critical, but unknown, function of raxST in mediating the Xoo/rice interaction. The raxST gene resides in the same operon (raxSTAB as components of a predicted type I secretion and processing system (RaxA and RaxB. These observations suggest a model where RaxST sulfates a molecule that contains a leader peptide, which is cleaved by the peptidase domain of the RaxB protein and secreted outside the bacterial cell by the RaxABC T1SS.
Sirunyan, A.M.; Adam, Wolfgang; Aşılar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Krammer, Natascha; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krätschmer, Ilse; Liko, Dietrich; Matsushita, Takashi; Mikulec, Ivan; Rabady, Dinyar; Rad, Navid; Rahbaran, Babak; Rohringer, Herbert; Schieck, Jochen; Strauss, Josef; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Dvornikov, Oleg; Makarenko, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; Zykunov, Vladimir; Shumeiko, Nikolai; Alderweireldt, Sara; De Wolf, Eddi A; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; Daci, Nadir; De Bruyn, Isabelle; Deroover, Kevin; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Olbrechts, Annik; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Léonard, Alexandre; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Randle-conde, Aidan; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Salva Diblen, Sinem; Schöfbeck, Robert; Tytgat, Michael; Van Driessche, Ward; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caudron, Adrien; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Jafari, Abideh; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Vidal Marono, Miguel; Wertz, Sébastien; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Matos Figueiredo, Diego; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Moon, Chang-Seong; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Shopova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Cheng, Tongguang; Jiang, Chun-Hua; Leggat, Duncan; Liu, Zhenan; Romeo, Francesco; Ruan, Manqi; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; El-khateeb, Esraa; Elgammal, Sherif; Mohamed, Amr; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Abdulsalam, Abdulla; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Chapon, Emilien; Charlot, Claude; Davignon, Olivier; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Miné, Philippe; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Regnard, Simon; Salerno, Roberto; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Carrillo Montoya, Camilo Andres; Chierici, Roberto; Contardo, Didier; Courbon, Benoit; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Khvedelidze, Arsen; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Verlage, Tobias; Albert, Andreas; Brodski, Michael; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Olschewski, Mark; Padeken, Klaas; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Cherepanov, Vladimir; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Lingemann, Joschka; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Dolinska, Ganna; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Karacheban, Olena; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Roland, Benoit; Sahin, Mehmet Özgür; Saxena, Pooja; Schoerner-Sadenius, Thomas; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hoffmann, Malte; Junkes, Alexandra; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baur, Sebastian; Baus, Colin; Berger, Joram; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Fink, Simon; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Gilbert, Andrew; Goldenzweig, Pablo; Haitz, Dominik; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Röcker, Steffen; Roscher, Frank; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Kousouris, Konstantinos; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Loukas, Nikitas; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Triantis, Frixos A; Filipovic, Nicolas; Pasztor, Gabriella; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Mittal, Monika; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Sharma, Varun; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Kole, Gouranga; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Parida, Bibhuti; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Dewanjee, Ram Krishna; Ganguly, Sanmay; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Caputo, Claudio; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Monge, Maria Roberta; Robutti, Enrico; Tosi, Silvano; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; De Nardo, Guglielmo; Di Guida, Salvatore; Esposito, Marco; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Lanza, Giuseppe; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Michelotto, Michele; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Torassa, Ezio; Ventura, Sandro; Zanetti, Marco; Zotto, Pierluigi; Braghieri, Alessandro; Fallavollita, Francesco; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Saha, Anirban; Santocchia, Attilio; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Del Re, Daniele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Lee, Haneol; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Ryu, Geonmo; Ryu, Min Sang; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Lopez-Fernandez, Ricardo; Magaña Villalba, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Carpinteyro, Severiano; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khan, Wajid Ali; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Calpas, Betty; Di Francesco, Agostino; Faccioli, Pietro; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Chtchipounov, Leonid; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Murzin, Victor; Oreshkin, Vadim; Sulimov, Valentin; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chadeeva, Marina; Rusinov, Vladimir; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Barrio Luna, Mar; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Navarro De Martino, Eduardo; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Suárez Andrés, Ignacio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Curras, Esteban; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chen, Yi; Cimmino, Anna; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Di Marco, Emanuele; Dobson, Marc; Dorney, Brian; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fartoukh, Stephane; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Girone, Maria; Glege, Frank; Gulhan, Doga; Gundacker, Stefan; Guthoff, Moritz; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kieseler, Jan; Kirschenmann, Henning; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Neugebauer, Hannes; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Sauvan, Jean-Baptiste; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Steggemann, Jan; Stoye, Markus; Takahashi, Yuta; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Veres, Gabor Istvan; Verweij, Marta; Wardle, Nicholas; Wöhri, Hermine Katharina; Zagoździńska, Agnieszka; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Martinez Ruiz del Arbol, Pablo; Masciovecchio, Mario; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Rossini, Marco; Schönenberger, Myriam; Starodumov, Andrei; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Wallny, Rainer; Aarrestad, Thea Klaeboe; Amsler, Claude; Caminada, Lea; Canelli, Maria Florencia; De Cosa, Annapaola; Donato, Silvio; Galloni, Camilla; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Ngadiuba, Jennifer; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Seitz, Claudia; Yang, Yong; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Konyushikhin, Maxim; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chang, You-Hao; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Miñano Moya, Mercedes; Paganis, Efstathios; Psallidas, Andreas; Tsai, Jui-fa; Asavapibhop, Burin; Singh, Gurpreet; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Boran, Fatma; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Tali, Bayram; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Yetkin, Elif Asli; Yetkin, Taylan; Cakir, Altan; Cankocak, Kerem; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Sorokin, Pavel; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Dunne, Patrick; Elwood, Adam; Futyan, David; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Penning, Bjoern; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Jesus, Orduna; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Spencer, Eric; Syarif, Rizki; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Squires, Michael; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Weber, Matthias; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Shrinivas, Amithabh; Si, Weinan; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Holzner, André; Klein, Daniel; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Welke, Charles; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Mullin, Sam Daniel; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bendavid, Joshua; Bornheim, Adolf; Bunn, Julian; Lawhorn, Jay Mathew; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Apollinari, Giorgio; Apresyan, Artur; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Wu, Yujun; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Das, Souvik; Field, Richard D; Furic, Ivan-Kresimir; Konigsberg, Jacobo; Korytov, Andrey; Low, Jia Fu; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Shchutska, Lesya; Sperka, David; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Bein, Samuel; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Perry, Thomas; Prosper, Harrison; Santra, Arka; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Forthomme, Laurent; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Sanders, Stephen; Stringer, Robert; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Apyan, Aram; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Bierwagen, Katharina; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Krajczar, Krisztian; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kao, Shih-Chuan; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Malta Rodrigues, Alan; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Alyari, Maral; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Rupprecht, Nathaniel; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Lange, David; Luo, Jingyu; Marlow, Daniel; Medvedeva, Tatiana; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Svyatkovskiy, Alexey; Tully, Christopher; Malik, Sudhir; Barker, Anthony; Barnes, Virgil E; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Betchart, Burton; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Juska, Evaldas; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Sun, Xin; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Sturdy, Jared; Zaleski, Shawn; Belknap, Donald; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Pierro, Giuseppe Antonio; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel
2017-10-11
Measurements are presented of $ \\mathrm{ W \\gamma\\gamma } $ and $ \\mathrm{ Z \\gamma\\gamma } $ production in proton-proton collisions. Fiducial cross sections are reported based on a data sample corresponding to an integrated luminosity of 19.4 fb$^{-1}$ collected with the CMS detector at a center-of-mass energy of 8 TeV. Signal is identified through the $\\mathrm{ W } \\to \\ell\
Reactor gamma spectrometry: status
International Nuclear Information System (INIS)
Gold, R.; Kaiser, B.J.
1979-01-01
Current work is described for Compton Recoil Gamma-Ray Spectrometry including developments in experimental technique as well as recent reactor spectrometry measurements. The current status of the method is described concerning gamma spectromoetry probe design and response characteristics. Emphasis is given to gamma spectrometry work in US LWR and BR programs. Gamma spectrometry in BR environments are outlined by focussing on start-up plans for the Fast Test Reactor (FTR). Gamma spectrometry results are presented for a LWR pressure vessel mockup in the Poolside Critical Assembly (PCA) at Oak Ridge National Laboratory
Problems of calibrating measuring instruments for selective gamma-gamma logging
International Nuclear Information System (INIS)
Daniel, J.; Smolarova, H.
1977-01-01
Quantitative determination of copper content in the Novoveska Huta chalcopyrite deposit is described using selective gamma-gamma logging. Factors influencing the calibration quality are discussed. (author)
Gamma--gamma directional correlations and coincidence studies in /sup 154/Gd
Energy Technology Data Exchange (ETDEWEB)
Gupta, J B; Gupta, S L; Hamilton, J H; Ramayya, A V [Vanderbilt Univ., Nashville, Tenn. (USA). Dept. of Physics; Delhi Univ. (India). Ramjas Coll.)
1977-06-01
The intensities, placements and E2/M1 mixing ratios of transitions in the decay of /sup 154/Eu have been carefully studied to provide accurate data for microscopic calculations. Coincidence relationships in thhe decay of /sup 154/Eu have been studied extensively with a multiparameter ..gamma..-..gamma.. coincidence system with two large volume Ge(Li) detectors. Spectra in coincidence with twenty energy gates were analyzed. Twenty-nine new coincidence relationships were established and confirmed most, but not all, of several levels previously assigned by energy fits only. From an analysis of coincidence spectra and singles spectra with a 18% efficiency Ge(Li) detector new information on the gamma-ray intensities were obtained. Precise values of the E2/M1 mixing ratios of transitions from the gamma- and beta-vibrational bands to the g.s. band have been determined from ..gamma..-..gamma.. directional correlation measurements with a NaI(Tl)-Ge(Li) detector coincidence system. Mixing ratios were obtained for a number of other transitions including those from KPI = 0/sup -/ and 2+ bands from direct and skipped cascade correlations.
Directory of Open Access Journals (Sweden)
Hannu Olkkonen
2013-01-01
Full Text Available In this work we introduce a new family of splines termed as gamma splines for continuous signal approximation and multiresolution analysis. The gamma splines are born by -times convolution of the exponential by itself. We study the properties of the discrete gamma splines in signal interpolation and approximation. We prove that the gamma splines obey the two-scale equation based on the polyphase decomposition. to introduce the shift invariant gamma spline wavelet transform for tree structured subscale analysis of asymmetric signal waveforms and for systems with asymmetric impulse response. Especially we consider the applications in biomedical signal analysis (EEG, ECG, and EMG. Finally, we discuss the suitability of the gamma spline signal processing in embedded VLSI environment.
A normalisation for the four - detector system for gamma - gamma angular correlation studies
International Nuclear Information System (INIS)
Kiang, G.C.; Chen, C.H.; Niu, W.F.
1994-01-01
A normalisation method for the multiple - HPGe - detector system is described. The system consists of four coaxial HPGe detectors with a CAMAC event - by - event data acquisition system, enabling to measure six gamma -gamma coincidences of angles simultaneously. An application for gamma - gamma correlation studies of Kr 82 is presented and discussed. 3 figs., 6 refs. (author)
A method to describe inelastic gamma field distribution in neutron gamma density logging.
Zhang, Feng; Zhang, Quanying; Liu, Juntao; Wang, Xinguang; Wu, He; Jia, Wenbao; Ti, Yongzhou; Qiu, Fei; Zhang, Xiaoyang
2017-11-01
Pulsed neutron gamma density logging (NGD) is of great significance for radioprotection and density measurement in LWD, however, the current methods have difficulty in quantitative calculation and single factor analysis for the inelastic gamma field distribution. In order to clarify the NGD mechanism, a new method is developed to describe the inelastic gamma field distribution. Based on the fast-neutron scattering and gamma attenuation, the inelastic gamma field distribution is characterized by the inelastic scattering cross section, fast-neutron scattering free path, formation density and other parameters. And the contribution of formation parameters on the field distribution is quantitatively analyzed. The results shows the contribution of density attenuation is opposite to that of inelastic scattering cross section and fast-neutron scattering free path. And as the detector-spacing increases, the density attenuation gradually plays a dominant role in the gamma field distribution, which means large detector-spacing is more favorable for the density measurement. Besides, the relationship of density sensitivity and detector spacing was studied according to this gamma field distribution, therefore, the spacing of near and far gamma ray detector is determined. The research provides theoretical guidance for the tool parameter design and density determination of pulsed neutron gamma density logging technique. Copyright © 2017 Elsevier Ltd. All rights reserved.
On the possible effects of gluon number fluctuations on {gamma}{gamma} collisions at high energies
Energy Technology Data Exchange (ETDEWEB)
Goncalves, V. P.; De Santana Amaral, J. T. [Instituto de Fisica e Matematica, Universidade Federal de Pelotas, Caixa Postal 354, 96010-900, Pelotas, RS (Brazil)
2013-03-25
We investigate the effects of the fluctuations on the total {gamma}{gamma}, {gamma}*{gamma}* cross sections and the real photon structure function F{sup {gamma}}{sub 2}(x,Q{sup 2}), considering a saturation phenomenological model for the dipole-dipole cross section and scattering amplitude with fluctuations included.
Triggering $B_s^0 \\to \\gamma\\gamma$ at LHCb
Benson, Sean
2018-01-01
The trigger strategy used in the search for the $B_s^0 \\to \\gamma\\gamma$ decay in Run 2 is described. A sample of data is also provided, corresponding to 80 pb$^{−1}$ of diphoton candidates collected in 2015.
International Nuclear Information System (INIS)
Fichtel, C.E.
1975-01-01
The first certain detection of celestial high energy gamma rays came from a satellite experiment flown on the third Orbiting Solar Observatory (OSO-111). A Gamma ray spark chamber telescope with substantively greater sensitivity and angular resolution (a few degrees) flown on the second Small Astronomy Satellite (SAS-II) has now provided a better picture of the gamma ray sky, and particularly the galactic plane and pulsars. This paper will summarize the present picture of gamma ray astronomy as it has developed at this conference from measurements made with experiments carried out on balloons, those remaining on the ground, and ones flown on satellites. (orig.) [de
Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg
2014-01-01
The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2-3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban.
Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg
2014-01-01
The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2–3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban. PMID:25426077
GammaLog Playback 1.0 - mobile gamma ray spectrometry software
International Nuclear Information System (INIS)
Watson, R.J.; Smethurst, M.A.
2011-01-01
The Geological Survey of Norway (NGU) operates a mobile gamma ray spectrometer system which can be used in nuclear emergency situations to determine the location and type of orphan sources, or the extent and type of fallout contamination. The system consists of a 20 litre (16 litre downward and 4 litre upward looking) RSX-5 NaI detector and spectrometer, and can be mounted in fixed wing aircraft, helicopters, or vans/cars as appropriate. NGU has developed its own data acquisition and analysis software for this system. GammaLog (Smethurst 2005) controls the acquisition, display, and storage of data from the spectrometer, and performs real-time data analysis including estimation of dose rates and fallout concentrations, and separation of geological and anthropogenic components of the signal. The latter is particularly important where the geological radioisotope signal varies strongly from one place to another, and makes it easier to locate and identify anthropogenic sources which might otherwise be difficult to separate from the geological background signal. A modified version of GammaLog has been developed, GammaLog Playback, which allows the replay of previously acquired GammaLog datasets, while performing similar processing and display as the GammaLog acquisition software. This allows datasets to be reviewed and compared in the field or during post-survey analysis to help plan subsequent measurement strategies.(Au)
Data of evolutionary structure change: 1BUCA-3MDEA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1BUCA-3MDEA 1BUC 3MDE A A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...> A 3MDEA RSDPDPKAPAS...E A 3MDEA IEANT-LGQVP 2 3MDE A 3MDEA
Block, Martin M
2002-01-01
Using an eikonal structure for the scattering amplitude, factorization theorems for nucleon-nucleon, gamma p and gamma gamma scattering at high energies have been derived, using only some very general assumptions. Using a QCD-inspired eikonal analysis of nucleon-nucleon scattering, we present here experimental confirmation for factorization of cross sections, nuclear slope parameters B and rho -values (ratio of real to imaginary portion of forward scattering amplitudes), showing that: 1) the three factorization theorems of Block and Kaidalov [2000] hold, 2) the additive quark model holds to approximately=1%, and 3) vector dominance holds to better than approximately=4%. Predictions for the total cross section, elastic cross section and other forward scattering parameters at the LHC (14 TeV) are given. (12 refs).
Gamma spectrometry on MANITU 271-01 gamma scan wires
International Nuclear Information System (INIS)
Dassel, G.; Buurveld, H.A.; Minkema, J.
1994-08-01
A series of irradiation experiments (271-series) is being performed of the sustain programme for material development and characterization of the NET (Next European Torus). In the framework of the first irradiation experiment 271-01, with irradiation up to 0.2 dpa, four gamma scan wires have been examined by gamma scanning. The purpose of the gamma scan wires (GSW) is to get information about the neutron fluence distribution in the capsules during irradiation. In the stainless steel wires the nuclides Co-58, Mu-54, Fe-59 and Co-60 are produced, are characteristic for fast and thermal neutron reactions. (orig./HP)
Energy Technology Data Exchange (ETDEWEB)
Stinnett, Jacob [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Venkataraman, Ram [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-09-13
The objective of this training is to explain the origin of x-rays and gamma rays, gamma ray interactions with matter, detectors and electronics used in gamma ray-spectrometry, and features of a gamma-ray spectrum for nuclear material that is safeguarded.
Dynamic gamma knife radiosurgery
International Nuclear Information System (INIS)
Luan Shuang; Swanson, Nathan; Chen Zhe; Ma Lijun
2009-01-01
Gamma knife has been the treatment of choice for various brain tumors and functional disorders. Current gamma knife radiosurgery is planned in a 'ball-packing' approach and delivered in a 'step-and-shoot' manner, i.e. it aims to 'pack' the different sized spherical high-dose volumes (called 'shots') into a tumor volume. We have developed a dynamic scheme for gamma knife radiosurgery based on the concept of 'dose-painting' to take advantage of the new robotic patient positioning system on the latest Gamma Knife C(TM) and Perfexion(TM) units. In our scheme, the spherical high dose volume created by the gamma knife unit will be viewed as a 3D spherical 'paintbrush', and treatment planning reduces to finding the best route of this 'paintbrush' to 'paint' a 3D tumor volume. Under our dose-painting concept, gamma knife radiosurgery becomes dynamic, where the patient moves continuously under the robotic positioning system. We have implemented a fully automatic dynamic gamma knife radiosurgery treatment planning system, where the inverse planning problem is solved as a traveling salesman problem combined with constrained least-square optimizations. We have also carried out experimental studies of dynamic gamma knife radiosurgery and showed the following. (1) Dynamic gamma knife radiosurgery is ideally suited for fully automatic inverse planning, where high quality radiosurgery plans can be obtained in minutes of computation. (2) Dynamic radiosurgery plans are more conformal than step-and-shoot plans and can maintain a steep dose gradient (around 13% per mm) between the target tumor volume and the surrounding critical structures. (3) It is possible to prescribe multiple isodose lines with dynamic gamma knife radiosurgery, so that the treatment can cover the periphery of the target volume while escalating the dose for high tumor burden regions. (4) With dynamic gamma knife radiosurgery, one can obtain a family of plans representing a tradeoff between the delivery time and
Exclusive production of pion pairs in {gamma}*{gamma} collisions at Large Q{sup 2}
Energy Technology Data Exchange (ETDEWEB)
Diehl, M.
2000-03-15
The authors perform a QCD analysis of the exclusive production of two mesons in {gamma}*{gamma} collisions in the kinematical domain of large photon virtuality Q and small hadronic invariant mass W. This reaction is dominated by a scale invariant mechanism which factorizes into a perturbative subprocess, {gamma}*{gamma} {r{underscore}arrow} q{anti q} or {gamma}*{gamma} {r{underscore}arrow} gg, and a generalized two-meson distribution amplitude. The authors develop in detail the phenomenology of this process at e{sup +}e{sup {minus}} colliders. Using a simple model for the two-pion distribution amplitude, based on its general properties, the authors estimate the cross section for the kinematics accessible at BABAR, BELLE, CLEO and LEP.
Collimatorless imaging of gamma rays with help of gamma-ray tracking
Marel, J V D
2001-01-01
In many gamma-ray detector systems that are built for imaging purposes Compton scattered photons are suppressed as much as possible. However, the information from photons that scattered inside a detector system can be used to reconstruct the tracks of the photons with help of gamma-ray tracking. Estimates of the incident directions of the photons can be made and an image can be created. Examples of potential applications for this technique are the use as a gamma-camera in medical imaging (e.g. SPECT) or as a detector for PET. Due to the omission of collimators, much higher detection efficiencies can be achieved, reducing the doses required for an image. A gamma-ray tracking method, called backtracking, has been developed for nuclear spectroscopy. The method tracks gamma-rays originating from a point source in the center of a spherical detector system consisting of position-sensitive germanium detectors. This method can also be used as a tracking technique for imaging of an unknown source distribution. With he...
Localization of the gamma-radiation sources using the gamma-visor
Directory of Open Access Journals (Sweden)
Ivanov Kirill E.
2008-01-01
Full Text Available The search of the main gamma-radiation sources at the site of the temporary storage of solid radioactive wastes was carried out. The relative absorbed dose rates were measured for some of the gamma-sources before and after the rehabilitation procedures. The effectiveness of the rehabilitation procedures in the years 2006-2007 was evaluated qualitatively and quantitatively. The decrease of radiation background at the site of the temporary storage of the solid radioactive wastes after the rehabilitation procedures allowed localizing the new gamma-source.
Localization of the gamma-radiation sources using the gamma-visor
International Nuclear Information System (INIS)
Ivanov, K. E.; Ponomaryev-Stepnoi, N. N.; Stepennov, B. S.; Teterin, Y. A.; Teterin, A. Y.; Kharitonov, V. V.
2008-01-01
The search of the main gamma-radiation sources at the site of the temporary storage of solid radioactive wastes was carried out. The relative absorbed dose rates were measured for some of the gamma-sources before and after the rehabilitation procedures. The effectiveness of the rehabilitation procedures in the years 2006-2007 was evaluated qualitatively and quantitatively. The decrease of radiation background at the site of the temporary storage of the solid radioactive wastes after the rehabilitation procedures al lowed localizing the new gamma-source. (author)
Energy Technology Data Exchange (ETDEWEB)
Kumar, Ashok; Soni, S K; Pancholi, S K; Gupta, S L [Delhi Univ. (India). Dept. of Physics and Astrophysics
1976-10-01
The results are presented of measuring the differential perturbed angular ..gamma gamma..-correlations for the ..gamma.. 1063.62 - ..gamma.. 569.67 keV cascade in /sup 207/Bi. The results obtained are analyzed and compared with data of other authors.
International Nuclear Information System (INIS)
Lindgren, E.
1974-01-01
The author makes a survey of his experience in sterilization and sterility control of medical products. At present three different methods are used, steamsterilization, gassterilizing and gammasterilizing. The investments and costs for gamma radiation is presented and a comparison of the costs for gamma- and gassterilization including sterility control is made. (M.S.)
Multiple hard interactions in $\\gamma\\gamma$ and $\\gamma$p physics at LEP and HERA
Butterworth, J.M.; Seymour, M.H.; Storrow, J.K.; Walker, R.
1995-01-01
At e^+e^- and ep colliders, the large fluxes of almost on-shell photons accompanying the lepton beams lead to the photoproduction of jets. As the centre-of-mass energy is increased, regions of smaller x in the parton densities are explored and these are regions of high parton density. As a result, the probability for more than one hard partonic scattering occurring in a single \\gamma \\gamma or \\gamma p collision can become significant. This effect has been simulated using an eikonal prescription combined with the HERWIG Monte Carlo program. The possible effects of multiple hard interactions on event shapes and jet cross sections have been studied in this framework at a range of energies relevant to HERA and LEPII. The results indicate that the effects could be significant.
Energy Technology Data Exchange (ETDEWEB)
Ichimiya, Tsutomu [Japan Radioisotope Association, Tokyo (Japan); Narita, Tsutomu; Kitao, Kensuke
1998-03-01
A quick index to {gamma}-rays and X-rays from natural radionuclides is presented. In the list, {gamma}-rays are arranged in order of increasing energy. The list also contains {gamma}-rays from radioactive nuclides produced in a germanium detector and its surrounding materials by interaction with cosmic neutrons, as well as direct {gamma}-rays from interaction with the neutrons. Artificial radioactive nuclides emitting {gamma}-rays with same or near energy value as that of the natural {gamma}-rays and X-rays are also listed. In appendix, {gamma}-ray spectra from a rock, uranium ore, thorium, monazite and uraninite and also background spectra obtained with germanium detectors placed in iron or lead shield have been given. The list is designed for use in {gamma}-ray spectroscopy under the conditions of highly natural background, such as in-situ environmental radiation monitoring or low-level activity measurements, with a germanium detector. (author)
GammaSem Proceedings - A Nordic seminar for users of gamma spectrometry
International Nuclear Information System (INIS)
Nunez, P.; Klemola, S.; Nielsen, Sven P.; Palsson, S.E.; Israelson, C.
2010-03-01
The project GammaSem was proposed to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and to establish a network of users of gamma spectrometry in the Nordic countries, thereby strengthening the collaboration and improving all participants' competence in practical gamma spectrometry. The seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 75 people participated; representing 34 different universities, commercial companies, research institutes and also all Nordic authorities. During the seminar several key issues for follow-up were identified and working groups for addressing the identified problems were established. The working groups were: 1) Uncertainties and detections of limits 2) True summing coincidence 3) Monte Carlo simulations and efficiency transfer 4) Absorption (density corrections and geometries) 5) Mobile gamma spectrometry systems 6) Nuclear forensics (on special samples and special parts of the spectra). The identified topics will form the basis for the agenda of the next seminar in 2010. There, the different working groups will be invited to present their ideas/solutions to the relevant problems. (author)
GammaSem Proceedings - A Nordic seminar for users of gamma spectrometry
Energy Technology Data Exchange (ETDEWEB)
Nunez, P. (ed.) (Institute for Energy Technology (IFE) (Norway)); Klemola, S. (Radiation and Nuclear Safety Authority (STUK) (Finland)); Nielsen, Sven P. (Technical Univ. of Denmark, Risoe National Lab. for Sustainable Energy. Roskilde (Denmark)); Palsson, S.E. (Icelandic Radiation Safety Authority (IS)); Israelson, C. (National Institute of Radiation Protection (Denmark))
2010-03-15
The project GammaSem was proposed to provide a forum for discussions and sharing of information on practical issues concerning gamma spectrometry and to establish a network of users of gamma spectrometry in the Nordic countries, thereby strengthening the collaboration and improving all participants' competence in practical gamma spectrometry. The seminars' focus was practical challenges met by the users themselves, rather than theoretical matters. Scientists and users of gamma spectrometry from all five Nordic countries were invited to the seminar, as well as scientist from the Baltic countries. A total of 75 people participated; representing 34 different universities, commercial companies, research institutes and also all Nordic authorities. During the seminar several key issues for follow-up were identified and working groups for addressing the identified problems were established. The working groups were: 1) Uncertainties and detections of limits 2) True summing coincidence 3) Monte Carlo simulations and efficiency transfer 4) Absorption (density corrections and geometries) 5) Mobile gamma spectrometry systems 6) Nuclear forensics (on special samples and special parts of the spectra). The identified topics will form the basis for the agenda of the next seminar in 2010. There, the different working groups will be invited to present their ideas/solutions to the relevant problems. (author)
Lauw, F. N.; Simpson, A. J.; Prins, J. M.; van Deventer, S. J.; Chaowagul, W.; White, N. J.; van der Poll, T.
2000-01-01
Gamma interferon (IFN-gamma)-inducible protein 10 (IP-10) and monokine induced by IFN-gamma (Mig) are related CXC chemokines which bind to the CXCR3 receptor and specifically target activated T lymphocytes and natural killer (NK) cells. The production of IP-10 and Mig by various cell types in vitro
Thompson, David
2012-01-01
Gamma rays reveal extreme, nonthermal conditions in the Universe. The Fermi Gamma-ray Space Telescope has been exploring the gamma-ray sky for more than four years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge gamma-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.
Fabrication of gamma sources using the neutron-gamma reactions of 238Pu13C
International Nuclear Information System (INIS)
Solinhac, I.; Maillard, C.; Donnet, L.
2004-01-01
A production campaign for 238 Pu 13 C sources with gamma fluence ranging from 2500 to 4500 gamma/s/4π at 6.13 MeV was carried out in 2002 in Atalante. An experimental study was undertaken to prepare the 238 PuC mixture, which is the most delicate step. This procedure is described together with the other steps in the source fabrication process: purification of a plutonium oxide batch, preparation of a nitric solution of 238 Pu, measurement of the gamma fluence of the PuC mixture before and after insertion into each of the two stainless steel capsules that constitute a PuN 2 O package, welding of the second envelope followed by leak testing, final measurement of the gamma fluence of the sealed source. This PuC sources fabrication procedure is effective: all the sources include the required gamma activity with an uncertainty on the gamma fluence of less than 10%. (authors)
Measurement of the Charm Production Cross Section in gamma gamma Collisions at LEP
Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.
2001-01-01
Open charm production in gamma-gamma collisions is studied with data collected at e+e- centre-of-mass energies from 189 GeV to 202 GeV corresponding to a total integrated luminosity of 410 pb-1. The charm cross section sigma(gamma gamma ---> c c~ X) is measured for the first time as a function of the two-photon centre-of-mass energy in the interval from 5 GeV to 70 GeV and is compared to NLO QCD calculations.
Upper limits on the branching ratios $\\tau$ --> $\\mu\\gamma$ and $\\tau$ --> e$\\gamma$
Abreu, P; Adye, T; Agasi, E; Ajinenko, I; Aleksan, Roy; Alekseev, G D; Allport, P P; Almehed, S; Alvsvaag, S J; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barate, R; Barbiellini, Guido; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Berggren, M; Bertrand, D; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bloch, D; Blume, M; Blyth, S; Bocci, V; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Borisov, G; Bosio, C; Bosworth, S; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brillault, L; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Buys, A; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carrilho, P; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Cerrito, L; Chabaud, V; Chapkin, M M; Charpentier, P; Chaussard, L; Chauveau, J; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Cindro, V; Collins, P; Contreras, J L; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Daum, A; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; De Boeck, H; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Djama, F; Dolbeau, J; Dönszelmann, M; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Dufour, Y; Dupont, F; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Ershaidat, N; Erzen, B; Espirito-Santo, M C; Falk, E; Fassouliotis, D; Feindt, Michael; Ferrer, A; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Fries, D E C; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gibbs, M; Gokieli, R; Golob, B; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Grosdidier, G; Gunnarsson, P; Günther, M; Guy, J; Haedinger, U; Hahn, F; Hahn, M; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Hao, W; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Ioannou, P; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karlsson, M; Karvelas, E; Katsanevas, S; Katsoufis, E C; Keränen, R; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klein, H; Klovning, A; Kluit, P M; Köhne, J H; Köne, B; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Kramer, P H; Krammer, Manfred; Kreuter, C; Królikowski, J; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamblot, S; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Lapin, V; Last, I; Laugier, J P; Lauhakangas, R; Ledroit, F; Lefébure, V; Legan, C K; Leitner, R; Lemoigne, Y; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Lokajícek, M; Loken, J G; López, J M; López-Fernandez, A; López-Aguera, M A; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Maio, A; Malychev, V; Mandl, F; Marco, J; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Maron, T; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Marvik, K; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Meroni, C; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Negri, P; Némécek, S; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Orava, Risto; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Pindo, M; Plaszczynski, S; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Prest, M; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Rosso, E; Roudeau, Patrick; Rovelli, T; Rückstuhl, W; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schneider, H; Schyns, M A E; Sciolla, G; Scuri, F; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Shellard, R C; Siccama, I; Siegrist, P; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stapnes, Steinar; Stavitski, I; Stepaniak, K; Stichelbaut, F; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Chikilev, O G; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Toet, D Z; Tomaradze, A G; Tomé, B; Tortora, L; Tranströmer, G; Treille, D; Trischuk, W; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Weierstall, M; Weilhammer, Peter; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zacharatou-Jarlskog, C; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zuberi, R; Zucchelli, G C; Zumerle, G
1995-01-01
The DELPHI collaboration has searched for lepton flavour violating decays \\tau \\rightarrow \\mu \\gamma and \\tau \\rightarrow e \\gamma using a data sample of about 70~pb^{-1} of integrated luminosity corresponding to 81 000 produced \\tau^+ \\tau^- events. No candidates were found for either of the two modes. This yields branching ratio upper limits of \\rm{B}( \\tau \\rightarrow e \\gamma ) < 1.1 \\times 10^{-4} and \\rm{B} ( \\tau \\rightarrow \\mu \\gamma) < 6.2 \\times 10^{-5} at 90\\% confidence level.
Multiple Gamma-Ray Detection Capability of a CeBr3 Detector for Gamma Spectroscopy
Directory of Open Access Journals (Sweden)
A. A. Naqvi
2017-01-01
Full Text Available The newly developed cerium tribromide (CeBr3 detector has reduced intrinsic gamma-ray activity with gamma energy restricted to 1400–2200 keV energy range. This narrower region of background gamma rays allows the CeBr3 detector to detect more than one gamma ray to analyze the gamma-ray spectrum. Use of multiple gamma-ray intensities in elemental analysis instead of a single one improves the accuracy of the estimated results. Multigamma-ray detection capability of a cylindrical 75 mm × 75 mm (diameter × height CeBr3 detector has been tested by analyzing the chlorine concentration in water samples using eight chlorine prompt gamma rays over 517 to 8578 keV energies utilizing a D-D portable neutron generator-based PGNAA setup and measuring the corresponding minimum detection limit (MDC of chlorine. The measured MDC of chlorine for gamma rays with 517–8578 keV energies varies from 0.07 ± 0.02 wt% to 0.80 ± 0.24. The best value of MDC was measured to be 0.07 ± 0.02 wt% for 788 keV gamma rays. The experimental results are in good agreement with Monte Carlo calculations. The study has shown excellent detection capabilities of the CeBr3 detector for eight prompt gamma rays over 517–8578 keV energy range without significant background interference.
Soldatov, Evgeny; The ATLAS collaboration
2016-01-01
The production of Z bosons with one or two isolated high energy photons is studied using pp collisions at 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 $fb^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic (ee, $\\mu\\mu$, $\
Energy Technology Data Exchange (ETDEWEB)
Antipov, Yu.M. [Institute for High Energy Physics, Protvino (Russian Federation); Artamonov, A.V. [Institute for High Energy Physics, Protvino (Russian Federation); Batarin, V.A. [Institute for High Energy Physics, Protvino (Russian Federation); Vavilov, D.V. [Institute for High Energy Physics, Protvino (Russian Federation); Victorov, V.A. [Institute for High Energy Physics, Protvino (Russian Federation); Eroshin, O.V. [Institute for High Energy Physics, Protvino (Russian Federation); Golovkin, S.V. [Institute for High Energy Physics, Protvino (Russian Federation); Gorin, Yu.P. [Institute for High Energy Physics, Protvino (Russian Federation); Kolganov, V.Z. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation); Kozhevnikov, A.P. [Institute for High Energy Physics, Protvino (Russian Federation); Konstantinov, A.S. [Institute for High Energy Physics, Protvino (Russian Federation); Kubarovsky, V.P. [Institute for High Energy Physics, Protvino (Russian Federation); Kurshetsov, V.F. [Institute for High Energy Physics, Protvino (Russian Federation); Landsberg, L.G. [Institute for High Energy Physics, Protvino (Russian Federation)]. E-mail: lgl@mx.ihep.su; Leontiev, V.M. [Institute for High Energy Physics, Protvino (Russian Federation); Lomkatsi, G.S. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation); Molchanov, V.V. [Institute for High Energy Physics, Protvino (Russian Federation)]. E-mail: molchanov@mx.ihep.su; Mukhin, V.A. [Institute for High Energy Physics, Protvino (Russian Federation); Nilov, A.F. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation); Patalakha, D.I. [Institute for High Energy Physics, Protvino (Russian Federation); Petrenko, S.V. [Institute for High Energy Physics, Protvino (Russian Federation); Smolyankin, V.T. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation)
2004-12-16
The radiative decay {lambda}(1520)->{lambda}{gamma} was measured directly in the study of the exclusive diffractive-like reaction p+N->{lambda}(1520)K{sup +}+N, {lambda}(1520)->{lambda}{gamma} with the SPHINX spectrometer. The values of the branching and partial width of this radiative decay were obtained: BR[{lambda}(1520)->{lambda}{gamma}]=(1.02+/-0.21(stat)+/-0.15(syst))x10{sup -2} and {gamma}[{lambda}(1520)->{lambda}{gamma}]=159+/-33(stat)+/-26(syst)-bar keV.
Dynamic gamma knife radiosurgery
Energy Technology Data Exchange (ETDEWEB)
Luan Shuang; Swanson, Nathan; Chen Zhe [Department of Computer Science, University of New Mexico, Albuquerque, NM 87131 (United States); Ma Lijun [Department of Radiation Oncology, University of California San Francisco, San Francisco, CA 94143 (United States)], E-mail: sluan@cs.unm.edu, E-mail: nate@cs.unm.edu, E-mail: zchen@cs.unm.edu, E-mail: lijunma@radonc.ucsf.edu
2009-03-21
Gamma knife has been the treatment of choice for various brain tumors and functional disorders. Current gamma knife radiosurgery is planned in a 'ball-packing' approach and delivered in a 'step-and-shoot' manner, i.e. it aims to 'pack' the different sized spherical high-dose volumes (called 'shots') into a tumor volume. We have developed a dynamic scheme for gamma knife radiosurgery based on the concept of 'dose-painting' to take advantage of the new robotic patient positioning system on the latest Gamma Knife C(TM) and Perfexion(TM) units. In our scheme, the spherical high dose volume created by the gamma knife unit will be viewed as a 3D spherical 'paintbrush', and treatment planning reduces to finding the best route of this 'paintbrush' to 'paint' a 3D tumor volume. Under our dose-painting concept, gamma knife radiosurgery becomes dynamic, where the patient moves continuously under the robotic positioning system. We have implemented a fully automatic dynamic gamma knife radiosurgery treatment planning system, where the inverse planning problem is solved as a traveling salesman problem combined with constrained least-square optimizations. We have also carried out experimental studies of dynamic gamma knife radiosurgery and showed the following. (1) Dynamic gamma knife radiosurgery is ideally suited for fully automatic inverse planning, where high quality radiosurgery plans can be obtained in minutes of computation. (2) Dynamic radiosurgery plans are more conformal than step-and-shoot plans and can maintain a steep dose gradient (around 13% per mm) between the target tumor volume and the surrounding critical structures. (3) It is possible to prescribe multiple isodose lines with dynamic gamma knife radiosurgery, so that the treatment can cover the periphery of the target volume while escalating the dose for high tumor burden regions. (4) With dynamic gamma knife radiosurgery, one can
International Nuclear Information System (INIS)
Ehstulin, I.V.
1980-01-01
A brief consideration is being given to the history of cosmic gamma burst discovery and modern knowledge of their properties. The time dependence of gamma bursts is described and their possible sources are discussed
Applied gamma-ray spectrometry
Dams, R; Crouthamel, Carl E
1970-01-01
Applied Gamma-Ray Spectrometry covers real life application of the gamma-ray and the devices used in their experimental studies. This book is organized into 9 chapters, and starts with discussions of the various decay processes, the possible interaction mechanisms of gamma radiation with matter, and the intrinsic and extrinsic variables, which affect the observed gamma-ray and X-ray spectra. The subsequent chapters deal with the properties and fabrication of scintillation detectors, semiconductor detectors, and proportional gas counters. These chapters present some of the most widely utilized
Cosmical sources of gamma radiation
Energy Technology Data Exchange (ETDEWEB)
Kuchowicz, B [Warsaw Univ. (Poland)
1974-01-01
A brief historical outline of the X-ray and ..gamma..-ray astronomies is given first, then a summary of the recent status of X-ray astronomy follows. Further chapters include information on ..gamma..-ray sources in the solar system, in our Galaxy, and beyond it. In discussing linear gamma spectra attention is paid to the possibility of studying explosive nucleo-synthesis by observation of gamma lines from supernova remnants, etc. Questions of the isotropic gamma background are discussed at the end of the survey.
Energy Technology Data Exchange (ETDEWEB)
Pottier, R; Berger, R [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France)
1966-06-01
A procedure is described for the qualitative and quantitative spectrographic analysis of radioactive sources containing two alpha-gamma emitters having the same alpha energy or two beta-gamma emitters having the same gamma energy. The main apparatus is a multichannel pulse-height analyzer including a coincidence circuit. The principle of the method, the synoptic scheme, the electronic device, the type of sources, and the precautions to be taken or the corrections to take into account are reported. The results obtained in solving the three following problems are discussed as examples of applications of the method: analysis of {sup 241}Am in alpha-gamma sources containing {sup 238}Pu; analysis of {sup 237}Np in beta-gamma sources containing {sup 239}Pu; and analysis of {sup 106}Ru-{sup 106}Rh in beta-gamma sources containing {sup 95}Zr-{sup 95}Nb. (authors) [French] Dans ce. rapport, on presente une methode d'analyse spectrographique qualitative et quantitative de sources radioactives contenant deux emetteurs alpha-gamma de meme energie alpha et deux emetteurs beta-gamma de meme energie gamma. L'organe principal est un analyseur d'amplitude a 400 canaux comprenant un circuit de coincidence. On decrit le principe de la methode, le schema synoptique, l'appareillage, le type des sources, les precautions a prendre ou les corrections a faire. On discute les resultats obtenus dans la solution des trois problemes suivants traites a titre d'application de la methode: 1. analyse d'americium 241 en presence de plutonium 238; 2. analyse de neptunium 237 en presence de plutonium 239; 3. analyse de ruthenium 106-rhodium 106 en presence de zirconium 95-niobium 95. (auteurs)
The Impact of Operating Parameters and Correlated Parameters for Extended BWR Burnup Credit
Energy Technology Data Exchange (ETDEWEB)
Ade, Brian J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Marshall, William B. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ilas, Germina [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Betzler, Benjamin R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Bowman, Stephen M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-06-01
Applicants for certificates of compliance for spent nuclear fuel (SNF) transportation and dry storage systems perform analyses to demonstrate that these systems are adequately subcritical per the requirements of Title 10 of the Code of Federal Regulations (10 CFR) Parts 71 and 72. For pressurized water reactor (PWR) SNF, these analyses may credit the reduction in assembly reactivity caused by depletion of fissile nuclides and buildup of neutron-absorbing nuclides during power operation. This credit for reactivity reduction during depletion is commonly referred to as burnup credit (BUC). US Nuclear Regulatory Commission (NRC) staff review BUC analyses according to the guidance in the Division of Spent Fuel Storage and Transportation Interim Staff Guidance (ISG) 8, Revision 3, Burnup Credit in the Criticality Safety Analyses of PWR Spent Fuel in Transportation and Storage Casks.
New stage in high-energy gamma-ray studies with GAMMA-400 after Fermi-LAT
Directory of Open Access Journals (Sweden)
Topchiev N.P.
2017-01-01
Full Text Available Fermi-LAT has made a significant contribution to the study of high-energy gamma-ray diffuse emission and the observations of 3000 discrete sources. However, one third of all gamma-ray sources (both galactic and extragalactic are unidentified, the data on the diffuse gamma-ray emission should be clarified, and signatures of dark matter particles in the high-energy gamma-ray range are not observed up to now. GAMMA-400, the currently developing gamma-ray telescope, will have angular (∼0.01∘ at 100 GeV and energy (∼1% at 100 GeV resolutions in the energy range of 10–1000 GeV which are better than Fermi-LAT (as well as ground gamma-ray telescopes by a factor of 5–10. It will observe some regions of the Universe (such as the Galactic Center, Fermi Bubbles, Crab, Cygnus, etc. in a highly elliptic orbit (without shading the telescope by the Earth continuously for a long time. It will allow us to identify many discrete sources, to clarify the structure of extended sources, to specify the data on the diffuse emission, and to resolve gamma rays from dark matter particles.
Analysis of copper-nickel ores by gamma-gamma method in ore enrichment works
International Nuclear Information System (INIS)
Bol'shakov, A.Yu.; Tovstenko, Yu.G.; Chinskij, E.B.; Eliseev, G.I.
1973-01-01
The paper presents experimental data on continuous gamma-gamma assay of copper-nickel ores on conveyor belts and of dry discrete samples of classifier overflow at the enrichment plants of the Pechenganikel' group. The relative errors are given of the results of comparison of two-hour rapid analyses and shift and 24-hour chemical analyses of classifier overflow samples with the figures for gamma-gamma assay. The factors affecting the accuracy of the latter technique are elucidated. Practical recommendations are given on the use of this technique at the above enrichment plants. (author)
Top quark electric dipole and Z gamma gamma couplings at a photon collider
Poulose, P
2001-01-01
Effect of the top quark electric dipole coupling and the Z gamma gamma coupling is studied in the pair production of top quark at a photon collider using CP-violating asymmetries. Our results show that with a photon collider of geometrical luminosity of 20 fb sup - sup 1 it is possible to put limits of the order of 0.1 on the Z gamma gamma coupling and about 2.5x10 sup - sup 1 sup 7 e cm on the top quark electric dipole coupling using these asymmetries.
Effects of Acute Gamma Irradiation on Amaryllis Orange Bio gamma
International Nuclear Information System (INIS)
Sakinah Ariffin; Shakinah Salleh; Shuhaimi Shamsuddin; Suhaimi Musa; Affrida Abu Hassan
2016-01-01
Ornamental and landscaping plants have their own demand. Color variations, shape and flower shelf life are among the important value-added characters in improvement of new varieties of ornamental plants. Mutation induction using ionizing radiation is an alternative way for obtaining plant with desirable traits. Improvement of ornamental plant Amaryllis 'Orange Bio gamma' was carried out by exposing bulbs with gamma rays at dose 0, 10, 15, 20, 25, 30, 40 and 50 Gy using Bio Beam GM8000 gamma irradiation chamber at the Malaysian Nuclear Agency. Effect of radiation on the growth of bulbs was observed. Data on shoot and root length was recorded after 6 weeks. From the observation, the increasing dose has caused a reduction in shoot length and inhibited the root production. This paper will discuss the effects of acute gamma irradiation on the plant morphology. The result and observation obtained is useful for future work on lily improvement and will be included into Bio Beam GM8000 irradiation database. (author)
Data of evolutionary structure change: 1BUCB-3MDEA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1BUCB-3MDEA 1BUC 3MDE B A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...pdbID> A 3MDEA RSDPDP...in> 3MDE A 3MDEA IEANT-LGQVPA 3MDEA AEKKG-DEYII
International Nuclear Information System (INIS)
Yildiz, Nihat; Akkoyun, Serkan
2013-01-01
Highlights: ► Detector responses in neutron–gamma discrimination were estimated by neural networks. ► Novel consistent neural network empirical physical formulas (EPFs) were constructed for detector responses. ► The EPFs are of explicit mathematical functional form. ► The EPFs can be used to derive various physical functions relevant to neutron–gamma discrimination in gamma ray tracking. -- Abstract: Gamma ray tracking is an efficient detection technique in studying exotic nuclei which lies far from beta stability line. To achieve very powerful and extraordinary resolution ability, new detectors based on gamma ray tracking are currently being developed. To reach this achievement, the neutron–gamma discrimination in these detectors is also an important task. In this paper, by suitable layered feedforward neural networks (LFNNs), we have constructed novel and consistent empirical physical formulas (EPFs) for some highly nonlinear detector counts measured in neutron–gamma discrimination. The detector counts data used in the discrimination was actually borrowed from our previous paper. The counts used here had been originally measured versus the following parameters: energy deposited in the first interaction points, difference in the incoming direction of initial gamma rays, and finally figure of merit values of the clusters determined by tracking. The LFNN–EPFs are of explicit mathematical functional form. Therefore, by various suitable operations of mathematical analysis, these LFNN–EPFs can be used to derivate further physical functions which might be potentially relevant to neutron–gamma discrimination performance of gamma ray tracking.
International Nuclear Information System (INIS)
Carroll, J. J.; Karamian, S. A.; Rivlin, L. A.; Zadernovsky, A. A.
2001-01-01
X-ray-driven gamma emission describes processes that may release nuclear energy in a 'clean' way, as bursts of incoherent or coherent gamma rays without the production of radioactive by-products. Over the past decade, studies in this area, as a part of the larger field of quantum nucleonics, have gained tremendous momentum. Since 1987 it has been established that photons could trigger gamma emission from a long-lived metastable nuclear excited state of one nuclide and it appears likely that triggering in other isotopes will be demonstrated conclusively in the near future. With these experimental results have come new proposals for the creation of collective and avalanche-like incoherent gamma-ray bursts and even for the ultimate light source, a gamma-ray laser. Obviously, many applications would benefit from controlled bursts of gamma radiation, whether coherent or not. This paper reviews the experimental results and concepts for the production of gamma rays, driven by externally produced X-rays
Search for the glueball candidates f/sub 0/(1500) and f/sub J/(1710) in gamma gamma collisions
Shan, Jin
2001-01-01
Summary form only given. Data taken with the ALEPH detector at LEP1 have been used to search for gamma gamma production of the glueball candidates f/sub 0/(1500) and f/sub J/(1710) via their decay to pi /sup +/ pi /sup -//sub ./ No signal is observed and upper limits to the product of gamma gamma width and pi /sup +/ pi /sup b/ranching ratio of the f/sub 0/(1500) and the f/sub J/(1710) have been measured to be Gamma ( gamma gamma to f/sub 0/(1500)) BR(f/sub 0/(1500) to pi /sup +/ pi /sup -/) < 0 31keV and Gamma ( gamma gamma to f/sub J /(1710)) BR(f/sub J/(1710) to pi /sup +/ pi /sup -/) < 0 55keV at 95% confidence level.
Observation of galactic gamma radiation
International Nuclear Information System (INIS)
Paul, J.A.
1982-09-01
A complete and deep survey of the galactic high-energy gamma radiation is now available, thanks to the gamma-ray telescopes on board of the SAS-2 and COS-B spacecrafts. A comparison of the COS-B gamma-ray survey with a fully sampled CO survey together with an Hsub(I) survey is used to show that a simple model, in which uniformly distributed cosmic rays interact with the interstellar gas, can account for almost all the gamma-ray emission observed in the first galactic quadrant. At medium galactic latitudes, it is shown that a relationship exists between the gamma radiation and the interstellar absorption derived from galaxy counts. Therefore gamma rays from the local galactic environment can be used as a valuable probe of the content and structure of the local interstellar medium. The large scale features of the local interstellar gas are revealed, in particular wide concentrations of nearby molecular hydrogen. On a smaller scale, the detection of numerous localized gamma-ray sources focuses the attention on some particular phases of clusters of young and massive stars where diffuse processes of gamma-ray emission may also be at work
Optical observations of Gamma-Ray Bursts
International Nuclear Information System (INIS)
Hjorth, J.; Pian, E.; Fynbo, J.P.U.
2004-01-01
We briefly review the status and recent progress in the field of optical observations of gamma-ray burst afterglows. We will focus on the fundamental observational evidence for the relationship between gamma-ray bursts and the final evolutionary phases of massive stars. In particular, we will address (i) gamma-ray burst host galaxies, (ii) optically dark gamma-ray burst afterglows, (iii) the gamma-ray burst-supernova connection, and (iv) the relation between X-ray flashes, gamma-ray bursts, and supernovae
The Gamma-ray Universe through Fermi
Thompson, David J.
2012-01-01
Gamma rays, the most powerful form of light, reveal extreme conditions in the Universe. The Fermi Gamma-ray Space Telescope and its smaller cousin AGILE have been exploring the gamma-ray sky for several years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge ga.nuna-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.
Energy Technology Data Exchange (ETDEWEB)
Caveda R, C.A.; Dominguez L, O.; Alonso A, D. [CPHR, Calle 20 No. 4113 e/41 y 47, Playa, C.P. 11300, A.P. 6195, C.P. 10600 La Habana (Cuba); Montalvan E, A.; Fabelo B, O. [CIAC, Ave. Finlay Km 2 1/2, Rpto. Puerto Principe, Camaguey 70800 (Cuba)]. e-mail: caveda@cphr.edu.cu
2006-07-01
In the following work an analysis of the existent relationship among the measurement of the absorbed dose rate in air due to the environmental gamma radiation and the temperature, magnitudes measured to intervals of 10 minutes by the gamma probe Gamma Tracer located in the post of occident of the National Net of Environmental Radiological Surveillance (RNVRA), in the Center of Protection and Hygiene of the Radiations (CPHR) is made. For it its were analyzed near 100,000 measurements corresponding to the period 2004-2005. For a better processing and interpretation of the data, these were analyzed with one frequency time zone and monthly using the Gamma Red software to which was necessary to add it some options. Finally it was submitted the probe to a heating process inside a stove. The results of the carried out experiments confirmed that the absorbed dose rate in air due to the environmental gamma radiation depends potentially of the probe temperature in the range of environmental temperature to which is subjected daily the same one. (Author)
On the maximum and minimum of two modified Gamma-Gamma variates with applications
Al-Quwaiee, Hessa
2014-04-01
In this work, we derive the statistical characteristics of the maximum and the minimum of two modified1 Gamma-Gamma variates in closed-form in terms of Meijer\\'s G-function and the extended generalized bivariate Meijer\\'s G-function. Then, we rely on these new results to present the performance analysis of (i) a dual-branch free-space optical selection combining diversity undergoing independent but not necessarily identically distributed Gamma-Gamma fading under the impact of pointing errors and of (ii) a dual-hop free-space optical relay transmission system. Computer-based Monte-Carlo simulations verify our new analytical results.
Energy Technology Data Exchange (ETDEWEB)
Czubek, J; Guitton, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-07-01
The principles of the gamma-gamma method are reviewed. It is shown in particular that, under certain conditions, the method makes it possible to obtain a representative measurement of the electronic density. Chemical analyses have been carried out on samples obtained from uranium deposits. The results show that an exact correlation exists between the massive and electronic densities. It is possible to consider the possibility of measuring the density of uranium-containing rocks by the gamma-gamma method. (authors) [French] Les principes de la methode gamma-gamma sont rappeles. En particulier, il est montre que, dans certaines conditions, la methode permet une mesure representative de la densite electronique. Des analyses chimiques ont ete effectuees sur des echantillons provenant de gisements uraniferes. Les resultats indiquent qu'il existe une correlation precise entre leur densite massique et leur densite electronique. Il est possible d'envisager la mesure de la densite des roches uraniferes par la methode gamma-gamma.
Hosseini, S. A.; Zangian, M.; Aghabozorgi, S.
2018-03-01
In the present paper, the light output distribution due to poly-energetic neutron/gamma (neutron or gamma) source was calculated using the developed MCNPX-ESUT-PE (MCNPX-Energy engineering of Sharif University of Technology-Poly Energetic version) computational code. The simulation of light output distribution includes the modeling of the particle transport, the calculation of scintillation photons induced by charged particles, simulation of the scintillation photon transport and considering the light resolution obtained from the experiment. The developed computational code is able to simulate the light output distribution due to any neutron/gamma source. In the experimental step of the present study, the neutron-gamma discrimination based on the light output distribution was performed using the zero crossing method. As a case study, 241Am-9Be source was considered and the simulated and measured neutron/gamma light output distributions were compared. There is an acceptable agreement between the discriminated neutron/gamma light output distributions obtained from the simulation and experiment.
Modeling the reduction of gross lithium erosion observed under high-flux deuterium bombardment
Abrams, T.; Jaworski, M. A.; Kaita, R.; Nichols, J. H.; Stotler, D. P.; De Temmerman, G.; van den Berg, M. A.; van der Meiden, H. J.; Morgan, T. W.
2015-01-01
Abstract Both thin (<1xa0;μm) and thick (∼500xa0;μm) lithium films under high-flux deuterium and neon plasma bombardment were studied in the linear plasma device Magnum-PSI at ion fluxes >1024xa0;m−2xa0;s−1 and surface temperatures <700xa0;°C.
Deuterium-induced nanostructure formation on tungsten exposed to high-flux plasma
Xu, H.Y.; De Temmerman, G.; Luo, G. N.; Jia, Y. Z.; Yuan, Y.; Fu, B. Q.; Godfrey, A.; Liu, W.
2015-01-01
Surface topography of polycrystalline tungsten (W) have been examined after exposure to a low-energy (38xa0;eV/D), high-flux (∼1.1–1.5xa0;×xa0;1024xa0;m−2xa0;s−1) deuterium plasma in the Pilot-PSI linear plasma device. The methods used were scanning electron microscopy
Artin, Emil
2015-01-01
This brief monograph on the gamma function was designed by the author to fill what he perceived as a gap in the literature of mathematics, which often treated the gamma function in a manner he described as both sketchy and overly complicated. Author Emil Artin, one of the twentieth century's leading mathematicians, wrote in his Preface to this book, ""I feel that this monograph will help to show that the gamma function can be thought of as one of the elementary functions, and that all of its basic properties can be established using elementary methods of the calculus."" Generations of teachers
Gravitational Waves versus X and Gamma Ray Emission in a Short Gamma-Ray Burst
Oliveira, F. G.; Rueda, Jorge A.; Ruffini, Remo
2012-01-01
The recent progress in the understanding the physical nature of neutron star equilibrium configurations and the first observational evidence of a genuinely short gamma-ray burst, GRB 090227B, allows to give an estimate of the gravitational waves versus the X and Gamma-ray emission in a short gamma-ray burst.
Extragalactic Gamma-Ray Astrophysics
CERN. Geneva
2016-01-01
During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...
GammaModeler 3-D gamma-ray imaging technology
International Nuclear Information System (INIS)
2000-01-01
The 3-D GammaModelertrademark system was used to survey a portion of the facility and provide 3-D visual and radiation representation of contaminated equipment located within the facility. The 3-D GammaModelertrademark system software was used to deconvolve extended sources into a series of point sources, locate the positions of these sources in space and calculate the 30 cm. dose rates for each of these sources. Localization of the sources in three dimensions provides information on source locations interior to the visual objects and provides a better estimate of the source intensities. The three dimensional representation of the objects can be made transparent in order to visualize sources located within the objects. Positional knowledge of all the sources can be used to calculate a map of the radiation in the canyon. The use of 3-D visual and gamma ray information supports improved planning decision-making, and aids in communications with regulators and stakeholders
Pérez de León, A A; Valenzuela, J G; Tabachnick, W J
1998-02-01
Blood feeding by the insect vector Culicoides variipennis sonorensis involves laceration of superficial host tissues, an injury that would be expected to trigger the coagulation cascade. Accordingly, the salivary glands of C.v. sonorensis were examined for the presence of an antihemostatic that prevents blood coagulation. Assays using salivary gland extracts showed a delay in the recalcification time of plasma devoid of platelets, indicating the presence of anticoagulant activity. Retardation in the formation of a fibrin clot was also observed after the addition of tissue factor to plasma that was preincubated with salivary gland extracts. Similarly, an inhibitory effect by salivary gland extracts was detected in assays that included factors of the intrinsic pathway. Inhibition of the catalytic activity of purified factor Xa toward its chromogenic substrate suggested that it was the target of the salivary anticoagulant of C.v. sonorensis. This was corroborated by the coincidence of anticoagulant and anti-FXa activities obtained by reverse-phase HPLC. The depletion of anti-FXa activity from salivary glands during blood feeding suggests that the FXa inhibitor functions as anticoagulant. Molecular sieving HPLC yielded an apparent molecular mass of 28 kDa for the salivary FXa inhibitor of C.v. sonorensis. Preventing the formation of thrombin through the inhibition of FXa likely facilitates blood feeding by maintaining the pool of blood fluid at the feeding site. The salivary FXa inhibitor of C.v. sonorensis could impair the network of host-defense mechanisms in the skin microenvironment by avoiding blood coagulation at the site of feeding.
DEFF Research Database (Denmark)
Elster, L; Kristiansen, U; Pickering, D S
2001-01-01
Two gamma-aminobutyric acid(A) (GABA(A)) receptor chimeras were designed in order to elucidate the structural requirements for GABA(A) receptor desensitization and assembly. The (alpha1/gamma2) and (gamma2/alpha1) chimeric subunits representing the extracellular N-terminal domain of alpha1 or gamma......, as opposed to the staining of the (gamma2/alpha1)-containing receptors, which was only slightly higher than background. To explain this, the (alpha1/gamma2) and (gamma2/alpha1) chimeras may act like alpha1 and gamma2 subunits, respectively, indicating that the extracellular N-terminal segment is important...... for assembly. However, the (alpha1/gamma2) chimeric subunit had characteristics different from the alpha1 subunit, since the (alpha1/gamma2) chimera gave rise to no desensitization after GABA stimulation in whole-cell patch-clamp recordings, which was independent of whether the chimera was expressed...
Lunar based gamma ray astronomy
International Nuclear Information System (INIS)
Haymes, R.C.
1985-01-01
Gamma ray astronomy represents the study of the universe on the basis of the electromagnetic radiation with the highest energy. Gamma ray astronomy provides a crucial tool for the understanding of astronomical phenomena, taking into account nucleosynthesis in supernovae, black holes, active galaxies, quasars, the sources of cosmic rays, neutron stars, and matter-antimatter annihilation. Difficulties concerning the conduction of studies by gamma ray astronomy are related to the necessity to perform such studies far from earth because the atmosphere is a source of gamma rays. Studies involving the use of gamma ray instruments in earth orbit have been conducted, and more gamma ray astronomy observations are planned for the future. Imperfections of studies conducted in low earth orbit could be overcome by estalishing an observatory on the moon which represents a satellite orbiting at 60 earth radii. Details concerning such an observatory are discussed. 5 references
Gamma-ray burst polarimeter (GAP)
International Nuclear Information System (INIS)
Mihara, Tatehiro; Murakami, Toshio; Yonetoku, Daisuke; Gunji, Shuichi; Kubo, Shin
2013-01-01
The gamma-ray burst polarimeter (GAP: GAmma-ray burst Polarimeter), which had been almost handcrafted by scientists, has succeeded in working normally in interplanetary space, and in detecting the polarization of the gamma-ray from a mysterious astronomical object 'gamma-ray burst'. It is the first result of the detectors in the world exclusively aiming at detecting gamma-ray polarization. We mainly describe the hardware of our GAP equipment and show the method of preparing equipment to work in the cosmic space with a tight budget. The mechanical structure, the electronic circuits, the software on the equipment, the data analysis on the earth, and the scientific results gained by the observation just over one year, are presented after explaining the principle of gamma-ray polarization detection. Our design to protect equipment against mechanical shock and cosmic radiation may provide useful information for future preparation of compact satellite. (J.P.N.)
DEFF Research Database (Denmark)
Løvborg, Leif; Gaffney, C. F.; Clark, P. A.
1985-01-01
Experimental and/or theoretical estimates are presented concerning, (i) attenuation within the sample of beta and gamma radiation from the soil, (ii) the gamma dose within the sample due to its own radioactivity, and (iii) the soil gamma dose in the proximity of boundaries between regions...... of differing radioactivity. It is confirmed that removal of the outer 2 mm of sample is adequate to remove influence from soil beta dose and estimates are made of the error introduced by non-removal. Other evaluations include variation of the soil gamma dose near the ground surface and it appears...... that the present practice of avoiding samples above a depth of 0.3 m may be over-cautious...
A gamma beam profile imager for ELI-NP Gamma Beam System
Cardarelli, P.; Paternò, G.; Di Domenico, G.; Consoli, E.; Marziani, M.; Andreotti, M.; Evangelisti, F.; Squerzanti, S.; Gambaccini, M.; Albergo, S.; Cappello, G.; Tricomi, A.; Veltri, M.; Adriani, O.; Borgheresi, R.; Graziani, G.; Passaleva, G.; Serban, A.; Starodubtsev, O.; Variola, A.; Palumbo, L.
2018-06-01
The Gamma Beam System of ELI-Nuclear Physics is a high brilliance monochromatic gamma source based on the inverse Compton interaction between an intense high power laser and a bright electron beam with tunable energy. The source, currently being assembled in Magurele (Romania), is designed to provide a beam with tunable average energy ranging from 0.2 to 19.5 MeV, rms energy bandwidth down to 0.5% and flux of about 108 photons/s. The system includes a set of detectors for the diagnostic and complete characterization of the gamma beam. To evaluate the spatial distribution of the beam a gamma beam profile imager is required. For this purpose, a detector based on a scintillator target coupled to a CCD camera was designed and a prototype was tested at INFN-Ferrara laboratories. A set of analytical calculations and Monte Carlo simulations were carried out to optimize the imager design and evaluate the performance expected with ELI-NP gamma beam. In this work the design of the imager is described in detail, as well as the simulation tools used and the results obtained. The simulation parameters were tuned and cross-checked with the experimental measurements carried out on the assembled prototype using the beam from an x-ray tube.
International Nuclear Information System (INIS)
Hermsen, W.
1980-01-01
Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)
Gamma Ray Imaging System (GRIS) GammaCam trademark. Final report, January 3, 1994 - May 31, 1996
International Nuclear Information System (INIS)
1996-01-01
This report describes the activities undertaken during the development of the Gamma Ray Imaging System (GRIS) program now referred to as the GammaCam trademark. The purpose of this program is to develop a 2-dimensional imaging system for gamma-ray energy scenes that may be present in nuclear power plants. The report summarizes the overall accomplishments of the program and the most recent GammaCam measurements made at LANL and Estonia. The GammaCam is currently available for sale from AIL Systems as an off-the-shelf instrument
Nucleotide diversity analysis of three major bacterial blight resistance genes in rice.
Directory of Open Access Journals (Sweden)
Waikhom Bimolata
Full Text Available Nucleotide sequence polymorphisms among R gene alleles influence the process of co-evolutionary interaction between host and pathogen by shaping the response of host plants towards invading pathogens. Here, we present the DNA sequence polymorphisms and diversities present among natural alleles of three rice bacterial blight resistance genes, Xa21, Xa26 and xa5. The diversity was examined across different wild relatives and cultivars of Oryza species. Functional significance of selected alleles was evaluated through semi-quantitative reverse transcription polymerase chain reaction and real time PCR. The greatest nucleotide diversity and singleton variable sites (SVS were present in Xa26 (π = 0.01958; SVS = 182 followed by xa5 and Xa21 alleles. The highest frequency of single nucleotide polymorphisms were observed in Xa21 alleles and least in xa5. Transition bias was observed in all the genes and 'G' to 'A' transitions were more favored than other form of transitions. Neutrality tests failed to show the presence of selection at these loci, though negative Tajima's D values indicate the presence of a rare form of polymorphisms. At the interspecies level, O. nivara exhibited more diversity than O. sativa. We have also identified two nearly identical resistant alleles of xa5 and two sequentially identical alleles of Xa21. The alleles of xa5 showed basal levels of expression while Xa21 alleles were functionally not expressed.
1991-01-01
This photograph shows the Compton Gamma-Ray Observatory (GRO) being deployed by the Remote Manipulator System (RMS) arm aboard the Space Shuttle Atlantis during the STS-37 mission in April 1991. The GRO reentered Earth atmosphere and ended its successful mission in June 2000. For nearly 9 years, the GRO Burst and Transient Source Experiment (BATSE), designed and built by the Marshall Space Flight Center (MSFC), kept an unblinking watch on the universe to alert scientists to the invisible, mysterious gamma-ray bursts that had puzzled them for decades. By studying gamma-rays from objects like black holes, pulsars, quasars, neutron stars, and other exotic objects, scientists could discover clues to the birth, evolution, and death of stars, galaxies, and the universe. The gamma-ray instrument was one of four major science instruments aboard the Compton. It consisted of eight detectors, or modules, located at each corner of the rectangular satellite to simultaneously scan the entire universe for bursts of gamma-rays ranging in duration from fractions of a second to minutes. In January 1999, the instrument, via the Internet, cued a computer-controlled telescope at Las Alamos National Laboratory in Los Alamos, New Mexico, within 20 seconds of registering a burst. With this capability, the gamma-ray experiment came to serve as a gamma-ray burst alert for the Hubble Space Telescope, the Chandra X-Ray Observatory, and major gound-based observatories around the world. Thirty-seven universities, observatories, and NASA centers in 19 states, and 11 more institutions in Europe and Russia, participated in the BATSE science program.
Energy Technology Data Exchange (ETDEWEB)
Nefkens, B M; Prakhov, S; Aguar-Bartolom��, P; Annand, J R; Arends, H J; Bantawa, K; Beck, R; Bekrenev, V; Bergh��user, H; Braghieri, A; Briscoe, W J; Brudvik, J; Cherepnya, S; Codling, R F; Collicott, C; Costanza, S; Danilkin, I V; Denig, A; Demissie, B; Dieterle, M; Downie, E J; Drexler, P; Fil' kov, L V; Fix, A; Garni, S; Glazier, D I; Gregor, R; Hamilton, D; Heid, E; Hornidge, D; Howdle, D; Jahn, O; Jude, T C; Kashevarov, V L; K��ser, A; Keshelashvili, I; Kondratiev, R; Korolija, M; Kotulla, M; Koulbardis, A; Kruglov, S; Krusche, B; Lisin, V; Livingston, K; MacGregor, I J; Maghrbi, Y; Mancel, J; Manley, D M; McNicoll, E F; Mekterovic, D; Metag, V; Mushkarenkov, A; Nikolaev, A; Novotny, R; Oberle, M; Ortega, H; Ostrick, M; Ott, P; Otte, P B; Oussena, B; Pedroni, P; Polonski, A; Robinson, J; Rosner, G; Rostomyan, T; Schumann, S; Sikora, M H; Starostin, A; Strakovsky, I I; Strub, T; Suarez, I M; Supek, I; Tarbert, C M; Thiel, M; Thomas, A; Unverzagt, M; Watts, D P; Werthmueller, D; Witthauer, L
2014-08-01
A new measurement of the rare, doubly radiative decay eta->pi^0 gamma gamma was conducted with the Crystal Ball and TAPS multiphoton spectrometers together with the photon tagging facility at the Mainz Microtron MAMI. New data on the dependence of the partial decay width, Gamma(eta->pi^0 gamma gamma), on the two-photon invariant mass squared, m^2(gamma gamma), as well as a new, more precise value for the decay width, Gamma(eta->pi^0 gamma gamma) = (0.33+/-0.03_tot) eV, are based on analysis of 1.2 x 10^3 eta->pi^0 gamma gamma decays from a total of 6 x 10^7 eta mesons produced in the gamma p -> eta p reaction. The present results for dGamma(eta->pi^0 gamma gamma)/dm^2(gamma gamma) are in good agreement with previous measurements and recent theoretical calculations for this dependence.
Aad, Georges; Abdallah, Jalal; Abdinov, Ovsat; Abeloos, Baptiste; Aben, Rosemarie; Abolins, Maris; AbouZeid, Ossama; Abraham, Nicola; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allen, Benjamin William; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Armitage, Lewis James; Arnaez, Olivier; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Artz, Sebastian; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Augsten, Kamil; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Balunas, William Keaton; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barranco Navarro, Laura; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Bechtle, Philip; Beck, Hans~Peter; Becker, Kathrin; Becker, Maurice; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bedognetti, Matteo; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, Andrew Stuart; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Belyaev, Nikita; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez, Jose; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Berlendis, Simon; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertram, Iain Alexander; Bertsche, Carolyn; Bertsche, David; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bevan, Adrian John; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bielski, Rafal; Biesuz, Nicolo Vladi; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biondi, Silvia; Bjergaard, David Martin; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blanco, Jacobo Ezequiel; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Blunier, Sylvain; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Boerner, Daniela; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Bortfeldt, Jonathan; Bortoletto, Daniela; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Bossio Sola, Jonathan David; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Boutle, Sarah Kate; Boveia, Antonio; Boyd, James; Boyko, Igor; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Broughton, James; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Brunt, Benjamin; Bruschi, Marco; Bruscino, Nello; Bryant, Patrick; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Budagov, Ioulian; Buehrer, Felix; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burgard, Carsten Daniel; Burghgrave, Blake; Burka, Klaudia; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calace, Noemi; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Caloba, Luiz; Calvet, David; Calvet, Samuel; Calvet, Thomas Philippe; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminal Armadans, Roger; Camincher, Clement; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Carbone, Ryne Michael; Cardarelli, Roberto; Cardillo, Fabio; Carli, Ina; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Casper, David William; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavallaro, Emanuele; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerda Alberich, Leonor; Cerio, Benjamin; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Stephen Kam-wah; Chan, Yat Long; Chang, Philip; Chapman, John Derek; Charlton, Dave; Chatterjee, Avishek; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Che, Siinn; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Shenjian; Chen, Shion; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Huajie; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiarelli, Giorgio; Chiodini, Gabriele; Chisholm, Andrew; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chomont, Arthur Rene; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocio, Alessandra; Cirotto, Francesco; Citron, Zvi Hirsh; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Michael; Clark, Philip James; Clarke, Robert; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Colasurdo, Luca; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crawley, Samuel Joseph; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cúth, Jakub; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Dann, Nicholas Stuart; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Merlin; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Benedetti, Abraham; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Denysiuk, Denys; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Dette, Karola; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Clemente, William Kennedy; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Du, Yanyan; Duarte-Campderros, Jorge; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dutta, Baishali; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edson, William; Edwards, Nicholas Charles; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellajosyula, Venugopal; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Ennis, Joseph Stanford; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Federica; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farina, Christian; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fawcett, William James; Fayard, Louis; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Flaschel, Nils; Fleck, Ivor; Fleischmann, Philipp; Fletcher, Gareth Thomas; Fletcher, Gregory; Fletcher, Rob Roy MacGregor; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Flowerdew, Michael; Forcolin, Giulio Tiziano; Formica, Andrea; Forti, Alessandra; Foster, Andrew Geoffrey; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; Fressard-Batraneanu, Silvia; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fusayasu, Takahiro; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gach, Grzegorz; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Louis Guillaume; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gascon Bravo, Alberto; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Gecse, Zoltan; Gee, Norman; Geich-Gimbel, Christoph; Geisler, Manuel Patrice; Gemme, Claudia; Genest, Marie-Hélène; Geng, Cong; Gentile, Simonetta; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghasemi, Sara; Ghazlane, Hamid; Ghneimat, Mazuza; Giacobbe, Benedetto; Giagu, Stefano; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gignac, Matthew; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuli, Francesco; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; Gongadze, Alexi; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goudet, Christophe Raymond; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Graber, Lars; Grabowska-Bold, Iwona; Gradin, Per Olov Joakim; Grafström, Per; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Grefe, Christian; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Grevtsov, Kirill; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Groh, Sabrina; Grohs, Johannes Philipp; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guan, Wen; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Guo, Yicheng; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Hadef, Asma; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Hall, David; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Haney, Bijan; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Jochen Jens; Heinrich, Lukas; Heinz, Christian; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Henkelmann, Steffen; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohlfeld, Marc; Hohn, David; Holmes, Tova Ray; Homann, Michael; Hong, Tae Min; Hooberman, Benjamin Henry; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Qipeng; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Huo, Peng; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Introzzi, Gianluca; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ito, Fumiaki; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jain, Vivek; Jakobi, Katharina Bianca; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanneau, Fabien; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Hai; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Johansson, Per; Johns, Kenneth; Johnson, William Joseph; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Sarah; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Jovicevic, Jelena; Ju, Xiangyang; Juste Rozas, Aurelio; Köhler, Markus Konrad; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kajomovitz, Enrique; Kalderon, Charles William; Kaluza, Adam; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneti, Steven; Kanjir, Luka; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kaplan, Laser Seymour; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karentzos, Efstathios; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kasahara, Kota; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Kato, Chikuma; Katre, Akshay; Katzy, Judith; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Kentaro, Kawade; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Kharlamov, Alexey; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kido, Shogo; Kim, Hee Yeun; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Knapik, Joanna; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Koi, Tatsumi; Kolanoski, Hermann; Kolb, Mathis; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewska, Anna Bozena; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuechler, Jan Thomas; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kukla, Romain; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurova, Anastasia; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lammers, Sabine; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Lazzaroni, Massimo; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; Le Quilleuc, Eloi; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Lerner, Giuseppe; Leroy, Claude; Lesage, Arthur; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Qi; Li, Shu; Li, Xingguo; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Lindquist, Brian Edward; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Hongbin; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanlin; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loew, Kevin Michael; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Longo, Luigi; Looper, Kristina Anne; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lopez Solis, Alvaro; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Haonan; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luedtke, Christian; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lynn, David; Lysak, Roman; Lytken, Else; Lyubushkin, Vladimir; Ma, Hong; Ma, Lian Liang; Ma, Yanhui; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Maček, Boštjan; Machado Miguens, Joana; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeda, Junpei; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Maneira, José; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Mansoulie, Bruno; Mantifel, Rodger; Mantoani, Matteo; Manzoni, Stefano; Mapelli, Livio; Marceca, Gino; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mc Fadden, Neil Christopher; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McClymont, Laurie; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer Zu Theenhausen, Hanno; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mistry, Khilesh; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Monden, Ryutaro; Mondragon, Matthew Craig; Mönig, Klaus; Monk, James; Monnier, Emmanuel; Montalbano, Alyssa; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Mori, Daniel; Mori, Tatsuya; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munoz Sanchez, Francisca Javiela; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Muškinja, Miha; Myagkov, Alexey; Myska, Miroslav; Nachman, Benjamin Philip; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagano, Kunihiro; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Narrias Villar, Daniel Isaac; Naryshkin, Iouri; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Norjoharuddeen, Nurfikri; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nurse, Emily; Nuti, Francesco; O'grady, Fionnbarr; O'Neil, Dugan; O'Rourke, Abigail Alexandra; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Oleiro Seabra, Luis Filipe; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onogi, Kouta; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Adam Jackson; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pascuzzi, Vincent; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Penc, Ondrej; Peng, Cong; Peng, Haiping; Penwell, John; Peralva, Bernardo; Perego, Marta Maria; Perepelitsa, Dennis; Perez Codina, Estel; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petroff, Pierre; Petrolo, Emilio; Petrov, Mariyan; Petrucci, Fabrizio; Pettersson, Nora Emilia; Peyaud, Alan; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pilcher, James; Pilkington, Andrew; Pin, Arnaud Willy J; Pina, João Antonio; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pires, Sylvestre; Pirumov, Hayk; Pitt, Michael; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pozo Astigarraga, Mikel Eukeni; Pralavorio, Pascal; Pranko, Aliaksandr; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Puddu, Daniele; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Raine, John Andrew; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Ratti, Maria Giulia; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reichert, Joseph; Reisin, Hernan; Rembser, Christoph; Ren, Huan; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rifki, Othmane; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Rizzi, Chiara; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodina, Yulia; Rodriguez Perez, Andrea; Rodriguez Rodriguez, Daniel; Roe, Shaun; Rogan, Christopher Sean; Røhne, Ole; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Jonatan; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryu, Soo; Ryzhov, Andrey; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saha, Puja; Sahinsoy, Merve; Saimpert, Matthias; Saito, Tomoyuki; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Salazar Loyola, Javier Esteban; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sammel, Dirk; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sasaki, Yuichi; Sato, Koji; Sauvage, Gilles; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmieden, Kristof; Schmitt, Christian; Schmitt, Stefan; Schmitz, Simon; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schorlemmer, Andre Lukas; Schott, Matthias; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shaikh, Nabila Wahab; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyedruhollah; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sidebo, Per Edvin; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simon, Manuel; Sinervo, Pekka; Sinev, Nikolai; Sioli, Maximiliano; Siragusa, Giovanni; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Slovak, Radim; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Sokhrannyi, Grygorii; Solans Sanchez, Carlos; Solar, Michael; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Son, Hyungsuk; Song, Hong Ye; Sood, Alexander; Sopczak, Andre; Sopko, Vit; Sorin, Veronica; Sosa, David; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spangenberg, Martin; Spanò, Francesco; Sperlich, Dennis; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; St Denis, Richard Dante; Stabile, Alberto; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Giordon; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Stärz, Steffen; Staszewski, Rafal; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Suchek, Stanislav; Sugaya, Yorihito; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Svatos, Michal; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Shuji; Tannenwald, Benjamin Bordy; Tapia Araya, Sebastian; Tapprogge, Stefan; Tarem, Shlomit; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Aaron; Taylor, Geoffrey; Taylor, Pierre Thor Elliot; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira-Dias, Pedro; Temming, Kim Katrin; Temple, Darren; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tisserant, Sylvain; Todome, Kazuki; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Baojia(Tony); Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Trofymov, Artur; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tseng, Jeffrey; Tsiareshka, Pavel; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsui, Ka Ming; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turgeman, Daniel; Turra, Ruggero; Turvey, Andrew John; Tuts, Michael; Tyndel, Mike; Ucchielli, Giulia; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valdes Santurio, Eduardo; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vasquez, Jared Gregory; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloce, Laurelle Maria; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigani, Luigi; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vittori, Camilla; Vivarelli, Iacopo; Vlachos, Sotirios; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wallangen, Veronica; Wang, Chao; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Tingting; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Washbrook, Andrew; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Whallon, Nikola Lazar; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilk, Fabian; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winston, Oliver James; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamaguchi, Daiki; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yang, Zongchang; Yao, Weiming; Yap, Yee Chinn; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yuen, Stephanie P; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zakharchuk, Nataliia; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zeng, Jian Cong; Zeng, Qi; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Guangyi; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Rui; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Mingliang; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zwalinski, Lukasz
2016-06-02
The production of $Z$ bosons with one or two isolated high-energy photons is studied using $pp$ collisions at $\\sqrt{s}$ = 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 fb$^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic ($e^{+}e^{-}$, $\\mu^{+}\\mu^{-}$, $\
Gamma-gamma angular correlation measurement in the 100 Ru
International Nuclear Information System (INIS)
Kenchian, G.
1990-01-01
An angular correlation automatic spectrometer with two Ge(Li) detectors has been developed. The spectrometer moves automatically, controlled by a microcomputer. The gamma-gamma directional angular correlations of coincidence transitions have been measured in 100 Ru nuclide, following the β + and electron capture of 100 Rh. The 100 Rh source has been produced with 100 Ru(p,n) 100 Rh reaction, using the proton beam of the Cyclotron Accelerator insiding in 100 Ru isotope. (author)
Gamma spectrometry of 285-04 ILAS gamma scan wires
International Nuclear Information System (INIS)
Dassel, G.; Buurveld, H.A.; Plakman, J.C.
1996-12-01
In the frame work of their on-going sustain programme for the material development and characterization of fusion reactors, ECN is investigating the irradiation behaviour of ferritic/martensitic steels. In the fourth irradiation experiment 285-04, 55 steel tensile samples have been irradiated up to 2.5 dpa. Four gamma scan wires from this experiment have been examined by gamma scanning. The results of the measurements have been described in this report. (orig.)
Gamma-ray spectrometry applied to down-hole logging
International Nuclear Information System (INIS)
Dumesnil, P.; Umiastowsky, K.
1983-11-01
Gamma-ray spectrometry permits to improve the accuracy of natural gamma, gamma-gamma and neutron-gamma geophysical measurements. The probe developed at Centre d'Etudes Nucleaires de Saclay allows down-hole gamma-ray spectrometry. Among others, this probe can be applied to the uranium content determination by selective natural gamma method, down-hole determination of the ash content in the coal by gamma-gamma selective method and elemental analysis by neutron-gamma method. For the calibration and an exact interpretation of the measurements it is important to know the gamma-ray and neutron characteristics of the different kinds of rocks considered as probabilistic variables
Space instrumentation for gamma-ray astronomy
Energy Technology Data Exchange (ETDEWEB)
Teegarden, B.J
1999-02-11
The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world.
Space instrumentation for gamma-ray astronomy
International Nuclear Information System (INIS)
Teegarden, B.J.
1999-01-01
The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world
Gamma response study of radiation sensitive MOSFETs for their use as gamma radiation sensor
Energy Technology Data Exchange (ETDEWEB)
Srivastava, Saurabh; Kumar, A. Vinod [Radiation Safety Systems Division, Bhabha Atomic Research Centre, Mumbai (India); Aggarwal, Bharti; Singh, Arvind; Topkar, Anita, E-mail: anita@barc.gov.in [Electronics Division, Bhabha Atomic Research Centre, Mumbai (India)
2016-05-23
Continuous monitoring of gamma dose is important in various fields like radiation therapy, space-related research, nuclear energy programs and high energy physics experiment facilities. The present work is focused on utilization of radiation-sensitive Metal-Oxide-Semiconductor Field Effect Transistors (MOSFETs) to monitor gamma radiation doses. Static characterization of these detectors was performed to check their expected current-voltage relationship. Threshold voltage and transconductance per unit gate to source voltage (K factor) were calculated from the experimental data. The detector was exposed to gamma radiation in both, with and without gate bias voltage conditions, and change in threshold voltage was monitored at different gamma doses. The experimental data was fitted to obtain equation for dependence of threshold voltage on gamma dose. More than ten times increase in sensitivity was observed in biased condition (+3 V) compared to the unbiased case.
International Nuclear Information System (INIS)
Hillier, R.
1984-01-01
The book reviews the development of gamma ray astronomy over the past twenty five years. A large section of the book is devoted to the problems of background radiation and the design of detectors. Gamma rays from the sun, the galactic disc, the galaxy, and extra galactic sources; are also discussed. (U.K.)
International Nuclear Information System (INIS)
Span, F.J.
1988-01-01
The patent concerns a gamma tomography apparatus for medical diagnosis. The apparatus comprises a gamma scintillation camera head and a suspension system for supporting and positioning the camera head with respect for the patient. Both total body scanning and single photon emission tomography can be carried out with the apparatus. (U.K.)
Directory of Open Access Journals (Sweden)
Ye-Ping Li
2018-01-01
Conclusions: TIP30 expression was associated with clinical tumor stage in BUC, suggesting that it might play an important role in disease progression. Furthermore, TIP30 might predict postoperative OS. Thus, its evaluation might be useful for predicting prognosis.
Low level GAMMA0 spectrometry by beta-gamma coincidence
International Nuclear Information System (INIS)
Grigorescu, E.L.; Luca, A.; Razdolescu, A.C.; Ivan, C.
1999-01-01
Low level gamma spectrometry has a wide application, especially in environmental monitoring. Two variants, based on a beta-gamma coincidence technique, were studied. The equipment was composed of a beta detector and a Ge(Li) gamma detector (6% - relative efficiency), with the associated electronics. The gamma rays are recorded by the multichannel analyzer (4096 channels) only if the associated beta particles, which precede the gamma transitions, are registered in coincidence. Two types of beta detectors were used: plastic and liquid scintillators. In both cases, an external lead shield of 5 cm thick was used. The integral gamma background (50-1700 KeV) was reduced about 85 and 50 times, respectively. The corresponding MDA (Minimum Detectable Activity) values decreased about 1.5 and (3-7) times, respectively. The 2π sr plastic beta detector was placed on top the Ge(Li). The sample was inserted between the two detectors. The measurement time was 10 4 s. A 4π sr detector, built of the same material, was also studied, but it proved to be less advantageous because the background was reduced only 16 times; for a MDA reduction similar with that of the 2π sr variant, a longer measurement was needed (3.10 4 s). The other type of beta detector used, was a liquid scintillator. The dissolving of the samples in scintillator ensures a 4π sr measurement geometry. The vials with scintillator (10 ml volume) were placed on top the Ge(Li) and visualised by the photocathode of a phototube. This setup was surrounded by an enclosure which prevent the light penetration. The measurement time was 10 4 s. The only difficulty encountered in this low level measurement method is the accurate determination of the beta efficiency. A limitation is the possibility to measure only small mass samples. These variants are more simple and cheaper than others, previously studied. The advantage of the method is obvious when, instead of low MDA values, shorter measurement times are preferred. The
Gamma spectrometry of 285-03 ILAS gamma scan wires
International Nuclear Information System (INIS)
Dassel, G.; Buurveld, H.A.; Plakman, J.C.
1996-12-01
In the frame work of their on-going sustain programme for the material development and characterization of fusion reactors, ECN is investigating the irradiation behaviour of ferritic/martensitic steels. In the third irradiation experiment 285-03, 55 vanadium (V-4Cr-4Ti) tensile samples have been irradiated up to 6 dpa. Four gamma scan wires from this experiment have been examined by gamma scanning. The results of the measurements have been described in this report. (orig.)
The measurement of gamma ray induced heating in a mixed neutron and gamma ray environment
International Nuclear Information System (INIS)
Chiu, H.K.
1991-10-01
The problem of measuring the gamma heating in a mixed DT neutron and gamma ray environment was explored. A new detector technique was developed to make this measurement. Gamma heating measurements were made in a low-Z assembly irradiated with 14-Mev neutrons and (n, n') gammas produced by a Texas Nuclear Model 9400 neutron generator. Heating measurements were made in the mid-line of the lattice using a proportional counter operating in the Continuously-varied Bias-voltage Acquisition mode. The neutron-induced signal was separated from the gamma-induced signal by exploiting the signal rise-time differences inherent to radiations of different linear energy transfer coefficient, which are observable in a proportional counter. The operating limits of this measurement technique were explored by varying the counter position in the low-Z lattice, hence changing the irradiation spectrum observed. The experiment was modelled numerically to help interpret the measured results. The transport of neutrons and gamma rays in the assembly was modelled using the one- dimensional radiation transport code ANISN/PC. The cross-section set used for these calculations was derived from the ENDF/B-V library using the code MC 2 -2 for the case of DT neutrons slowing down in a low-Z material. The calculated neutron and gamma spectra in the slab and the relevant mass-stopping powers were used to construct weighting factors which relate the energy deposition in the counter fill-gas to that in the counter wall and in the surrounding material. The gamma energy deposition at various positions in the lattice is estimated by applying these weighting factors to the measured gamma energy deposition in the counter at those locations
Apparatus for gamma ray radiography
International Nuclear Information System (INIS)
Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi
1979-01-01
This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)
Simultaneous neutron and gamma spectrum adjustment
International Nuclear Information System (INIS)
Remec, I.
1996-01-01
The spectrum adjustment procedure was extended to simultaneous neutron and gamma spectrum adjustment, and the feasibility of this technique is demonstrated in the analysis of HFIR dosimetry experiments. Conditions in which gamma rays may contribute considerably to radiation damage in steels are discussed. Beryllium helium accumulation fluence monitors (HAFMs) were found to be good monitors in gamma fields of intensities high enough to contribute to steel embrittlement. Use of 237 Np, 238 U, and 9 Be HAFM as gamma dosimeters is proposed for high-dose irradiations in high-energy, high-intensity gamma fields
Energy Technology Data Exchange (ETDEWEB)
Julliot, C. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1960-07-01
The scintillation detector forms the main part of the instrument used, the electronic unit presenting the results produced. After a brief description of the process of {gamma} photon absorption in the material, the particular case of NaI (T1), the scintillator used, is examined. The intensity of the scintillation caused by {gamma} ray absorption and the characteristics of the photomultiplier play a determining part in the energy resolution of the instrument. For the {gamma} recording spectrograph, we show to what extent the technique for using the electronic unit can modify the results. A detailed description is given of the activity measurement of a {gamma}-emitting radioelement by the spectrographic method. (author) [French] Dans l'appareillage utilise, le detecteur a scintillations constitue la piece maitresse, l'ensemble electronique presente les resultats issus du detecteur. Apres avoir brievement decrit le processus d'absorption des photons {gamma} dans la matiere, nous examinons le cas particulier du NaI(T1), le scintillateur utilise. L'intensite de la scintillation provoque par l'absorption des rayons {gamma} et les caracteristiques du photomultiplicateur jouent un role determinant dans la resolution en energie de l'appareil. Pour le spectrographe {gamma} enregistreur, nous indiquons dans quelle mesure la technique d'utilisation de l'ensemble electronique peut modifier les resultats. La-mesure de l'activite d'un radioelement emetteur {gamma} par spectrographie fait l'objet d'une description detaillee. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Julliot, C [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1960-07-01
The scintillation detector forms the main part of the instrument used, the electronic unit presenting the results produced. After a brief description of the process of {gamma} photon absorption in the material, the particular case of NaI (T1), the scintillator used, is examined. The intensity of the scintillation caused by {gamma} ray absorption and the characteristics of the photomultiplier play a determining part in the energy resolution of the instrument. For the {gamma} recording spectrograph, we show to what extent the technique for using the electronic unit can modify the results. A detailed description is given of the activity measurement of a {gamma}-emitting radioelement by the spectrographic method. (author) [French] Dans l'appareillage utilise, le detecteur a scintillations constitue la piece maitresse, l'ensemble electronique presente les resultats issus du detecteur. Apres avoir brievement decrit le processus d'absorption des photons {gamma} dans la matiere, nous examinons le cas particulier du NaI(T1), le scintillateur utilise. L'intensite de la scintillation provoque par l'absorption des rayons {gamma} et les caracteristiques du photomultiplicateur jouent un role determinant dans la resolution en energie de l'appareil. Pour le spectrographe {gamma} enregistreur, nous indiquons dans quelle mesure la technique d'utilisation de l'ensemble electronique peut modifier les resultats. La-mesure de l'activite d'un radioelement emetteur {gamma} par spectrographie fait l'objet d'une description detaillee. (auteur)
Application of gamma-gamma logging in predicting anomalous geodynamic phenomena in hard coal mines
International Nuclear Information System (INIS)
Blaha, F.; Keclik, L.
1980-01-01
The application is discussed of gamma-gamma logging in the prediction of dynamic events like coal and gas bursts, coal sliding in medium dip seams and rock bumps. The overall analysis of the applied rock characterization method and of the measurement results shows that the prediction possibilities of dynamic events are partly limited due to specific effects of the rock massive. In these cases, however, unambiguous results may be obtained by other geophysical methods such as seismoacoustic testing etc. In most cases, however, the gamma-gamma logging results may be used for estimating the degree of dynamic events or checking the efficiency of preventive measures in the locality under investigation. (author)
Study of the $K^{\\pm} \\rightarrow \\pi^{\\pm} \\gamma \\gamma$ decay by the NA62 experiment
INSPIRE-00100355; Romano, A.; Ceccucci, A.; Danielsson, H.; Falaleev, V.; Gatignon, L.; Goy Lopez, S.; Hallgren, B.; Maier, A.; Peters, A.; Piccini, M.; Riedler, P.; Frabetti, P.L.; Gersabeck, E.; Kekelidze, V.; Madigozhin, D.; Misheva, M.; Molokanova, N.; Movchan, S.; Shkarovskiy, S.; Zinchenko, A.; Rubin, P.; Baldini, W.; Cotta Ramusino, A.; Dalpiaz, P.; Fiorini, M.; Gianoli, A.; Norton, A.; Petrucci, F.; Savrie, M.; Wahl, H.; Bizzeti, A.; Bucci, F.; Iacopini, E.; Lenti, M.; Veltri, M.; Antonelli, A.; Moulson, M.; Raggi, M.; Spadaro, T.; Eppard, K.; Hita-Hochgesand, M.; Kleinknecht, K.; Renk, B.; Wanke, R.; Winhart, A.; Winston, R.; Bolotov, V.; Duk, V.; Gushchin, E.; Ambrosino, F.; Di Filippo, D.; Massarotti, P.; Napolitano, M.; Palladino, V.; Saracino, G.; Anzivino, G.; Imbergamo, E.; Piandani, R.; Sergi, A.; Cenci, P.; Pepe, M.; Costantini, F.; Doble, N.; Giudici, S.; Pierazzini, G.; Sozzi, M.; Venditti, S.; Balev, S.; Collazuol, G.; Di, L.; Gallorini, S.; Goudzovski, E.; Lamanna, G.; Mannelli, I.; Ruggiero, G.; Cerri, C.; Fantechi, R.; Kholodenko, S.; Kurshetsov, V.; Obraztsov, V.; Semenov, V.; Yushchenko, O.; D'Agostini, G.; Leonardi, E.; Serra, M.; Valente, P.; Fucci, A.; Salamon, A.; Bloch-Devaux, B.; Peyaud, B.; Engelfried, J.; Coward, D.; Kozhuharov, V.; Litov, L.; Arcidiacono, R.; Bifani, S.; Biino, C.; Dellacasa, G.; Marchetto, F.; Numao, T.; Retiere, F.
2014-05-01
A study of the dynamics of the rare decay $K^\\pm\\to\\pi^\\pm\\gamma\\gamma$ has been performed on a sample of 232 decay candidates, with an estimated background of $17.4\\pm1.1$ events, collected by the NA62 experiment at CERN in 2007. The results are combined with those from a measurement conducted by the NA48/2 collaboration at CERN. The combined model-independent branching ratio in the kinematic range $z=(m_{\\gamma\\gamma}/m_K)^2>0.2$ is ${\\cal B}_{\\rm MI}(z>0.2) = (0.965 \\pm 0.063) \\times 10^{-6}$, and the combined branching ratio in the full kinematic range assuming a Chiral Perturbation Theory description is ${\\cal B}(K_{\\pi\\gamma\\gamma}) = (1.003 \\pm 0.056) \\times 10^{-6}$. A detailed comparison of the results with the previous measurements is performed.
Processing of gamma-ray spectrometric logs
International Nuclear Information System (INIS)
Umiastowski, K.; Dumesnil, P.
1984-10-01
CEA (Commissariat a l'Energie Atomique) has developped a gamma-ray spectrometric tool, containing an analog-to-digital converter. This new tool permits to perform very precise uranium logs (natural gamma-ray spectrometry), neutron activation logs and litho-density logs (gamma-gamma spectrometric logs). Specific processing methods were developped to treate the particular problems of down-hole gamma-ray spectrometry. Extraction of the characteristic gamma-ray peak, even if they are superposed on the background radiation of very high intensity, is possible. This processing methode enables also to obtain geological informations contained in the continuous background of the spectrum. Computer programs are written in high level language for SIRIUS (VICTOR) and APOLLO computers. Exemples of uranium and neutron activation logs treatment are presented [fr
Barate, R.; Ghez, Philippe; Goy, C.; Lees, J.P.; Merle, E.; Minard, M.N.; Pietrzyk, B.; Alemany, R.; Bravo, S.; Casado, M.P.; Chmeissani, M.; Crespo, J.M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Grauges, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Pacheco, A.; Riu, I.; Ruiz, H.; Colaleo, A.; Creanza, D.; De Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix, G.; Buchmuller, O.; Cattaneo, M.; Cerutti, F.; Ciulli, V.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Greening, T.C.; Halley, A.W.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, Gigi; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Wright, A.E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Blondel, A.; Bonneaud, G.; Brient, J.C.; Rouge, A.; Rumpf, M.; Swynghedauw, M.; Verderi, M.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Lynch, J.G.; Negus, P.; O'Shea, V.; Raine, C.; Teixeira-Dias, P.; Thompson, A.S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Martin, E.B.; Marinelli, N.; Sciaba, A.; Sedgbeer, J.K.; Thomson, Evelyn J.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C.K.; Buck, P.G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Robertson, N.A.; Williams, M.I.; Giehl, I.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; Wachsmuth, H.; Zeitnitz, C.; Aubert, J.J.; Bonissent, A.; Carr, J.; Coyle, P.; Payre, P.; Rousseau, D.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Buescher, Volker; Dietl, H.; Ganis, G.; Huttmann, K.; Lutjens, G.; Mannert, C.; Manner, W.; Moser, H.G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, P.; Jacholkowska, A.; Le Diberder, F.; Lefrancois, J.; Lutz, A.M.; Schune, M.H.; Veillet, J.J.; Videau, I.; Zerwas, D.; Bagliesi, Giuseppe; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Ferrante, I.; Foa, L.; Giassi, A.; Gregorio, A.; Ligabue, F.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Cowan, G.; Green, M.G.; Medcalf, T.; Strong, J.A.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Norton, P.R.; Thompson, J.C.; Tomalin, I.R.; Bloch-Devaux, Brigitte; Colas, P.; Emery, S.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S.N.; Dann, J.H.; Johnson, R.P.; Kim, H.Y.; Konstantinidis, N.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Cartwright, S.; Combley, F.; Lehto, M.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Grupen, C.; Hess, J.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Rothberg, J.; Wasserbaech, S.; Armstrong, S.R.; Elmer, P.; Ferguson, D.P.S.; Gao, Y.; Gonzalez, S.; Hayes, O.J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P.A., III; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; von Wimmersperg-Toeller, J.H.; Wu, Sau Lan; Wu, X.; Zobernig, G.
2000-01-01
Data taken with the ALEPH detector at LEP1 have been used to search for gamma gamma production of the glueball candidates f0(1500) and fJ(1710) via their decay to pi+pi-. No signal is observed and upper limits to the product of gamma gamma width and pi+pi- branching ratio of the f0(1500) and the fJ(1710) have been measured to be Gamma_(gamma gamma -> f0(1500)). BR(f0(1500)->pi+pi-) fJ(1710)). BR(fJ(1710)->pi+pi-) < 0.55 keV at 95\\-onfidence level.
Distinguishing 'Higgs' spin hypotheses using $\\gamma \\gamma$ and $W W^*$ decays
Ellis, John; Hwang, Dae Sung; Sanz, Veronica; You, Tevong
2013-01-01
The new particle X recently discovered by the ATLAS and CMS Collaborations in searches for the Higgs boson has been observed to decay into gamma gamma, ZZ* and WW*, but its spin and parity, J^P, remain a mystery, with J^P = 0^+ and 2^+ being open possibilities. We use PYTHIA and Delphes to simulate an analysis of the angular distribution of gg to X to gamma gamma decays in a full 2012 data set, including realistic background levels. We show that this angular distribution should provide strong discrimination between the possibilities of spin zero and spin two with graviton-like couplings: ~ 3 sigma if a conservative symmetric interpretation of the log-likelihood ratio (LLR) test statistic is used, and ~ 6 sigma if a less conservative asymmetric interpretation is used. The WW and ZZ couplings of the Standard Model Higgs boson and of a 2^+ particle with graviton-like couplings are both expected to exhibit custodial symmetry. We simulate the present ATLAS and CMS search strategies for X to WW* using PYTHIA and De...
GRAP, Gamma-Ray Level-Scheme Assignment
International Nuclear Information System (INIS)
Franklyn, C.B.
2002-01-01
1 - Description of program or function: An interactive program for allocating gamma-rays to an energy level scheme. Procedure allows for searching for new candidate levels of the form: 1) L1 + G(A) + G(B) = L2; 2) G(A) + G(B) = G(C); 3) G(A) + G(B) = C (C is a user defined number); 4) L1 + G(A) + G(B) + G(C) = L2. Procedure indicates intensity balance of feed and decay of each energy level. Provides for optimization of a level energy (and associated error). Overall procedure allows for pre-defining of certain gamma-rays as belonging to particular regions of the level scheme, for example, high energy transition levels, or due to beta- decay. 2 - Method of solution: Search for cases in which the energy difference between two energy levels is equal to a gamma-ray energy within user-defined limits. 3 - Restrictions on the complexity of the problem: Maximum number of gamma-rays: 999; Maximum gamma ray energy: 32000 units; Minimum gamma ray energy: 10 units; Maximum gamma-ray intensity: 32000 units; Minimum gamma-ray intensity: 0.001 units; Maximum number of levels: 255; Maximum level energy: 32000 units; Minimum level energy: 10 units; Maximum error on energy, intensity: 32 units; Minimum error on energy, intensity: 0.001 units; Maximum number of combinations: 6400 (ca); Maximum number of gamma-ray types : 127
Gamma-Gompertz life expectancy at birth
Directory of Open Access Journals (Sweden)
Trifon I. Missov
2013-02-01
Full Text Available BACKGROUND The gamma-Gompertz multiplicative frailty model is the most common parametric modelapplied to human mortality data at adult and old ages. The resulting life expectancy hasbeen calculated so far only numerically. OBJECTIVE Properties of the gamma-Gompertz distribution have not been thoroughly studied. The focusof the paper is to shed light onto its first moment or, demographically speaking, characterizelife expectancy resulting from a gamma-Gompertz force of mortality. The paperprovides an exact formula for gamma-Gompertz life expectancy at birth and a simplerhigh-accuracy approximation that can be used in practice for computational convenience.In addition, the article compares actual (life-table to model-based (gamma-Gompertzlife expectancy to assess on aggregate how many years of life expectancy are not captured(or overestimated by the gamma-Gompertz mortality mechanism. COMMENTS A closed-form expression for gamma-Gomeprtz life expectancy at birth contains a special(the hypergeometric function. It aids assessing the impact of gamma-Gompertz parameterson life expectancy values. The paper shows that a high-accuracy approximation canbe constructed by assuming an integer value for the shape parameter of the gamma distribution.A historical comparison between model-based and actual life expectancy forSwedish females reveals a gap that is decreasing to around 2 years from 1950 onwards.Looking at remaining life expectancies at ages 30 and 50, we see this gap almost disappearing.
New program and boundary plasma research in GAMMA 10 modification (GAMMA-PDX)
International Nuclear Information System (INIS)
Imai, Tsuyoshi
2011-01-01
GAMMA 10 is the world's largest tandem mirror machine. Since the incorporation of national universities in 2004, many R and D activities taking advantage of its features have been performed in GAMMA 10 to contribute to the development of thermonuclear fusion researches. In the second mid-term plan since 2010, modification of the machine has been proposed to start boundary plasma research projects. Cooperative studies with other groups in Japan on divertor plasmas and particle transports are conducted by taking advantage of the potential control ability and the availability of the hot ion flux of GAMMA 10. (J.P.N.)
Equipment for x- and gamma ray radiography
International Nuclear Information System (INIS)
Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail
2004-01-01
The following topics related to the equipment for x - and gamma ray radiography are discussed in this chapter. The topics are x-ray source for Industrial Radiography: properties of x-ray, generation of x-ray, mechanism of x-ray production, x-ray equipment, power supply, distribution of x-ray intensity along the tube: gamma ray source for Industrial Radiography: properties of gamma rays, gamma ray sources, gamma ray projectors on cameras, source changing. Care of Radiographic Equipments: Merits and Demerits of x and Gamma Rays
A simple neutron-gamma discriminating system
International Nuclear Information System (INIS)
Liu Zhongming; Xing Shilin; Wang Zhongmin
1986-01-01
A simple neutron-gamma discriminating system is described. A detector and a pulse shape discriminator are suitable for the neutron-gamma discriminating system. The influence of the constant fraction discriminator threshold energy on the neutron-gamma resolution properties is shown. The neutron-gamma timing distributions from an 241 Am-Be source, 2.5 MeV neutron beam and 14 MeV neutron beam are presented
Relativistic motion in gamma-ray bursts
International Nuclear Information System (INIS)
Krolik, J.H.; Pier, E.A.
1991-01-01
Three fundamental problems affect models of gamma-ray bursts, i.e., the energy source, the ability of high-energy photons to escape the radiation region, and the comparative weakness of X-ray emission. It is indicated that relativistic bulk motion of the gamma-ray-emitting plasma generically provides a solution to all three of these problems. Results show that, if the plasma that produces gamma-ray bursts has a bulk relativistic velocity with Lorentz factor gamma of about 10, several of the most troubling problems having to do with gamma-ray bursts are solved. 42 refs
DELTA - a computer program to analyze gamma-gamma angular correlations from unaligned states
International Nuclear Information System (INIS)
Ekstroem, L.P.
1983-10-01
A computer program to analyze gamma-gamma angular correlations from radioactive decay and from thermal-neutron capture is described. The program can, in addition to correlation data, handle mixing ratio and conversion coefficient data. (author)
Reaction /sup 56/Fe (. gamma. ,. cap alpha. /sub 0/) and /sup 56/Fe (. gamma. , p/sub 0/)
Energy Technology Data Exchange (ETDEWEB)
Tamae, T; Sugawara, M [Tohoku Univ., Sendai (Japan). Lab. of Nuclear Science; Tsubota, H
1975-06-01
Precise analysis was made on the cross section of the /sup 56/Fe (..gamma.., ..cap alpha../sub 0/) reaction and the angular distribution at Esub(e) = 17 MeV, including the systematic error. The (..gamma.., ..cap alpha../sub 0/) reaction cross section was compared with a calculation using the compound nucleus model, utilizing the photon absorption cross section derived from the experimental values of /sup 56/Fe (..gamma.., n) and /sup 56/Fe (..gamma.., p) cross sections. From the (..gamma.., ..cap alpha../sub 0/) reaction cross section data of various nuclei, an empirical formula was obtained for determining the position of a peak in the (..gamma.., ..cap alpha../sub 0/) reaction cross section. The /sup 56/Fe (..gamma.., p/sub 0/) reaction cross section measured at an excitation energy in the range of 14.6--25.0 MeV was compared with the calculated one with the compound nucleus model, but the form and size differ totally.
Energy Technology Data Exchange (ETDEWEB)
Postelt, Frederik; Gerald, Kirchner [Carl Friedrich von Weizsaecker-Centre for Science and Peace Research, Hamburg (Germany)
2015-07-01
Measurements of neutron induced gammas allow the characterisation of fissile material (i.e. plutonium and uranium), despite self- and additional shielding. Most prompt gamma-rays from radiative neutron capture reactions in fissile material have energies between 3 and 6.5 MeV. Such high energy photons have a high penetrability and therefore minimise shielding and self-absorption effects. They are also isotope specific and therefore well suited to determine the isotopic composition of fissile material. As they are non-destructive, their application in dismantlement verification is desirable. Disadvantages are low detector efficiencies at high gamma energies, as well as a high background of gammas which result from induced fission reactions in the fissile material, as well as delayed gammas from both, (n,f) and(n,gamma) reactions. In this talk, simulations of (n,gamma) measurements and their implications are presented. Their potential for characterising fissile material is assessed and open questions are addressed.
Free vibration of elastically supported thin cylinders including gyroscopic effects
CSIR Research Space (South Africa)
Loveday, PW
1998-10-29
Full Text Available [ The equations D[R[ 747723 JSV 106:2 "Issue# MS 1560 VIBRATION OF THIN CYLINDERS 442 required for this procedure\\ including the gyroscopic terms\\ are included in Appendix A[ The displacement functions can then be written as follows] W"x# C0 cosh a0xa C1 sinh a0... xa C2 cos g1xa C3 sin g1xa epx:a0C4 cos qxa C5 sin qxa 1 e px:a0C6 cos qxa C7 sin qxa 1 "6a# V"x# A0C0 cosh a0xa A0C1 sinh a0xa A2C2 cos g1xa A2C3 sin g1xa epx:a$"A4C4 A5C5# cos qxa "A4C5 A5C4# sin qxa % e px:a$"A4C6 A5C7# cos...
International Nuclear Information System (INIS)
Yamagami, Takamasa
1985-01-01
Ballon experiments for searching gamma-ray burst were carried out by employing rotating-cross modulation collimators. From a very long observation of total 315 hours during 1975 to 1979, three gamma-ray intensity anomalies were observed which were speculated as a gamma-ray burst. As for the first gamma-ray intensity anomaly observed in 1975, the burst source could be located precisely but the source, heavenly body, could not be specified. Gamma-ray burst source estimation was made by analyzing distribution of burst source in the celestial sphere, burst size distribution, and burst peak. Using the above-mentioned data together with previously published ones, apparent inconsistency was found between the observed results and the adopted theory that the source was in the Galaxy, and this inconsistency was found due to the different time profiles of the burst observed with instruments of different efficiency. It was concluded by these analysis results that employment of logN - logP (relation between burst frequency and burst count) was better than that of logN - logS (burst size) in the examination of gamma-ray burst because the former was less uncertain than the latter. Analyzing the author's observed gamma-ray burst data and the related published data, it was clarified that the burst distribution was almost P -312 for the burst peak value larger than 10 -6 erg/cm 2 .sec. The author could indicate that the calculated celestial distribution of burst source was consistent with the observed results by the derivation using the logN - logP relationship and that the burst larger than 10 -6 erg/cm 2 .sec happens about one thousand times a year, about ten times of the previous value. (Takagi, S.)
Observation of solar gamma-ray by Hinotori
International Nuclear Information System (INIS)
Yoshimori, Masato; Okudaira, Kiyoaki; Hirashima, Yo; Kondo, Ichiro.
1982-01-01
The solar gamma-ray emitted by solar flare was observed. The gamma-ray is the electromagnetic radiation with the energy more than 300 keV. The line gamma-ray intensity and the time profile were observed. The gamma-ray detector CsI (Tl) was loaded on Hinotori, and the observed gamma-ray was analyzed by a multi-channel analyzer. The observed line gamma-ray was the radiation from Fe-56 and Ne-20. The line gamma-ray from C-12 and O-16 was also seen. These gamma-ray is the direct evidence of the nuclear reaction on the sun. The observed spectrum suggested the existence of the lines from Mg-24 and Si-28. The intensity of the 2.22 MeV gamma-line was small. This fact showed that the origin of this line was different from other nuclear gamma-ray. Two kinds of hard X-ray bursts were detected. The one was impulsive burst, and the other was gradual burst. There was no time difference between the hard X-ray and the gamma-ray of the impulsive burst. The impulsive burst may be explained by the beam model. The delay of time profile in the high energy gamma-ray of the gradual burst was observed. This means that the time when accelerated electrons cause bremsstrahlung depends on the electron energy. The long trapping of electrons at the top of magnetic loop is suggested. (Kato, T.)
1992-01-01
Crosslinking of the low affinity immunoglobulin G (IgG) Fc receptor (Fc gamma R type III) on natural killer (NK) cells initiates antibody- dependent cellular cytotoxicity. During this process, Fc gamma R stimulation results in the rapid activation of phospholipase C (PLC), which hydrolyzes membrane phosphoinositides, generating inositol-1,4,5- trisphosphate and sn-1,2-diacylglycerol as second messengers. We have recently reported that PLC activation after Fc gamma R stimulation can be inhibit...
Economics of gamma irradiation processing
International Nuclear Information System (INIS)
Tani, Toshio
1980-01-01
The gamma-ray irradiation business started at the Takasaki Laboratory of Japan Atomic Energy Research Institute. The irradiation facilities were constructed thereafter at various sites. The facilities must accept various types of irradiation, and must be constructed as multi-purpose facilities. The cost of irradiation consists of the cost of gamma sources, construction expense, personnel expense, management expense, and bank interest. Most of the expenses are considered to be fixed expense, and the amount of irradiation treatment decides the original costs of work. The relation between the irradiation dose and the construction expense shows the larger facility is more economical. The increase of amount of treatment reduces the original cost. The utilization efficiency becomes important when the amount of treatment and the source intensity exceed some values. The principal subjects of gamma-ray irradiation business are the sterilization of medical tools and foods for aseptic animals, the improvement of quality of plastic goods, and the irradiation of foods. Among them, the most important subject is the sterilization of medical tools. The cost of gamma irradiation per m 3 in still more expensive than that by ethylene oxide gas sterilization. However, the demand of gamma-ray irradiation is increasing. For the improvement of quality of plastic goods, electron irradiation is more favourable than the gamma irradiation. In near future, the economical balance of gamma irradiation can be achieved. (Kato, T.)
Highlights of GeV Gamma-Ray Astronomy
Thompson, David J.
2010-01-01
Because high-energy gamma rays are primarily produced by high-energy particle interactions, the gamma-ray survey of the sky by the Fermi Gamma-ray Space Telescope offers a view of sites of cosmic ray production and interactions. Gamma-ray bursts, pulsars, pulsar wind nebulae, binary sources, and Active Galactic Nuclei are all phenomena that reveal particle acceleration through their gamma-ray emission. Diffuse Galactic gamma radiation, Solar System gamma-ray sources, and energetic radiation from supernova remnants are likely tracers of high-energy particle interactions with matter and photon fields. This paper will present a broad overview of the constantly changing sky seen with the Large Area Telescope (LAT) on the Fermi spacecraft.
Spontaneous Gamma Activity in Schizophrenia.
Hirano, Yoji; Oribe, Naoya; Kanba, Shigenobu; Onitsuka, Toshiaki; Nestor, Paul G; Spencer, Kevin M
2015-08-01
A major goal of translational neuroscience is to identify neural circuit abnormalities in neuropsychiatric disorders that can be studied in animal models to facilitate the development of new treatments. Oscillations in the gamma band (30-100 Hz) of the electroencephalogram have received considerable interest as the basic mechanisms underlying these oscillations are understood, and gamma abnormalities have been found in schizophrenia (SZ). Animal models of SZ based on hypofunction of the N-methyl-d-aspartate receptor (NMDAR) demonstrate increased spontaneous broadband gamma power, but this phenomenon has not been identified clearly in patients with SZ. To examine spontaneous gamma power and its relationship to evoked gamma oscillations in the auditory cortex of patients with SZ. We performed a cross-sectional study including 24 patients with chronic SZ and 24 matched healthy control participants at the Veterans Affairs Boston Healthcare System from January 1, 2009, through December 31, 2012. Electroencephalograms were obtained during auditory steady-state stimulation at multiple frequencies (20, 30, and 40 Hz) and during a resting state in 18 participants in each group. Electroencephalographic activity in the auditory cortex was estimated using dipole source localization. Auditory steady-state response (ASSR) measures included the phase-locking factor and evoked power. Spontaneous gamma power was measured as induced (non-phase-locked) gamma power in the ASSR data and as total gamma power in the resting-state data. The ASSR phase-locking factor was reduced significantly in patients with SZ compared with controls for the 40-Hz stimulation (mean [SD], 0.075 [0.028] vs 0.113 [0.065]; F1,46 = 6.79 [P = .012]) but not the 20- or the 30-Hz stimulation (0.042 [0.038] vs 0.043 [0.034]; F1,46 = 0.006 [P = .938] and 0.084 [0.040] vs 0.098 [0.050]; F1,46 = 1.605 [P = .212], respectively), repeating previous findings. The mean [SD] broadband-induced (30
Investigation of {sup 136} Ba gamma-Transitions in the (n,n` gamma) Reaction
Energy Technology Data Exchange (ETDEWEB)
Sergiwa, S M [University of Garyuonis, Benghazi, (Libyan Arab Jamahiriya); Rateb, G M; Zleetni, S M; dufani, M M; Shermit, A M; Al Hamidi, M M [Tajoura Nuclear Research Center, Tripoli, (Libyan Arab Jamahiriya); El-Ahrash, M S [7th of April University, Zawia, (Libyan Arab Jamahiriya)
1995-10-01
Using the reactor fast neutron beam, angular distribution and linear polarization of gamma-rays emitted from the {sup 136} Ba (n,n` gamma) reaction were measured. From these measurements, a decay scheme of {sup 1}36{sup B}a has been constructed. New spin and parity (J{pi}) assignments as well as resolving ambiguities in previous assignments for some levels were done. In addition, multipole mixing rations ({delta} - values, important for model comparison) have been unambiguously determined for many gamma-transitions. 1 fig., 2 tabs.
Gamma factors of an ambulatory source; Factores gamma de una fuente ambulatoria
Energy Technology Data Exchange (ETDEWEB)
Arcos P, A; Vega C, H R; Manzanares A, E; Salas L, M A; Hernandez D, V M [Unidades Academicas de Estudios Nucleares e Ingenieria Electrica, Universidad Autonoma de Zacatecas, C. Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Barquero, R [Hospital Universitario del Rio Hortega, E-47010 Valladolid (Spain)
2007-07-01
Some of the procedures for diagnostic or treatment used in the medicine use radioactive materials as the I{sup 131}. By means of Monte Carlo methods were calculated the doses in the internal organs of a woman, with three months of pregnancy, due to the radioiodine captured by her thyroid, as well as to 1 meter of the gland. A three-dimensional mathematical model of the body of a woman was used and by means of Monte Carlo, the radioiodine photons were transported isotropically from the thyroid toward the whole body and was calculated the absorbed dose by their internal organs, also the Kerma in air (K) was determined and the environmental equivalent dose (H{sup *}(10)) at 1 m of the gland. Two activity factors at dose were determined, Gamma Factors that it allows to estimate the dose that the patient produces to people to its around. Of the gamma radiation that emits the I{sup 131} in the thyroid was found that the thymus receives the biggest dose while the uterus is the organ that smaller dose receives. The determined gamma factors were: {gamma}{sub KAire} = 56 {mu}Gy-m{sup 2}-h{sup -1}-GBq{sup -1}, and {gamma}{sub H}{sup *}{sub (10)} = 73 {mu}Sv-m{sup 2}-h{sup -1}-GBq{sup -1}. The distribution of the absorbed dose by the internal organs is attributed to the relative distance among the thyroid and the other organs, to the inter-organs shielding, its size and to its elementary composition. The {gamma}{sub KAire} and {gamma}{sub H}{sup *}{sub (10)} factors allow to estimate the exposure that the patient produces on the personnel to its around. With this, the nuclear medicus, the medical physicist or the one responsible of the radiological safety in the hospital can give more precise indications on the behavior of people around the patient. (Author)
Possibility of applying the gamma-gamma method to the in situ determination of uranium-ore densities
International Nuclear Information System (INIS)
Czubek, J.; Guitton, J.
1965-01-01
The principles of the gamma-gamma method are reviewed. It is shown in particular that, under certain conditions, the method makes it possible to obtain a representative measurement of the electronic density. Chemical analyses have been carried out on samples obtained from uranium deposits. The results show that an exact correlation exists between the massive and electronic densities. It is possible to consider the possibility of measuring the density of uranium-containing rocks by the gamma-gamma method. (authors) [fr
Search for neutrinoless {tau} decays: {tau}{r_arrow}e{gamma} and {tau}{r_arrow}{mu}{gamma}
Energy Technology Data Exchange (ETDEWEB)
Edwards, K.W. [Carleton University, Ottawa, Ontario, K1S 5B6 (CANADA); Bellerive, A.; Janicek, R.; MacFarlane, D.B.; McLean, K.W.; Patel, P.M. [McGill University, Montreal, Quebec, H3A 2T8 (CANADA); Sadoff, A.J. [Ithaca College, Ithaca, New York 14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Hancock, N.; Kotov, S.; Kravchenko, I.; Kwak, N. [University of Kansas, Lawrence, Kansas 66045 (United States); Anderson, S.; Kubota, Y.; Lattery, M.; ONeill, J.J.; Patton, S.; Poling, R.; Riehle, T.; Savinov, V.; Smith, A. [University of Minnesota, Minneapolis, Minnesota 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Severini, H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York 12222 (United States); Anastassov, A.; Blinov, S.; Duboscq, J.E.; Fujino, D.; Fulton, R.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Spencer, M.B.; Sung, M.; Undrus, A.; Wanke, R.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio 43210 (United States); Nemati, B.; Richichi, S.J.; Ross, W.R.; Skubic, P.; Wood, M. [University of Oklahoma, Norman, Oklahoma 73019 (United States); Bishai, M.; Fast, J.; Gerndt, E.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana 47907 (United States); Gibbons, L.; Johnson, S.D.; Kwon, Y.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Schaffner, S.F.; Ugolini, D.; Wang, R.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas 75275 (United States); Artuso, M.; Efimov, A.; Frasconi, F.; Gao, M.
1997-04-01
A search for the lepton-family-number-violating decays {tau}{r_arrow}e{gamma} and {tau}{r_arrow}{mu}{gamma} has been performed using CLEO II data. No evidence of a signal has been found and the corresponding upper limits are B({tau}{r_arrow}e{gamma}){lt}2.7{times}10{sup {minus}6} and B({tau}{r_arrow}{mu}{gamma}){lt}3.0{times}10{sup {minus}6} at 90{percent} C.L. {copyright} {ital 1997} {ital The American Physical Society}
Arkhangelskaja, Irene
2016-07-01
GAMMA-400 (Gamma Astronomical Multifunctional Modular Apparatus) will be the gamma-telescope onboard international satellite gamma-observatory designed for particle registration in the wide energy band. Its parameters are optimized for detection of gamma-quanta with the energy ˜ 100 GeV in the main aperture. The main scientific goals of GAMMA-400 are to investigate fluxes of γ-rays and the electron-positron cosmic ray component possibly generated by dark matter particles decay or annihilation and to search for and study in detail discrete γ-ray sources, to investigate the energy spectra of Galactic and extragalactic diffuse γ-rays, and to study γ-ray bursts and γ-emission from the active Sun. This article presents analysis of detected events identification procedures and energy resolution in three apertures provide particles registration both from upper and lateral directions based on GAMMA-400 modeling due special designed software. Time and segmentation methods are used to reject backsplash (backscattering particles created when high energy γ-rays interact with the calorimeter's matter and move in the opposite direction) in the main aperture while only energy deposition analysis allows to reject this effect in the additional and lateral ones. The main aperture provides the best angular (all strip layers information analysis) and energy (energy deposition in the all detectors studying) resolution in the energy range 0.1 - 3 × 10^{3} GeV. The energy resolution in this band is 1%. Triggers in the main aperture will be formed using information about particle direction provided by time of flight system and presence of charged particle or backsplash signal formed according to analysis of energy deposition in combination of all two-layers anticoincidence systems individual detectors. In the additional aperture gamma-telescope allows to register events in the energy band 10 × 10^{-3} - 3 × 10^{3} GeV. The additional aperture energy resolution provides due to
Energy Technology Data Exchange (ETDEWEB)
Leveque, [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1959-07-01
Brief review of the principles of activation analysis: calculation of activities, decay curves, {beta} absorption curves, examples of application. - Principle and description of the {gamma} spectrograph. - Practical utilisation of the {gamma} spectrograph: analysis by activation, analysis by {beta} - x fluorescence. - Sensitivity limit of the method and precision of the measurements. - Possible improvements to the method: {gamma} spectroscopy with elimination of the Compton effect. (author) [French] Bref rappel des principes de l'analyse par activation: calcul des activites, courbes de decroissance, courbes d'absorption {beta}, exemples d'utilisation. - Principe et description du spectrographe {gamma}. - Utilisation pratique de la spectrographie {gamma}: analyse par activation, analyse par fluorescence {beta} - x. - Limite de sensibilite de la methode et precision des mesures. - Ameliorations possibles de la methode: spectrographe {gamma} avec elimination de l'effet Compton. (auteur)
International Nuclear Information System (INIS)
Kobayashi, Tatsuya; Mori, Yohsimasa; Kida, Yoshihisa
2003-01-01
Gamma knife radiosurgery has become a new treatment modality in the field of neurosurgery since the first gamma knife was brought into Japan in 1990. Advances in applications of new indications and long-term results have been continued to evolve during the past 12 years. Based on the experience of more than 4,500 cases treated by gamma knife at Komaki City Hospital, long-term results of arteriovenous malformations (AVMs), metastatic brain tumors, acoustic neurinomas, meningiomas and trigeminal neuralgias are presented. Radiosurgery has become a novel treatment modality, especially for AVM, acoustic neurinoma and meningioma, which were once only treatable by conventional surgery, and shows a high cure rate in AVM cases and high control rate in benign tumors without major complications. The effects of radiosurgery for metastatic brain tumors have been thought to be superior to fractionated radiotherapy due to high response and control rates, and patients showed improved quality of life although no prolongation of the life span was obtained. Gamma knife treatment for trigeminal neuralgia has been shown to be effective and less invasive than microvascular decompression, and is useful for cases resistant to conventional therapies and as an initial treatment as well. (author)
The topological filtration of gamma-structures
DEFF Research Database (Denmark)
Li, Thomas; Reidys, Christian
2013-01-01
In this paper we study gamma-structures filtered by topological genus. gamma-structures are a class of RNA pseudoknot structures that plays a key role in the context of polynomial time folding of RNA pseudoknot structures. A gamma-structure is composed by specific building blocks, that have...... topological genus less than or equal to gamma, where composition means concatenation and nesting of such blocks. Our main results are the derivation of a new bivariate generating function for gamma-structures via symbolic methods, the singularity analysis of the solutions and a central limit theorem...... for the distribution of topological genus in gamma-structures of given length. In our derivation specific bivariate polynomials play a central role. Their coefficients count particular motifs of fixed topological genus and they are of relevance in the context of genus recursion and novel folding algorithms....
Gamma ray astronomy with COS-B
International Nuclear Information System (INIS)
Swanenburg, B.N.
1981-01-01
Observational results in the field of gamma-ray astronomy that have been obtained to date with the COS-B satellite are discussed and questions raised by these observations are summarized. Following a brief review of the instrumental characteristics of COS-B and the extent of COS-B gamma-ray coverage of the sky, particular attention is given to the questions raised by the discovery of many unidentified gamma-ray sources with no apparent optical, X-ray or radio counterparts and the detection of high-energy gamma radiation from the quasar 3C 273, which suggests the role of gamma-ray emission in the creation of other radiation
Inverse Compton gamma-rays from pulsars
International Nuclear Information System (INIS)
Morini, M.
1983-01-01
A model is proposed for pulsar optical and gamma-ray emission where relativistic electrons beams: (i) scatter the blackbody photons from the polar cap surface giving inverse Compton gamma-rays and (ii) produce synchrotron optical photons in the light cylinder region which are then inverse Compton scattered giving other gamma-rays. The model is applied to the Vela pulsar, explaining the first gamma-ray pulse by inverse Compton scattering of synchrotron photons near the light cylinder and the second gamma-ray pulse partly by inverse Compton scattering of synchrotron photons and partly by inverse Compton scattering of the thermal blackbody photons near the star surface. (author)
DEFF Research Database (Denmark)
Kaupmann, Klemens; Cryan, John F; Wellendorph, Petrine
2003-01-01
gamma-Hydroxybutyrate (GHB), a metabolite of gamma-aminobutyric acid (GABA), is proposed to function as a neurotransmitter or neuromodulator. gamma-Hydroxybutyrate and its prodrug, gamma-butyrolactone (GBL), recently received increased public attention as they emerged as popular drugs of abuse. T...
Simultaneous beta and gamma spectroscopy
Farsoni, Abdollah T.; Hamby, David M.
2010-03-23
A phoswich radiation detector for simultaneous spectroscopy of beta rays and gamma rays includes three scintillators with different decay time characteristics. Two of the three scintillators are used for beta detection and the third scintillator is used for gamma detection. A pulse induced by an interaction of radiation with the detector is digitally analyzed to classify the type of event as beta, gamma, or unknown. A pulse is classified as a beta event if the pulse originated from just the first scintillator alone or from just the first and the second scintillator. A pulse from just the third scintillator is recorded as gamma event. Other pulses are rejected as unknown events.
On the maximum and minimum of two modified Gamma-Gamma variates with applications
Al-Quwaiee, Hessa; Ansari, Imran Shafique; Alouini, Mohamed-Slim
2014-01-01
on these new results to present the performance analysis of (i) a dual-branch free-space optical selection combining diversity undergoing independent but not necessarily identically distributed Gamma-Gamma fading under the impact of pointing errors and of (ii
浅川, 正純; 安本, 亮二; 上水流, 雅人; 前川, 正信
1988-01-01
gamma-Seminoprotein (gamma-Sm) is recently being noted as a tumor marker of prostatic cancer. However, since gamma-Sm is a specific antigen against the prostatic tissue, high levels are also observed in patients with benign prostatic hypertrophy (BPH). In this report, two patients with BPH who had high levels of gamma-Sm were studied.
Localization of Gamma-Ray Bursts Using the Fermi Gamma-Ray Burst Monitor
Connaughton, V.; Briggs, M.S.; Goldstein, A.; Meegan, C.A.; Paciesas, W.S.; Preece, R.D.; Wilson-Hodge, C.A.; Gibby, M.H.; Greiner, J.; Gruber, D.; Jenke, P.; Kippen, R.M.; Pelassa, V.; Xiong, S.; Yu, H-F.; Bhat, P.N.; Burgess, J.M.; Byrne, D.; Fitzpatrick, G.; Foley, S.; Giles, M.M.; Guiriec, S.; van der Horst, A.J.; von Kienlin, A.; McBreen, S.; McGlynn, S.; Tierney, D.; Zhang, B..B.
2015-01-01
The Fermi Gamma-ray Burst Monitor (GBM) has detected over 1400 gamma-ray bursts (GRBs) since it began science operations in 2008 July. We use a subset of over 300 GRBs localized by instruments such as Swift, the Fermi Large Area Telescope, INTEGRAL, and MAXI, or through triangulations from the
Gamma-Ray Lenses for Astrophysics-and the Gamma-Ray Imager Mission GRI
DEFF Research Database (Denmark)
Wunderer, C. B.; Ballmoos, P. V.; Barriere, N.
2009-01-01
Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are acc...
Backup control airstart performance on a digital electronic engine control-equipped F100-engine
Johnson, J. B.
1984-01-01
The air start capability of a backup control (BUC) was tested for a digital electronic engine control (DEEC) equipped F100 engine, which was installed in an F-15 aircraft. Two air start schedules were tested. Using the group 1 start schedule, based on a 40 sec timer, an air speed of 300 knots was required to ensure successful 40 and 25% BUC mode spooldown airstarts. If core rotor speed (N2) was less than 40% a stall would occur when the start bleed closed, 40 sec after initiation of the air start. All jet fuel starter (JFS) assisted air starts were successful with the group 1 start schedule. For the group 2 schedule, the time between pressurization and start bleed closure ranged between 50 sec and 72 sec. Idle rps was lower than the desired 65% for air starts at higher altitudes and lower air speeds.
International Nuclear Information System (INIS)
Ward, J.T. Jr.
1975-01-01
Calculated and experimental gamma heating rates of europia in the Engineering Mockup Critical Assembly (EMC) were correlated. A calculated to experimental (C/E) ratio of 1.086 was established in validating the theoretical approach and computational technique applied in the calculations. Gamma heat deposition rates in the FTR with Eu 2 O 3 control absorbers were determined from three-dimensional calculations. Maximum gamma heating was found to occur near the tip of a half-inserted row 5 control rod assembly--12.8 watts/gm of europia. Gamma heating profiles were established for a single half-inserted europia absorber assembly. Local heat peaking was found not to alter significantly heating rates computed in the FTR core model, where larger mesh interval sizes precluded examination of spatially-limited heating gradients. These computations provide the basis for thermal-hydraulic analyses to ascertain temperature profiles in the FTR under europia control
Determination of gamma production from (n, gamma) reactions
International Nuclear Information System (INIS)
Kostal, M.
2007-06-01
Calculation of gamma production by interaction of neutrons with materials requires a reasonable accuracy of the nuclear libraries, i. e. effective cross sections, nuclear levels and probabilities of transitions between them. Accurate data enable accurate calculations to be performed, e.g. for PGNAA. First, gamma production in a thick 56 Fe target was examined. Appreciable discrepancies were found among the nuclear libraries available. Additional calculations were performed and compared with the observed data. The fluence of photons observed behind a thick iron target was investigated, the target being irradiated with neutrons from the front side. The results were evaluated for the various nuclear libraries. It is concluded that the libraries ENDF/B VI.2., i.e. data embedded in the MCNPX code, are sufficient for a number of applications. However, their accuracy is insufficient for prompt gamma neutron activation analysis. This is also true of data from the libraries JEFF 3.1. a JENDL 3.3, so that other libraries will have to be used for PGNAA. Specifically for 56 Fe, the data from the libraries ENDF/B VII.0 seem to be usable. (P.A.)
International Nuclear Information System (INIS)
Lapides, J.R.
1981-01-01
The gamma-ray spectroscopy of planet surfaces is one of several possible methods that are useful in determining the elemental composition of planet surfaces from orbiting spacecraft. This has been demonstrated on the Apollos 15 and 16 missions as well as the Soviet Mars-5 mission. Planetary gamma-ray emission is primarily the result of natural radioactive decay and cosmic-ray and solar-flare-induced nuclear reactions. Secondary neutron reactions play a large role in the more intense gamma-ray emission. The technique provides information on the elemental composition of the top few tens of centimeters of the planet surface. Varying concentrations of hydrogen and compositional variations that alter the macroscopic thermal-neutron absorption cross section have a significant effect on the neutron flux in the planet surface and therefore also on the gamma-ray emission from the surface. These effects have been systematically studied for a wide range of possible planetary compositions that include Mercury, the moon, Mars, the comets, and the asteroids. The problem of the Martian atmosphere was also investigated. The results of these calculations, in which both surface neutron fluxes and gamma-ray emission fluxes were determined, were used to develop general procedures for obtaining planet compositions from the gamma-ray spectrum. Several changes have been suggested for reanalyzing the Apollos 15 and 16 gamma-ray results. In addition, procedures have been suggested that can be applied to neutron-gamma techniques in mineral and oil exploration
Batley, J R; Lazzeroni, C; Munday, D J; Patel, M; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Ceccucci, A; Cundy, D; Doble, N; Falaleev, V; Gatignon, L; Gonidec, A; Grafstrom, P; Kubischta, W; Mikulec, I; Norton, A; Panzer-Steindel, B; Rubin, P; Wahl, H; Goudzovski, E; Hristov, P; Kekelidze, V; Litov, L; Madigozhin, D; Molokanova, N; Potrebenikov, Yu; Stoynev, S; Zinchenko, A; Monnier, E; Swallow, E; Winston, R; Sacco, R; Walker, A; Baldini, W; Gianoli, A; Dalpiaz, P; Frabetti, P L; Martini, M; Petrucci, F; Savrie, M; Scarpa, M; Calvetti, M; Collazuol, G; Iacopini, E; Ruggiero, G; Bizzeti, A; Lenti, M; Veltri, M; Behler, M; Eppard, K; Eppard, M; Hirstius, A; Kleinknecht, K; Koch, U; Marouelli, P; Masetti, L; Moosbrugger, U; Morales-Morales, C; Peters, A; Wanke, R; Winhart, A; Dabrowski, A; Fonseca Martin, T; Velasco, M; Cenci, P; Lubrano, P; Pepe, M; Anzivino, G; Imbergamo, E; Lamanna, G; Michetti, A; Nappi, A; Petrucci, M C; Piccini, M; Valdata, M; Cerri, C; Fantechi, R; Costantini, F; Fiorini, L; Giudici, S; Pierazzini, G; Sozzi, M; Mannelli, I; Cheshkov, C; Cheze, J B; De Beer, M; Debu, P; Gouge, G; Marel, G; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Marchetto, F; Pastrone, N; Clemencic, M; Goy Lopez, S; Menichetti, E; Wislicki, W; Dibon, H; Jeitler, M; Markytan, M; Neuhofer, G; Widhalm, L
2010-01-01
The decay asymmetries of the weak radiative Hyperon decays $\\Xi^{0}\\to \\Lambda \\gamma$ and $\\Xi^{0} \\to \\Sigma^{0}\\gamma$ have been measured with high precision using data of the NA48/1 experiment at CERN. From about 52000 $\\Xi^{0}\\to \\Lambda \\gamma$ and 15000 $\\Xi^{0} \\to \\Sigma^{0}\\gamma$ decays, we obtain for the decay asymmetries $\\alpha_{\\Xi^{0}\\to \\Lambda\\gamma}$ = -0.704 +- 0.019$_{stat}$ +- 0.064$_{syst}$ and $\\alpha_{\\Xi^{0}\\to \\Sigma^{0}\\gamma}$ = -0.729 +- 0.030$_{stat}$ +- 0.076$_{syst}$, respectively. These results are in good agreement with previous experiments, but more precise.
Lunar occultations for gamma-ray source measurements
Koch, David G.; Hughes, E. B.; Nolan, Patrick L.
1990-01-01
The unambiguous association of discrete gamma-ray sources with objects radiating at other wavelengths, the separation of discrete sources from the extended emission within the Galaxy, the mapping of gamma-ray emission from nearby galaxies and the measurement of structure within a discrete source cannot presently be accomplished at gamma-ray energies. In the past, the detection processes used in high-energy gamma-ray astronomy have not allowed for good angular resolution. This problem can be overcome by placing gamma-ray detectors on the moon and using the horizon as an occulting edge to achieve arcsec resolution. For purposes of discussion, this concept is examined for gamma rays above 100 MeV for which pair production dominates the detection process and locally-generated nuclear gamma rays do not contribute to the background.
gamma. -relaxation process in crystallizable polymers
Energy Technology Data Exchange (ETDEWEB)
Mindiyarov, Kh G; Zelenev, Yu V; Bartenev, G M [Birskij Gosudarstvennyj Pedagogicheskij Inst. (USSR)
1975-07-01
In the present paper, with the aid of radiothermoluminescence technique ..gamma..-relaxation processes are investigated, which are conditioned by molecular mobility and are associated with defects in the crystalline structure of polymers PEh, PP, and elastomers PIB, NK, SKD, SKI exposed to ..gamma..-rays of Co/sup 60/ at a dose rate of 1 Mrad. The shape of the thermoluminescence curve, i.e. the luminescence intensity in the ..cap alpha.. - ..gamma..-maxima, their relationship, position with respect to temperature are strongly dependent on the degree of crystallinity, on the thermal and mechanical prehistory. In highly crystalline samples of PEh and PP ..cap alpha..-maximum may be absent. Dependence has been studied of the luminescence intensity in the ..cap alpha..- and ..gamma..-maxima (Isub(..cap alpha..)/Isub(..gamma..)) on the crystallization temperature; the curve passes through the minimum when the crystallization rate is maximum. The relationship Isub(..gamma..)re of crystallinity degree.
Influence of the temperature in the measurement of the gamma automatic probe Gamma Tracer
International Nuclear Information System (INIS)
Caveda R, C.A.; Dominguez L, O.; Alonso A, D.; Montalvan E, A.; Fabelo B, O.
2006-01-01
In the following work an analysis of the existent relationship among the measurement of the absorbed dose rate in air due to the environmental gamma radiation and the temperature, magnitudes measured to intervals of 10 minutes by the gamma probe Gamma Tracer located in the post of occident of the National Net of Environmental Radiological Surveillance (RNVRA), in the Center of Protection and Hygiene of the Radiations (CPHR) is made. For it its were analyzed near 100,000 measurements corresponding to the period 2004-2005. For a better processing and interpretation of the data, these were analyzed with one frequency time zone and monthly using the Gamma Red software to which was necessary to add it some options. Finally it was submitted the probe to a heating process inside a stove. The results of the carried out experiments confirmed that the absorbed dose rate in air due to the environmental gamma radiation depends potentially of the probe temperature in the range of environmental temperature to which is subjected daily the same one. (Author)
Realization of a gamma multiplicity filter and gamma multiplicity measurements
International Nuclear Information System (INIS)
Azgui, F.
1981-12-01
A gamma multiplicity filter for the study of reaction mechanism has been realised. It's composed of six NaI(Tl) counters. The flexibility of the geometry allows many configurations. This set up has been tested with gamma radioactive sources and with the 252 Cf source to resolve problems of gamma-efficiency of the NaI(Tl) counters and the contamination of neutrons in these detectors. A logical electronic unit (Encodeur) has been constructed and the around electronic has been developped. This gamma multiplicity filter has been coupled with a detector of high resolution Ge(Li), and used in two reactions: 12 C + 55 Mn at E( 12 C) = 54 MeV; α + 63 Cu at E(α) = 52 MeV. The dominant process is the fusion-evaporation. The compound nucleus 67 Ga, is formed at the same excitation energy. The values of multiplicities Msub(γ) have been extracted using a program based on the formalism of W.J. Ockels. The fractionalization of the angular momentum is well observed for some residual nuclei ( 63 Zn, 64 Zn, 65 Zn), and for each residual nucleus, the average gamma multiplicity is lower with projectile α than that with projectile 12 C. For the most strongly output channel p2n, an entry point for the 64 Zn has been determined in the reactions. All these observations are in good agreement with those published, in the same region (f-p shell) of nuclei. This set up can be coupled with different central detector as, ''X'', neutrons charged particles detectors, and will be used with the new machine SARA to make a systematic study of transfer of angular momentum to the fragments at 30 MeV/A [fr
Diehl, Roland
2017-06-01
Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.
Future prospects for. gamma. -ray astronomy
Energy Technology Data Exchange (ETDEWEB)
Fichtel, C [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center
1981-06-30
As ..gamma..-ray astronomy moves from the discovery to the exploratory phase, the promise of ..gamma..-ray astrophysics noted by theorists in the late 1940s and 1950s is beginning to be realized. In the future, satellites should carry instruments that will have over an order of magnitude greater sensitivity than those flown thus far, and, for at least some portions of the ..gamma..-ray energy range, these detectors will also have substantially improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance our knowledge of several astrophysical phenomena including the very energetic and nuclear processes associated with compact objects, astrophysical nucleosynthesis, solar particle acceleration, the chemical composition of the planets and other bodies of the Solar System, the structure of our Galaxy, the origin and dynamic pressure effects of the cosmic rays, high energy particles and energetic processes in other galaxies especially active ones, and the degree of matter-antimatter symmetry of the Universe. The ..gamma..-ray results of the forthcoming programs such as Gamma-I, the Gamma Ray Observatory, the ..gamma..-ray burst network, Solar Polar, and very high energy ..gamma..-ray telescopes on the ground will almost certainly provide justification for more sophisticated telescopes. These advanced instruments might be placed on the Space Platform currently under study by N.A.S.A.
Zheng, Chenguang; Bieri, Kevin Wood; Trettel, Sean Gregory; Colgin, Laura Lee
2015-01-01
In hippocampal area CA1 of rats, the frequency of gamma activity has been shown to increase with running speed (Ahmed and Mehta, 2012). This finding suggests that different gamma frequencies simply allow for different timings of transitions across cell assemblies at varying running speeds, rather than serving unique functions. However, accumulating evidence supports the conclusion that slow (~25–55 Hz) and fast (~60–100 Hz) gamma are distinct network states with different functions. If slow and fast gamma constitute distinct network states, then it is possible that slow and fast gamma frequencies are differentially affected by running speed. In this study, we tested this hypothesis and found that slow and fast gamma frequencies change differently as a function of running speed in hippocampal areas CA1 and CA3, and in the superficial layers of the medial entorhinal cortex (MEC). Fast gamma frequencies increased with increasing running speed in all three areas. Slow gamma frequencies changed significantly less across different speeds. Furthermore, at high running speeds, CA3 firing rates were low, and MEC firing rates were high, suggesting that CA1 transitions from CA3 inputs to MEC inputs as running speed increases. These results support the hypothesis that slow and fast gamma reflect functionally distinct states in the hippocampal network, with fast gamma driven by MEC at high running speeds and slow gamma driven by CA3 at low running speeds. PMID:25601003
International Nuclear Information System (INIS)
Kunwar, B.; Bhadra, A.; Gupta, S.K. Sen
2014-01-01
A preliminary, and perhaps the first, study of astrophysical applications of Delbrück scattering in a gamma-ray emitting celestial object like a gamma-ray burst (GRB) has been made. At energies≥100 MeV the elastic scattering of gamma-ray photons off the molecular dust surrounding the GRB site is dominated by Delbrück scattering. Expressions for Delbrück-scattered gamma-ray flux as a function of time has been obtained for a few selected energies by assuming a simple model of GRB. These are compared with Compton-scattered flux. At certain situations, interestingly, the former is found to exceed the latter for the first few milliseconds of the burst. The issue of detectability of Delbrück-scattered gamma-ray echo from the cloud of a GRB is discussed. Although it is observed that the detection of such an echo is not within the capability of the presently operating gamma-ray missions such as Fermi LAT, a rough estimate shows that one can be optimistic that future generation gamma-ray telescopes might be able to see such photons' contribution to the total flux. - Highlights: ► Astrophysical application of Delbrück scattering in a GRB has been made. ► Initially, the Delbrück scattering may dominate the scattering of GeV γ-rays. ► The issue of detectability of such radiations is discussed
LENUS (Irish Health Repository)
Gleeson, Eimear M
2013-07-19
Vitamin K-dependent proteases generated in response to vascular injury and infection enable fibrin clot formation, but also trigger distinct immuno-regulatory signaling pathways on myeloid cells. Factor Xa, a protease crucial for blood coagulation, also induces protease-activated receptor-dependent cell signaling. Factor Xa can bind both monocytes and macrophages, but whether factor Xa-dependent signaling stimulates or suppresses myeloid cell cytokine production in response to Toll-like receptor activation is not known. In this study, exposure to factor Xa significantly impaired pro-inflammatory cytokine production from lipopolysaccharide-treated peripheral blood mononuclear cells, THP-1 monocytic cells and murine macrophages. Furthermore, factor Xa inhibited nuclear factor-kappa B activation in THP-1 reporter cells, requiring phosphatidylinositide 3-kinase activity for its anti-inflammatory effect. Active-site blockade, γ-carboxyglutamic acid domain truncation and a peptide mimic of the factor Xa inter-epidermal growth factor-like region prevented factor Xa inhibition of lipopolysaccharide-induced tumour necrosis factor-α release. In addition, factor Xa anti-inflammatory activity was markedly attenuated by the presence of an antagonist of protease-activated receptor 2, but not protease-activated receptor 1. The key role of protease-activated receptor 2 in eliciting factor Xa-dependent anti-inflammatory signaling on macrophages was further underscored by the inability of factor Xa to mediate inhibition of tumour necrosis factor-α and interleukin-6 release from murine bone marrow-derived protease-activated receptor 2-deficient macrophages. We also show for the first time that, in addition to protease-activated receptor 2, factor Xa requires a receptor-associated protein-sensitive low-density lipoprotein receptor to inhibit lipopolysaccharide-induced cytokine production. Collectively, this study supports a novel function for factor Xa as an endogenous, receptor
Kontny, U; Kurane, I; Ennis, F A
1988-01-01
It has been reported that anti-dengue antibodies at subneutralizing concentrations augment dengue virus infection of monocytic cells. This is due to the increased uptake of dengue virus in the form of virus-antibody complexes by cells via Fc gamma receptors. We analyzed the effects of recombinant human gamma interferon (rIFN-gamma) on dengue virus infection of human monocytic cells. U937 cells, a human monocytic cell line, were infected with dengue virus in the form of virus-antibody complexe...
International Nuclear Information System (INIS)
Berninger, W.H.
1975-01-01
The light pulse output of a scintillator, on which incident collimated gamma rays impinge, is detected by an array of photoelectric tubes each having a convexly curved photocathode disposed in close proximity to the scintillator. Electronic circuitry connected to outputs of the phototubes develops the scintillation event position coordinate electrical signals with good linearity and with substantial independence of the spacing between the scintillator and photocathodes so that the phototubes can be positioned as close to the scintillator as is possible to obtain less distortion in the field of view and improved spatial resolution as compared to conventional planar photocathode gamma cameras
Radio Observations of Gamma-ray Novae
Linford, Justin D.; Chomiuk, L.; Ribeiro, V.; project, E.-Nova
2014-01-01
Recent detection of gamma-ray emission from classical novae by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope surprised many in the astronomical community. We present results from radio observations, obtained using the Karl G. Jansky Very Large Array (VLA), of three gamma-ray novae: Mon2012, Sco2012, and Del2013. Radio observations allow for the calculation of ejecta masses, place limits on the distances, and provide information about the gamma-ray emission mechanism for these sources.
Gamma Spectroscopy with Pixellated CdZnTe Gamma Detectors
International Nuclear Information System (INIS)
Shor, A.; Mardor, I.; Eisen, Y.
2002-01-01
Pixellated CdZnTe detectors are good candidates for room temperature gamma detection requiring spectroscopic performance with imaging capabilities. The CdZnTe materials possess high resistivity and good electron charge transport properties. The poor charge transport for the holes inherent in the CdZnTe material can be circumvented by fabricating the electrodes in any one of a number of structures designed for unipolar charge detection[1]. Recent interest in efficient gamma detection at relatively higher gamma energies has imposed more stringent demands on the CdZnTe material and on detector design and optimization. We developed at Soreq a technique where signals from all pixels and from the common electrode are processed, and then a correction is applied for improving the energy resolution and the photopeak efficiency. For illumination with an un-collimated 133 Ba source , we obtain a combined detector energy resolution of 5.0 % FWHM for the 81 keV peak, and 1.5 % FWHM for the 356 keV peak. We discuss the importance of detector material with high electron (μτ) e for thick Pixellated detectors
Zhang, Weihua; Ungar, Kurt; Stukel, Matthew; Mekarski, Pawel
2014-04-01
In this study, a digital gamma-gamma coincidence/anticoincidence spectrometer was developed and examined for low-level cosmogenic (22)Na and (7)Be in air-filter sample monitoring. The spectrometer consists of two bismuth germanate scintillators (BGO) and an XIA LLC Digital Gamma Finder (DGF)/Pixie-4 software and card package. The spectrometer design allows a more selective measurement of (22)Na with a significant background reduction by gamma-gamma coincidence events processing. Hence, the system provides a more sensitive way to quantify trace amounts of (22)Na than normal high resolution gamma spectrometry providing a critical limit of 3 mBq within a 20 h count. The use of a list-mode data acquisition technique enabled simultaneous determination of (22)Na and (7)Be activity concentrations using a single measurement by coincidence and anticoincidence mode respectively. Copyright © 2014 Elsevier Ltd. All rights reserved.
Xanthium italicum, Xanthium strumarium and Arctium lappa as new hosts for Diaporthe helianthi.
Vrandecic, Karolina; Jurkovic, Drazenka; Riccioni, Luca; Cosic, Jasenka; Duvnjak, Tomislav
2010-07-01
Sunflower (Helianthus annuus) stem canker caused by Diaporthe helianthi is one of the most important sunflower diseases in Croatia. Until recently, sunflower was the only known host for D. helianthi. In our research carried out in the area of Eastern Croatia, isolates of Diaporthe/Phomospis were collected from Xanthium italicum, X. strumarium and Arctium lappa. Using morphological, cultural and molecular ITS rDNA data, isolates from these weeds were identified as D. helianthi. The following isolates were used in the pathogenicity test: one isolate originated from sunflower (Su5/04), three from X. italicum (Xa2, Xa3 and Xa5), two from X. strumarium (Xa9 and Xa12), one from Xanthium sp. (Xa13) and one from A. lappa (Ar3). According to the results, it was determined that isolate Xa5 (originated from X. italicum) was the most pathogenic to sunflower stems. The average length of the lesion was 11.3 cm. The lowest level of pathogenicity was found in Xa9 (isolated from X. strumarium). The length of the lesion was 0.1 cm.
Attrition resistant gamma-alumina catalyst support
Singleton, Alan H.; Oukaci, Rachid; Goodwin, James G.
2006-03-14
A .gamma.-alumina catalyst support having improved attrition resistance produced by a method comprising the steps of treating a particulate .gamma.-alumina material with an acidic aqueous solution comprising water and nitric acid and then, prior to adding any catalytic material thereto, calcining the treated .gamma.-alumina.
Gamma-ray Output Spectra from 239 Pu Fission
International Nuclear Information System (INIS)
Ullmann, John
2015-01-01
Gamma-ray multiplicities, individual gamma-ray energy spectra, and total gamma energy spectra following neutron-induced fission of 239 Pu were measured using the DANCE detector at Los Alamos. Corrections for detector response were made using a forward-modeling technique based on propagating sets of gamma rays generated from a paramaterized model through a GEANT model of the DANCE array and adjusting the parameters for best fit to the measured spectra. The results for the gamma-ray spectrum and multiplicity are in general agreement with previous results, but the measured total gamma-ray energy is about 10% higher. A dependence of the gamma-ray spectrum on the gamma-ray multplicity was also observed. Global model calculations of the multiplicity and gamma energy distributions are in good agreement with the data, but predict a slightly softer total-energy distribution
Gamma-Ray Astronomy Technology Needs
Gehrels, N.; Cannizzo, J. K.
2012-01-01
In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.
AUTHOR|(INSPIRE)INSPIRE-00349845; The ATLAS collaboration
2016-01-01
The production of Z bosons with one or two isolated high-energy photons is studied using $pp$ collisions at $\\sqrt{s}$ = 8 TeV. The analyses use a data sample with an integrated luminosity of 20.3 $fb^{-1}$ collected by the ATLAS detector during the 2012 LHC data taking. The data are used to make tests of the electroweak sector of the Standard Model (SM) and search for deviations that could provide evidence for new physics beyond SM. The $Z\\gamma$ and $Z\\gamma\\gamma$ production cross sections are measured with leptonic ($e^{+}e^{-}$, $\\mu^{+}\\mu^{-}$, $\
Gamma ray lines from a universal extra dimension
Energy Technology Data Exchange (ETDEWEB)
Bertone, Gianfranco; Jackson, C. B.; Shaughnessy, Gabe; Tait, Tim M.P.; Vallinotto, Alberto
2012-03-01
Indirect Dark Matter searches are based on the observation of secondary particles produced by the annihilation or decay of Dark Matter. Among them, gamma-rays are perhaps the most promising messengers, as they do not suffer deflection or absorption on Galactic scales, so their observation would directly reveal the position and the energy spectrum of the emitting source. Here, we study the detailed gamma-ray energy spectrum of Kaluza--Klein Dark Matter in a theory with 5 Universal Extra Dimensions. We focus in particular on the two body annihilation of Dark Matter particles into a photon and another particle, which produces monochromatic photons, resulting in a line in the energy spectrum of gamma rays. Previous calculations in the context of the five dimensional UED model have computed the line signal from annihilations into \\gamma \\gamma, but we extend these results to include \\gamma Z and \\gamma H final states. We find that these spectral lines are subdominant compared to the predicted \\gamma \\gamma signal, but they would be important as follow-up signals in the event of the observation of the \\gamma \\gamma line, in order to distinguish the 5d UED model from other theoretical scenarios.
gamma-Glutamyl dipeptides in Petiveria alliacea.
Kubec, Roman; Musah, Rabi A
2005-10-01
Three gamma-glutamyl dipeptides have been isolated from Petiveria alliacea L. roots. These dipeptides include (S(C2)R(C7))-gamma-glutamyl-S-benzylcysteine together with two diastereomeric sulfoxides, namely (S(C2)R(C7)R(S))- and (S(C2)R(C7)R(S))-gamma-glutamyl-S-benzylcysteine S-oxides (gamma-glutamyl-petiveriins A and B, respectively). Their structures and absolute configurations have been determined by NMR, MALDI-HRMS, IR and CD spectroscopy, and confirmed by comparison with authentic compounds obtained by synthesis.
Regulation of PPAR{gamma} function by TNF-{alpha}
Energy Technology Data Exchange (ETDEWEB)
Ye Jianping [Pennington Biomedical Research Center, Louisiana State University System, 6400 Perkins Road, Baton Rouge, LA 70808 (United States)], E-mail: yej@pbrc.edu
2008-09-26
The nuclear receptor PPAR{gamma} is a lipid sensor that regulates lipid metabolism through gene transcription. Inhibition of PPAR{gamma} activity by TNF-{alpha} is involved in pathogenesis of insulin resistance, atherosclerosis, inflammation, and cancer cachexia. PPAR{gamma} activity is regulated by TNF-{alpha} at pre-translational and post-translational levels. Activation of serine kinases including IKK, ERK, JNK, and p38 may be involved in the TNF-regulation of PPAR{gamma}. Of the four kinases, IKK is a dominant signaling molecule in the TNF-regulation of PPAR{gamma}. IKK acts through at least two mechanisms: inhibition of PPAR{gamma} expression and activation of PPAR{gamma} corepressor. In this review article, literature is reviewed with a focus on the mechanisms of PPAR{gamma} inhibition by TNF-{alpha}.
Calibration of nuclides by gamma-gamma sum peak coincidence counting
International Nuclear Information System (INIS)
Guevara, E.A.
1986-01-01
The feasibility of extending sum peak coincidence counting to the direct calibration of gamma-ray emitters having particular decay schemes was investigated, also checkings of the measurement accuracy, by comparing with more precise beta-gamma coincidence counting have been performed. New theoretical studies and experiments were developed, demonstrating the reliability of the procedure. Uncertainties of less than one percent were obtained when certain radioactive sources were measured. The application of the procedure to 60 Co, 22 Na, 47 Ca and 148 Pm was studied. Theoretical bases of sum peak coincidence counting were set in order to extend it as an alternative method for absolute activity determination. In this respect, theoretical studies were performed for positive and negative beta decay, and electron capture, either accompanied or unaccompanied by coincident gamma rays. They include decay schemes containing up to three daughter nuclide excited levels, for different geometrical configurations. Equations are proposed for a possible generalization of the procedure. (M.E.L.) [es
Observation of gamma-ray bursts with GINGA
International Nuclear Information System (INIS)
Murakami, Toshio; Fujii, Masami; Nishimura, Jun
1989-01-01
Gamma-ray Burst Detector System (GBD) on board the scientific satellite 'GINGA' which was launched on Feb. 5, 1987, was realized as an international cooperation between ISAS and LANL. It has recorded more than 40 Gamma-Ray Burst candidates during 20 months observation. Although many observational evidences were accumulated in past 20 years after the discovery of gamma-ray burst by LANL scientists, there are not enough evidence to determine the origin and the production mechanism of the gamma-ray burst. GBD consists of a proportional counter and a NaI scintillation counter so that it became possible to observe energy spectrum of the gamma-ray burst with high energy resolution over wide range of energy (1.5-380 keV) together with high time resolution. As the result of observation, the following facts are obtained: (1) A large fraction of observed gamma-ray bursts has a long X-ray tail after the harder part of gamma-ray emission has terminated. (2) Clear spectral absorption features with harmonic in energy was observed in some of the energy spectrum of gamma-ray bursts. These evidences support the hypothesis that the strongly magnetized neutron star is the origin of gamma-ray burst. (author)
Okech, Bernard; Arai, Meiji; Matsuoka, Hiroyuki
2006-03-24
Xanthurenic acid (XA), produced as a byproduct during the biosynthesis of insect eye pigment (ommochromes), is a strong inducer of Plasmodium gametogenesis at very low concentrations. In previous studies, it was shown that XA is present in Anopheles stephensi (Diptera: Culicidae) mosquito salivary glands and that during blood feeding the mosquitoes ingested their own saliva into the midgut. Considering these two facts together, it is therefore likely that XA is discharged with saliva during blood feeding and is swallowed into the midgut where it exerts its effect on Plasmodium gametocytes. However, the quantities of XA in the salivary glands and midgut are unknown. In this study, we used high performance liquid chromatography with electrochemical detection to detect and quantify XA in the salivary glands and midgut. Based on the results of this study, we found 0.28+/-0.05 ng of XA in the salivary glands of the mosquitoes, accounting for 10% of the total XA content in the mosquito whole body. The amounts of XA in the salivary glands reduced to 0.13+/-0.06 ng after mosquitoes ingested a blood meal. Approximately 0.05+/-0.01 ng of XA was detected in the midgut of nonblood fed An. stephensi mosquitoes. By adding synthetic tryptophan as a source of XA into larval rearing water (2 mM) or in sugar meals (10 mM), we evaluated whether XA levels in the mosquito (salivary glands, midgut, and whole body) were boosted and the subsequent effect on infectivity of Plasmodium berghei in the treated mosquito groups. A female specific increase in XA content was observed in the whole body and in the midgut of mosquito groups where tryptophan was added either in the larval water or sugar meals. However, XA in the salivary glands was not affected by tryptophan addition to larval water, and surprisingly it reduced when tryptophan was added to sugar meals. The P. berghei oocyst loads in the mosquito midguts were lower in mosquitoes fed tryptophan treated sugar meals than in mosquitoes
Directory of Open Access Journals (Sweden)
Jegadeesan Ramalingam
2017-06-01
Full Text Available Bacterial blight (BB, caused by Xanthomonas oryzae pv.oryzae is one among the major diseases in rice, which in severe condition cause losses up to 60% in total yield. Marker assisted pyramiding of three broad spectrum BB resistance genes (xa5, xa13, and Xa21 in prominent rice varieties is the most economical and effective strategy for the management of the BB disease. We report here the pyramiding of three genes (xa5, xa13, and Xa21 in maintainer lines (CO 2B, CO 23B, and CO 24B of three promising wild abortive cytoplasmic male sterile lines (CO 2A, CO 23A, and CO 24A through functional markers assisted back cross breeding. IRBB60 with xa5, xa13, and Xa21 genes is used as a donor parent. BC2F1 and BC2F2 generations from a cross of CO 2B, CO 23B, and CO 24B with IRBB60 were evaluated for bacterial blight and non-fertility restoration. In BC2F1, plants with all three resistance genes (xa5, xa13, and Xa21 and high parent genome recovery was identified. In BC2F2, plants with all resistance genes and without fertility restorer (Rf3 and Rf4 were selected. Based on agronomic traits, BB resistance and maintenance of sterility, two plants each in CO 2B × IRBB60, CO 24B × IRBB60 and one plant in CO 23B × IRBB60 combinations were identified. The identified lines were crossed with respective male sterile lines for conversion of improved B line into CMS line through back-crossing, in addition to selfing. The plants with high recurrent genome and phenotypically similar to parental lines and sterile are being used for the hybrid rice development program. Currently, using these lines (improved CMS line, test crosses were made to develop new rice hybrids. Hybrids combinations viz., CO 23A × AD08009R and CO 24A × IET20898R were found to be stable at different locations with high yield. The R line used in this study has been introgressed with xa5, xa13, and Xa21 genes in a separate breeding program. These new hybrids with resistance against bacterial blight
International Nuclear Information System (INIS)
Al'bitskij, L.L.; Brikker, I.N.; Bychkov, V.N.; Voronin, V.V.; Mirzoyan, A.R.; Rogozhin, A.S.; Sarkisyan, Yu.Kh.
1989-01-01
A system of automated control Aspect-2 was developed for automation of gamma therapy on units of the Rokus series. The system consists of the following hardware and software complexes: a complex of preirradiation preparation Centrator-imitator, a complex Accord for anatomotopographic data coding; a software complex and a gamma-therapeutic complex Rokus-AM. The Centrator-imitator and Rokus-AM complexes are fitted out with built-in microcomputers with specially developed systemic software. The Rokus-AM complex has automatic punch tape programmed control of 9 degrees of freedom of the gamma-unit and treatment table and ensures 5 modes of irradiation: positional, rotating, rotaing-convergent, sectoral rotating-convergent and scanning
Energy Technology Data Exchange (ETDEWEB)
Swain, J
2004-03-16
In May 2003 PEP-II achieved instantaneous luminosities in excess of 6 x 10{sup 33} cm{sup -2}s{sup -1}, twice the design luminosity. To permit BABAR to operate in this challenging environment, development work on the data acquisition system continued after detector commissioning. A vital part of this process is understanding the performance of the data acquisition system. Considerable effort was invested in the design and implementation of an application capable of collecting performance statistics from hundreds of CPUs in the data acquisition system during data collection. The monitoring application and some examples of its operation are presented in this thesis. Also presented here are the searches for the exclusive radiative one-loop decays, B {yields} {omega}{gamma}, B {yields} {phi}{gamma} and B{sup 0} {yields} {phi}K{sub S}{sup 0}{gamma}, using a sample of 89 million B{bar B} events. No significant signal is seen in any of the channels. Upper limits on the branching ratios, {Beta}, were found to be {Beta}(B {yields} {omega}{gamma}) < 3.0 x 10{sup -6}, {Beta}(B {yields} {phi}{gamma}) < 2.9 x 10{sup -6}, and {Beta}(B{sup 0} {yields} {phi}K{sub S}{sup 0}{gamma}) < 3.8 x 10{sup -6}, at the 90% confidence level.
Stellar Sources of Gamma-ray Bursts
Luchkov, B. I.
2011-01-01
Correlation analysis of Swift gamma-ray burst coordinates and nearby star locations (catalog Gliese) reveals 4 coincidences with good angular accuracy. The random probability is 4\\times 10^{-5}, so evidencing that coincident stars are indeed gamma-ray burst sources. Some additional search of stellar gamma-ray bursts is discussed.
Topchiev, N. P.; Galper, A. M.; Arkhangelskiy, A. I.; Arkhangelskaja, I. V.; Kheymits, M. D.; Suchkov, S. I.; Yurkin, Y. T.
2017-01-01
Scientific project GAMMA-400 (Gamma Astronomical Multifunctional Modular Apparatus) relates to the new generation of space observatories intended to perform an indirect search for signatures of dark matter in the cosmic-ray fluxes, measurements of characteristics of diffuse gamma-ray emission and gamma-rays from the Sun during periods of solar activity, gamma-ray bursts, extended and point gamma-ray sources, electron/positron and cosmic-ray nuclei fluxes up to TeV energy region by means of the GAMMA-400 gamma-ray telescope represents the core of the scientific complex. The system of triggers and counting signals formation of the GAMMA-400 gamma-ray telescope constitutes the pipelined processor structure which collects data from the gamma-ray telescope subsystems and produces summary information used in forming the trigger decision for each event. The system design is based on the use of state-of-the-art reconfigurable logic devices and fast data links. The basic structure, logic of operation and distinctive features of the system are presented.
Zhang, Weihua; Yi, Jing; Mekarski, Pawel; Ungar, Kurt; Hauck, Barry; Kramer, Gary H
2011-06-01
The purpose of this study is to investigate the possibility of verifying depleted uranium (DU), natural uranium (NU), low enriched uranium (LEU) and high enriched uranium (HEU) by a developed digital gamma-gamma coincidence spectroscopy. The spectroscopy consists of two NaI(Tl) scintillators and XIA LLC Digital Gamma Finder (DGF)/Pixie-4 software and card package. The results demonstrate that the spectroscopy provides an effective method of (235)U and (238)U quantification based on the count rate of their gamma-gamma coincidence counting signatures. The main advantages of this approach over the conventional gamma spectrometry include the facts of low background continuum near coincident signatures of (235)U and (238)U, less interference from other radionuclides by the gamma-gamma coincidence counting, and region-of-interest (ROI) imagine analysis for uranium enrichment determination. Compared to conventional gamma spectrometry, the method offers additional advantage of requiring minimal calibrations for (235)U and (238)U quantification at different sample geometries. Crown Copyright © 2011. Published by Elsevier Ltd. All rights reserved.
Sequential Analysis of Gamma Spectra
International Nuclear Information System (INIS)
Fayez-Hassan, M.; Hella, Kh.M.
2009-01-01
This work shows how easy one can deal with a huge number of gamma spectra. The method can be used for radiation monitoring. It is based on the macro feature of the windows XP connected to QBASIC software. The routine was used usefully in generating accurate results free from human errors. One hundred measured gamma spectra were fully analyzed in 10 minutes using our fast and automated method controlling the Genie 2000 gamma acquisition analysis software.
Energy Technology Data Exchange (ETDEWEB)
Tomilin, N V; Barenfeld, L S [AN SSSR, Leningrad. Inst. Tsitologii
1979-03-01
..gamma..-endonuclease Y, an enzyme that hydrolyses phosphodiester bonds at alkali-stable lesions in ..gamma..-irradiated (N/sub 2/, tris buffer) DNA, has been partially purified from Micrococcus luteus. The enzyme has a molecular weight of about 19 000, induces single-strand breaks with 3'OH-5'PO/sub 4/ termini and contains endonuclease activity towards DNA treated with 7-bromomethylbenz(a)anthracene. ..gamma..-endonuclease Y induces breaks in OsO/sub 4/-treated poly(dA-dT) and apparently is specific towards ..gamma..-ray-induced base lesions of the t' type. The complete excision repair of ..gamma..-endonuclease Y substrate sites has been performed in vitro by ..gamma..-endonuclease Y, DNA polymerase and ligase.
Measurement of B(psi -> gamma chi(c1)) and search for psi -> gamma chi(c2)
Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Liao, J. B.; Liao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Komicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiging; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thomdike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zheruchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.
2015-01-01
We report a measurement of the branching fraction for psi(3770) -> gamma chi(c1) and search for the transition psi(3770) -> gamma chi(c2) based on 2.92 fb(-1) of e(+)e(-) data accumulated at root s = 3.773 GeV with the BESIII detector at the BEPCII collider. We measure B(psi(3770) -> gamma chi(c1))
A link between prompt optical and prompt gamma-ray emission in gamma-ray bursts.
Vestrand, W T; Wozniak, P R; Wren, J A; Fenimore, E E; Sakamoto, T; White, R R; Casperson, D; Davis, H; Evans, S; Galassi, M; McGowan, K E; Schier, J A; Asa, J W; Barthelmy, S D; Cummings, J R; Gehrels, N; Hullinger, D; Krimm, H A; Markwardt, C B; McLean, K; Palmer, D; Parsons, A; Tueller, J
2005-05-12
The prompt optical emission that arrives with the gamma-rays from a cosmic gamma-ray burst (GRB) is a signature of the engine powering the burst, the properties of the ultra-relativistic ejecta of the explosion, and the ejecta's interactions with the surroundings. Until now, only GRB 990123 had been detected at optical wavelengths during the burst phase. Its prompt optical emission was variable and uncorrelated with the prompt gamma-ray emission, suggesting that the optical emission was generated by a reverse shock arising from the ejecta's collision with surrounding material. Here we report prompt optical emission from GRB 041219a. It is variable and correlated with the prompt gamma-rays, indicating a common origin for the optical light and the gamma-rays. Within the context of the standard fireball model of GRBs, we attribute this new optical component to internal shocks driven into the burst ejecta by variations of the inner engine. The correlated optical emission is a direct probe of the jet isolated from the medium. The timing of the uncorrelated optical emission is strongly dependent on the nature of the medium.
Decision about buying a gamma camera
International Nuclear Information System (INIS)
Ganatra, R.D.
1992-01-01
A large part of the referral to a nuclear medicine department is usually for imaging studies. Sooner or later, the nuclear medicine specialist will be called upon to make a decision about when and what type of gamma camera to buy. There is no longer an option of choosing between a rectilinear scanner and a gamma camera as the former is virtually out of the market. The decision that one has to make is when to invest in a gamma camera, and then on what basis to select the gamma camera
Decision about buying a gamma camera
Energy Technology Data Exchange (ETDEWEB)
Ganatra, R D
1993-12-31
A large part of the referral to a nuclear medicine department is usually for imaging studies. Sooner or later, the nuclear medicine specialist will be called upon to make a decision about when and what type of gamma camera to buy. There is no longer an option of choosing between a rectilinear scanner and a gamma camera as the former is virtually out of the market. The decision that one has to make is when to invest in a gamma camera, and then on what basis to select the gamma camera 1 tab., 1 fig
Data acquisition system for gamma-gamma physics at KLOE2
International Nuclear Information System (INIS)
Iafolla, Lorenzo; Archilli, Flavio; Babusci, Danilo; Badoni, Davide; Beretta, Matteo; Gonnella, Francesco; Messi, Roberto; Moricciani, Dario
2010-01-01
In the new KLOE2 experiment, at DAΦNE particle accelerator of LNF-INFN, a pair of tagger detectors will be installed in order to investigate gamma-gamma physics. We shall need to acquire a 32 bits pattern for each detector and to allow a high time-resolution event reconstruction with KLOE data. The acquisition system will be implemented with Virtex-5 FPGA in order to avoid expensive TDC. The real time sampling and holding system, reference providing system, memorization and transfer data system will be described.
Quality assurance for gamma knives
International Nuclear Information System (INIS)
Jones, E.D.; Banks, W.W.; Fischer, L.E.
1995-09-01
This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations
Quality assurance for gamma knives
Energy Technology Data Exchange (ETDEWEB)
Jones, E.D.; Banks, W.W.; Fischer, L.E. [Lawrence Livermore National Lab., CA (United States)
1995-09-01
This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations.
Ben Issaid, Chaouki
2017-04-01
The Gamma-Gamma distribution has recently emerged in a number of applications ranging from modeling scattering and reverbation in sonar and radar systems to modeling atmospheric turbulence in wireless optical channels. In this respect, assessing the outage probability achieved by some diversity techniques over this kind of channels is of major practical importance. In many circumstances, this is intimately related to the difficult question of analyzing the statistics of a sum of Gamma-Gamma random variables. Answering this question is not a simple matter. This is essentially because outage probabilities encountered in practice are often very small, and hence the use of classical Monte Carlo methods is not a reasonable choice. This lies behind the main motivation of the present work. In particular, this paper proposes a new approach to estimate the left tail of the sum of independent and identically distributed Gamma-Gamma variates. More specifically, we propose a mean-shift importance sampling scheme that efficiently evaluates the outage probability of L-branch maximum ratio combining diversity receivers over Gamma-Gamma fading channels. The proposed estimator satisfies the well-known bounded relative error criterion. We show the accuracy and the efficiency of our approach compared to naive Monte Carlo via some selected numerical simulations.
Ben Issaid, Chaouki; Rached, Nadhir B.; Kammoun, Abla; Alouini, Mohamed-Slim; Tempone, Raul
2017-01-01
The Gamma-Gamma distribution has recently emerged in a number of applications ranging from modeling scattering and reverbation in sonar and radar systems to modeling atmospheric turbulence in wireless optical channels. In this respect, assessing the outage probability achieved by some diversity techniques over this kind of channels is of major practical importance. In many circumstances, this is intimately related to the difficult question of analyzing the statistics of a sum of Gamma-Gamma random variables. Answering this question is not a simple matter. This is essentially because outage probabilities encountered in practice are often very small, and hence the use of classical Monte Carlo methods is not a reasonable choice. This lies behind the main motivation of the present work. In particular, this paper proposes a new approach to estimate the left tail of the sum of independent and identically distributed Gamma-Gamma variates. More specifically, we propose a mean-shift importance sampling scheme that efficiently evaluates the outage probability of L-branch maximum ratio combining diversity receivers over Gamma-Gamma fading channels. The proposed estimator satisfies the well-known bounded relative error criterion. We show the accuracy and the efficiency of our approach compared to naive Monte Carlo via some selected numerical simulations.
Gamma spectrometry and plastic-scintillator inherent background
International Nuclear Information System (INIS)
Pomerantsev, V.V.; Gagauz, I.B.; Mitsai, L.I.; Pilipenko, V.S.; Solomonov, V.M.; Chernikov, V.V.; Tsirlin, Y.A.
1988-01-01
The authors measured the energy resolution for a linear dependence of light yield on gamma radiation energy of gamma spectrometers based on plastic scintillation detectors for several plastic scintillators. If there were several gamma lines from the source the line with the highest energy was used to eliminate distortion due to overlap from the Compton background from gamma radiation of higher energy. Attenuation lengths were calculated. The tests were based on three modes of interaction between the gamma radiation and the scintillator: Compton scattering, the photoelectric effect, and pair formation. The contribution from light collection was also considered. The scintillators tested included polystyrene, polymethyl methacrylate, cesium iodide, and sodium iodide. Gamma sources included cesium 137, sodium 22, potassium 40, yttrium 88, thorium 232, and plutonium-beryllium
Microwave-gamma ray water in crude monitor
International Nuclear Information System (INIS)
Paap, H.J.
1984-01-01
A microwave-gamma ray water-in-crude monitoring system measures the percent quantity of fresh water or salt water in crude oil flowing in a pipe line. The system includes a measuring cell arranged with the pipe line so that the crude oil flows through the measuring cell. A microwave transmitter subsystem and a gamma ray source are arranged with the measuring cell so that microwave energy and gamma rays are transmitted through the measuring cell. A microwave receiving subsystem and a gamma ray detector provide signals corresponding to received microwave energy and to the received gamma rays, respectively. Apparatus connected to the microwave receiver and to the gamma ray detector provides an indication of the percentage of water in the crude oil
International Nuclear Information System (INIS)
Simonet, G.
1987-06-01
The mapping of gamma sources radiation emission in a nuclear plant is an important safety point. A remote gamma ray mapping process was developed in SPS/CEA/SACLAY. It uses the ''pinhole camera'' principle, precursor of photography. It mainly consists of a radiation proof box, with a small orifice, containing sensitive emulsions at the opposite. A first conventional photographic type emulsion photographs the area. A second photographic emulsion shows up the gamma radiations. The superim position of the two shots gives immediate informations of the precise location of each source of radiation in the observed area. To make easier the presentation and to improve the accuracy of the results for radiation levels mapping, the obtained films are digitally processed. The processing assigns a colours scale to the various levels of observed radiations. Taking account physical data and standard parameters, it gets possible to estimate the dose rate. The device is portable. Its compactness and fully independent nature make it suitable for use anywhere. It can be adapted to a remote automatic handling system, robot... so as to avoid all operator exposure when the local dose rate is too high [fr
Wunderer, Cornelia B.; GRI Collaboration
2008-03-01
Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are accelerated to extreme relativistic energies by mechanisms which are still poorly understood, and nuclear reactions are synthesizing the basic constituents of our world. Cosmic accelerators and cosmic explosions are major science themes that are addressed in the gamma-ray regime. ESA's INTEGRAL observatory currently provides the astronomical community with a unique tool to investigate the sky up to MeV energies and hundreds of sources, new classes of objects, extraordinary views of antimatter annihilation in our Galaxy, and fingerprints of recent nucleosynthesis processes have been discovered. NASA's GLAST mission will similarly take the next step in surveying the high-energy ( GeV) sky, and NuSTAR will pioneer focusing observations at hard X-ray energies (to 80 keV). There will be clearly a growing need to perform deeper, more focused investigations of gamma-ray sources in the 100-keV to MeV regime. Recent technological advances in the domain of gamma-ray focusing using Laue diffraction and multilayer-coated mirror techniques have paved the way towards a gamma-ray mission, providing major improvements compared to past missions regarding sensitivity and angular resolution. Such a future Gamma-Ray Imager will allow the study of particle acceleration processes and explosion physics in unprecedented detail, providing essential clues on the innermost nature of the most violent and most energetic processes in the Universe.
Gamma-Ray Interactions for Reachback Analysts
Energy Technology Data Exchange (ETDEWEB)
Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Myers, Steven Charles [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-08-02
This presentation is a part of the DHS LSS spectroscopy training course and presents an overview of the following concepts: identification and measurement of gamma rays; use of gamma counts and energies in research. Understanding the basic physics of how gamma rays interact with matter can clarify how certain features in a spectrum were produced.
The gamma oscillation: master or slave?
Schroeder, Charles E; Lakatos, Peter
2009-06-01
The idea that gamma enhancement reflects a state of high neuronal excitability and synchrony, critical for active brain operations, sets gamma up as a "master" or executor process that determines whether an input is effectively integrated and an effective output is generated. However, gamma amplitude is often coupled to the phase of lower frequency delta or theta oscillations, which would make gamma a "slave" to lower frequency activity. Gamma enslavement is productive and typical during rhythmic mode brain operations; when a predictable rhythm is in play, low and mid-frequency oscillations can be entrained and their excitability fluctuations of put to work in sensory and motor functions. When there is no task relevant rhythm that the system can entrain to, low frequency oscillations become detrimental to processing. Then, a continuous (vigilance) mode of operation is implemented; the system's sensitivity is maximized by suppressing lower frequency oscillations and exploiting continuous gamma band oscillations. Each mode has costs and benefits, and the brain shifts dynamically between them in accord with task demands.
Gamma Ray Bursts-Afterglows and Counterparts
Fishman, Gerald J
1998-01-01
Several breakthrough discoveries were made last year of x-ray, optical and radio afterglows and counterparts to gamma-ray bursts, and a redshift has been associated with at least one of these. These discoveries were made possible by the fast, accurate gamma-ray burst locations of the BeppoSAX satellite. It is now generally believed that the burst sources are at cosmological distances and that they represent the most powerful explosions in the Universe. These observations also open new possibilities for the study of early star formation, the physics of extreme conditions and perhaps even cosmology. This session will concentrate on recent x-ray, optical and radio afterglow observations of gamma-ray bursts, associated redshift measurements, and counterpart observations. Several review and theory talks will also be presented, along with a summary of the astrophysical implications of the observations. There will be additional poster contributions on observations of gamma-ray burst source locations at wavelengths other than gamma rays. Posters are also solicited that describe new observational capabilities for rapid follow-up observations of gamma-ray bursts.
Two-photon widths of the chi(c0,2) states and helicity analysis for chi(c2) -> gamma gamma
Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, Kun; Liu, P. L.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Thorndike, E. H.; Tian, H. L.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Werner, M.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. G.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.
2012-01-01
Based on a data sample of 106 X 10(6) psi' events collected with the BESIII detector, the decays psi' -> gamma chi(c0,2), chi(c0,2) -> gamma gamma are studied to determine the two-photon widths of the chi(c0,2) states. The two-photon decay branching fractions are determined to be B(chi(c0) -> gamma
Smith, Jackson
2015-01-01
Results of the latest $\\gamma$ combination from LHCb are presented, along with the six LHCb measurements used as inputs. In addition, the anticipated precision attainable for measuring $\\gamma$ after the LHCb Upgrade is outlined
Introscopy using gamma sources
International Nuclear Information System (INIS)
Gromov, Yu.V.; Leonov, B.I.; Najorov, A.N.; Smirnov, N.N.; Firstov, V.G.
1978-01-01
A method is described of working with standard 170 Tm, 75 Se, 192 Ir, 137 Cs and 60 Co sources at the activity of 1-4000 Ci, during television gamma introscopy of steel products. Experiments involving the RI-10T introscope are carried out to determine prospects of using various radiation sources. The results of using X-ray instruments for control of steel products are also shown for comparison. In introscopy of X-rayed steel products over 25 mm thick, spreading of the edge of the detected groove image is shown to be comparable when using X radiation and gamma radiation of standard sources. Sensitivity of control by fluorographic introscope in X-raying and gamma irradiation of products over 25 mm thick will presumably be the same owing to the detector storage capacity. The use of commercial gamma flaw detecting instruments together with a television introscope permits to reliably reveal defects of 0.5-2.0 mm in size, eliminating possible instability of operation of X-ray instruments, particularly in field conditions
76 FR 32989 - Request for Certification of Compliance-Rural Industrialization Loan and Grant Program
2011-06-07
... real estate and construction of a new location of Buc-ee's (gas station and convenience store), which...: 447110 (gasoline stations with convenience stores). DATES: All interested parties may submit comments in... Department of Agriculture to make or guarantee loans or grants to finance industrial and business activities...
Multifrequency Observations of Gamma-Ray Burst
Greiner, J.
1995-01-01
Neither a flaring nor a quiescent counterpart to a gamma-ray burst has yet been convincingly identified at any wavelength region. The present status of the search for counterparts of classical gamma-ray bursts is given. Particular emphasis is put on the search for flaring counterparts, i.e. emission during or shortly after the gamma-ray emission.
Gamma-rays from deep inelastic collisions
International Nuclear Information System (INIS)
Stephens, F.S.
1981-01-01
My objective in this talk is to consider the question: 'What can be learned about deep inelastic collisions (DIC) from studying the associated gamma-rays'. First, I discuss the origin and nature of the gamma-rays from DIC, then the kinds of information gamma-ray spectra contain, and finally come to the combination of these two subjects. (orig./HSI)
NEW FERMI-LAT EVENT RECONSTRUCTION REVEALS MORE HIGH-ENERGY GAMMA RAYS FROM GAMMA-RAY BURSTS
Energy Technology Data Exchange (ETDEWEB)
Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Baldini, L. [Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bregeon, J.; Pesce-Rollins, M.; Sgro, C.; Tinivella, M. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bruel, P. [Laboratoire Leprince-Ringuet, Ecole polytechnique, CNRS/IN2P3, Palaiseau (France); Chekhtman, A. [Center for Earth Observing and Space Research, College of Science, George Mason University, Fairfax, VA 22030 (United States); Cohen-Tanugi, J. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, F-34095 Montpellier (France); Drlica-Wagner, A.; Omodei, N.; Rochester, L. S.; Usher, T. L. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Granot, J. [Department of Natural Sciences, The Open University of Israel, 1 University Road, P.O. Box 808, Ra' anana 43537 (Israel); Longo, F. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Razzaque, S. [Department of Physics, University of Johannesburg, Auckland Park 2006 (South Africa); Zimmer, S., E-mail: melissa.pesce.rollins@pi.infn.it, E-mail: nicola.omodei@stanford.edu, E-mail: granot@openu.ac.il [Department of Physics, Stockholm University, AlbaNova, SE-106 91 Stockholm (Sweden)
2013-09-01
Based on the experience gained during the four and a half years of the mission, the Fermi-LAT Collaboration has undertaken a comprehensive revision of the event-level analysis going under the name of Pass 8. Although it is not yet finalized, we can test the improvements in the new event reconstruction with the special case of the prompt phase of bright gamma-ray bursts (GRBs), where the signal-to-noise ratio is large enough that loose selection cuts are sufficient to identify gamma rays associated with the source. Using the new event reconstruction, we have re-analyzed 10 GRBs previously detected by the Large Area Telescope (LAT) for which an X-ray/optical follow-up was possible and found four new gamma rays with energies greater than 10 GeV in addition to the seven previously known. Among these four is a 27.4 GeV gamma ray from GRB 080916C, which has a redshift of 4.35, thus making it the gamma ray with the highest intrinsic energy ({approx}147 GeV) detected from a GRB. We present here the salient aspects of the new event reconstruction and discuss the scientific implications of these new high-energy gamma rays, such as constraining extragalactic background light models, Lorentz invariance violation tests, the prompt emission mechanism, and the bulk Lorentz factor of the emitting region.
Development of air equivalent gamma dose monitor
International Nuclear Information System (INIS)
Alex, Mary; Bhattacharya, Sadhana; Karpagam, R.; Prasad, D.N.; Jakati, R.K.; Mukhopadhyay, P.K.; Patil, R.K.
2010-01-01
The paper describes design and development of air equivalent gamma absorbed dose monitor. The monitor has gamma sensitivity of 84 pA/R/h for 60 Co source. The characterization of the monitor has been done to get energy dependence on gamma sensitivity and response to gamma radiation field from 1 R/hr to 5000 R/hr. The gamma sensitivity in the energy range of 0.06 to 1.25MeV relative to 137 Cs nuclide was within 2.5%. The linearity of the monitor response as a function of gamma field from 10 R/h to 3.8 kR/h was within 6%. The monitor has been designed for its application in harsh environment. It has been successfully qualified to meet environmental requirements of shock. (author)
Gamma radiography and its technological application
International Nuclear Information System (INIS)
Courtois, G.
1962-01-01
After the presentation of gamma radiography and X-ray radiography, the author compare both techniques showing, in particular, the greater utility of gamma radiography in industrial diagnostic and more particularly on works site diagnostic. Problem of using radiography and safety consideration will be studied. Figures shows two radiography equipment which have been designed for gamma radiography respecting the safety regulations required by the Radioisotope Inter-ministerial Commission. In the second part, different techniques and uses of gamma radiography are briefly described : xerography, neutron radiography, fluoroscopy and imaging amplifier, tomography, betatrons and linear accelerators. Cost analysis will discussed in conclusion. (M.P.)
Burn-up credit applications for UO2 and MOX fuel assemblies in AREVA/COGEMA
International Nuclear Information System (INIS)
Toubon, H.; Riffard, C.; Batifol, M.; Pelletier, S.
2003-01-01
For the last seven years, AREVA/COGEMA has been implementing the second phase of its burn-up credit program (the incorporation of fission products). Since the early nineties, major actinides have been taken into account in criticality analyses first for reprocessing applications, then for transport and storage of fuel assemblies Next year (2004) COGEMA will take into account the six main fission products (Rh103, Cs133, Nd143, Sm149, Sm152 and Gd155) that make up 50% of the anti-reactivity of all fission products. The experimental program will soon be finished. The new burn-up credit methodology is in progress. After a brief overview of BUC R and D program and COGEMA's application of the BUC, this paper will focus on the new burn-up measurement for UO2 and MOX fuel assemblies. It details the measurement instrumentation and the measurement experiments on MOX fuels performed at La Hague in January 2003. (author)
Gamma knife surgery for craniopharyngioma
International Nuclear Information System (INIS)
Prasad, D.; Steiner, M.; Steiner, L.
1995-01-01
We present our results of Gamma Knife surgery for craniopharyngioma in nine patients. The current status of surgery, radiation therapy, intracavitary instillation of radionuclides and Gamma Knife surgery in the management of craniopharyngiomas is discussed. (author)
Neutron detection gamma ray sensitivity criteria
International Nuclear Information System (INIS)
Kouzes, Richard T.; Ely, James H.; Lintereur, Azaree T.; Mace, Emily K.; Stephens, Daniel L.; Woodring, Mitchell L.
2011-01-01
The shortage of 3 He has triggered the search for effective alternative neutron detection technologies for national security and safeguards applications. Any new detection technology must satisfy two basic criteria: (1) it must meet a neutron detection efficiency requirement, and (2) it must be insensitive to gamma-ray interference at a prescribed level, while still meeting the neutron detection requirement. It is the purpose of this paper to define measureable gamma ray sensitivity criteria for neutron detectors. Quantitative requirements are specified for: intrinsic gamma ray detection efficiency and gamma ray absolute rejection. The gamma absolute rejection ratio for neutrons (GARRn) is defined, and it is proposed that the requirement for neutron detection be 0.9 3 He based neutron detector is provided showing that this technology can meet the stated requirements. Results from tests of some alternative technologies are also reported.
BFKL resummation effects in gamma* gamma* to rho rho
Energy Technology Data Exchange (ETDEWEB)
Enberg, R.; Pire, B.; Szymanowski, L.; Wallon, S.
2005-08-11
We calculate the leading order BFKL amplitude for the exclusive diffractive process {gamma}*{sub L}(Q{sub 1}{sup 2}) {gamma}*{sub L}(Q{sub 2}{sup 2}) {yields} {rho}{sub L}{sup 0}{rho}{sub L}{sup 0} in the forward direction, which can be studied in future high energy e{sup +}e{sup -} linear colliders. The resummation effects are very large compared to the fixed-order calculation. We also estimate the next-to-leading logarithmic corrections to the amplitude by using a specific resummation of higher order effects and find a substantial growth with energy, but smaller than in the leading logarithmic approximation.
Energy Technology Data Exchange (ETDEWEB)
Gross, Bernhard [National Institute of Technology, Rio de Janeiro (Brazil)
1960-06-15
The Compton current produced by X-rays and {gamma}-rays in the 0.3 to 3 MeV range is proportional to the radiant energy flux. Therefore the intensity of the current can be used as a measure of radiation dose. The present paper describes a radiation receiver and electrical measuring system suitable for Compton current measurements and results obtained with this device under irradiation from a 2000 curie Co{sup 60} source. (author) [French] Le courant de Compton produit par des rayons X et {gamma} dans le domaine d'energies compris entre 0,3 et 3 MeV est proportionnel au flux d'energie rayonnante. C'est pourquoi l'intensite du courant peut servir de mesure de la dose de rayonnements. Le memoire decrit un ensemble, appareil recepteur de rayonnements et appareil de mesure electrique, permettant de mesurer le courant de Compton et il expose les resultats obtenus, au moyen de ce dispositif, sous irradiation par une source de Co{sup 60} de 2000 curies. (author) [Spanish] La corriente de Compton producida por rayos X y rayos {gamma} de energia comprendida entre 0,3 y 3 MeV es proporcional al flujo de energia radiante. Por consiguiente, la intensidad de la corriente puede servir para medir la dosis de radiacion. En este trabajo se describen un receptor de radiaciones y un sistema de medicion electrica apropiados para determinar la intensidad de la corriente de Compton, asi como los resultados obtenidos mediante este dis- positivo cuando se irradia con una fuente de Co{sup 60} de 2000 curies. (author) [Russian] Komptonovskij potok, obrazuemyj rentgenovskim i luchami i {gamma}-luchami v predelakh ot 0,3 do 3 mehv, proportsionale n potoku luchistoj ehnergii. Poehtomu intensivnost' potoka mozhet byt' ispol'zovana dlya izmereniya dozy radiatsii. V nastoyashchem dokumente opisyvayutsya radiatsionny j priemnik i ehlektricheskaya izmeritel'naya sistema, prigodnye dlya izmerenij s pomoshch'yu komptonovskog o potoka, i rezul'taty, poluchennye s pomoshch'yu ehtogo ustrojstva v khode
Advanced HEDL gamma scan system
International Nuclear Information System (INIS)
Smith, F.C.; Olson, R.N.
1983-01-01
The design of an advanced state-of-the-art gamma scan system built for the purpose of measuring the point-by-point gamma activity of irradiated fuel rods is described. The emphasis of the system design was to achieve the highest rate of throughput with the minimum per rod cost while maintaining system accuracy and reliability. Preliminary tests demonstrate that all system requirements were met or exceeded. The system provides improved throughput, precision, automation, flexibility, and data processing capability over previous gamma scan systems
Batley, J.R.; Lazzeroni, C.; Munday, D.J.; Slater, M.W.; Wotton, S.A.; Arcidiacono, R.; Bocquet, G.; Cabibbo, N.; Ceccucci, A.; Cundy, D.; Falaleev, V.; Fidecaro, M.; Gatignon, L.; Gonidec, A.; Kubischta, W.; Norton, A.; Maier, A.; Patel, M.; Peters, A.; Balev, S.; Frabetti, P.L.; Gersabeck, E.; Goudzovski, E.; Hristov, P.; Kekelidze, V.; Kozhuharov, V.; Litov, L.; Madigozhin, D.; Molokanova, N.; Polenkevich, I.; Potrebenikov, Yu.; Stoynev, S.; Zinchenko, A.; Monnier, E.; Swallow, E.; Winston, R.; Rubin, P.; Walker, A.; Baldini, W.; Cotta Ramusino, A.; Dalpiaz, P.; Damiani, C.; Fiorini, M.; Gianoli, A.; Martini, M.; Petrucci, F.; Savrie, M.; Scarpa, M.; Wahl, H.; Bizzeti, A.; Lenti, M.; Veltri, M.; Calvetti, M.; Celeghini, E.; Iacopini, E.; Ruggiero, G.; Behler, M.; Eppard, K.; Kleinknecht, K.; Marouelli, P.; Masetti, L.; Moosbrugger, U.; Morales Morales, C.; Renk, B.; Wache, M.; Wanke, R.; Winhart, A.; Coward, D.; Dabrowski, A.; Fonseca Martin, T.; Shieh, M.; Szleper, M.; Velasco, M.; Wood, M.D.; Cenci, P.; Pepe, M.; Petrucci, M.C.; Anzivino, G.; Imbergamo, E.; Nappi, A.; Piccini, M.; Raggi, M.; Valdata-Nappi, M.; Cerri, C.; Fantechi, R.; Collazuol, G.; DiLella, L.; Lamanna, G.; Mannelli, I.; Michetti, A.; Costantini, F.; Doble, N.; Fiorini, L.; Giudici, S.; Pierazzini, G.; Sozzi, M.; Venditti, S.; Bloch-Devaux, B.; Cheshkov, C.; Cheze, J.B.; De Beer, M.; Derre, J.; Marel, G.; Mazzucato, E.; Peyaud, B.; Vallage, B.; Holder, M.; Ziolkowski, M.; Biino, C.; Cartiglia, N.; Marchetto, F.; Bifani, S.; Clemencic, M.; Goy Lopez, S.; Dibon, H.; Jeitler, M.; Markytan, M.; Mikulec, I.; Neuhofer, G.; Widhalm, L.
2014-01-01
The NA48/2 experiment at CERN collected two data samples with minimum bias trigger conditions in 2003 and 2004. A measurement of the rate and dynamic properties of the rare decay $K^\\pm\\to\\pi^\\pm\\gamma\\gamma$ from these data sets based on 149 decay candidates with an estimated background of $15.5\\pm0.7$ events is reported. The model-independent branching ratio in the kinematic range $z=(m_{\\gamma\\gamma}/m_K)^2>0.2$ is measured to be ${\\cal B}_{\\rm MI}(z>0.2) = (0.877 \\pm 0.089) \\times 10^{-6}$, and the branching ratio in the full kinematic range assuming a particular Chiral Perturbation Theory description to be ${\\cal B}(K_{\\pi\\gamma\\gamma}) = (0.910 \\pm 0.075) \\times 10^{-6}$.
Physical constraints on models of gamma-ray bursters
International Nuclear Information System (INIS)
Epstein, R.I.
1985-01-01
This report deals with the constraints that can be placed on models of gamma-ray burst sources based on only the well-established observational facts and physical principles. The premise is developed that the very hard x-ray and gamma-ray continua spectra are well-established aspects of gamma-ray bursts. Recent theoretical work on gamma-ray bursts are summarized with emphasis on the geometrical properties of the models. Constraints on the source models which are implied by the x-ray and gamma-ray spectra are described. The allowed ranges for the luminosity and characteristic dimension for gamma-ray burst sources are shown. Some of the deductions and inferences about the nature of the gamma-ray burst sources are summarized. 67 refs., 3 figs
Directory of Open Access Journals (Sweden)
Chun Fu Lin
Full Text Available We sought to imitate angiographic cerebral circulation time (CCT and create a similar index from baseline CT perfusion (CTP to better predict vasospasm in patients with subarachnoid hemorrhage (SAH.Forty-one SAH patients with available DSA and CTP were retrospectively included. The vasospasm group was comprised of patients with deterioration in conscious functioning and newly developed luminal narrowing; remaining cases were classified as the control group. The angiography CCT (XA-CCT was defined as the difference in TTP (time to peak between the selected arterial ROIs and the superior sagittal sinus (SSS. Four arterial ROIs were selected to generate four corresponding XA-CCTs: the right and left anterior cerebral arteries (XA-CCTRA2 and XA-CCTLA2 and right- and left-middle cerebral arteries (XA-CCTRM2 and XA-CCTLM2. The CCTs from CTP (CT-CCT were defined as the differences in TTP from the corresponding arterial ROIs and the SSS. Correlations of the different CCTs were calculated and diagnostic accuracy in predicting vasospasm was evaluated.Intra-class correlations ranged from 0.96 to 0.98. The correlations of XA-CCTRA2, XA-CCTRM2, XA-CCTLA2, and XA-CCTLM2 with the corresponding CT-CCTs were 0.64, 0.65, 0.53, and 0.68, respectively. All CCTs were significantly prolonged in the vasospasm group (5.8-6.4 s except for XA-CCTLA2. CT-CCTA2 of 5.62 was the optimal cut-off value for detecting vasospasm with a sensitivity of 84.2% and specificity 82.4.CT-CCTs can be used to interpret cerebral flow without deconvolution algorithms, and outperform both MTT and TTP in predicting vasospasm risk. This finding may help facilitate management of patients with SAH.
Energy spectrum of lightning gamma emission
Energy Technology Data Exchange (ETDEWEB)
Chubenko, A.P. [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Karashtin, A.N. [Research Radiophysics Institute, Nizhny Novgorod (Russian Federation); Ryabov, V.A., E-mail: ryabov@x4u.lebedev.r [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Shepetov, A.L. [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Antonova, V.P.; Kryukov, S.V. [Ionosphere Institute, Almaty (Kazakhstan); Mitko, G.G.; Naumov, A.S.; Pavljuchenko, L.V. [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Ptitsyn, M.O., E-mail: ptitsyn@lpi.r [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Shalamova, S.Ya. [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Shlyugaev, Yu.V. [Research Radiophysics Institute, Nizhny Novgorod (Russian Federation); Vildanova, L.I. [Tien-Shan Mountain Cosmic Ray Station, Almaty (Kazakhstan); Zybin, K.P. [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation); Gurevich, A.V., E-mail: alex@lpi.r [P.N. Lebedev Physical Institute of RAS, Moscow (Russian Federation)
2009-08-10
The results of gamma emission observations obtained during thunderstorms at Tien-Shan Mountain Cosmic Ray Station are presented. The energy spectrum radiation of the stepped leader gamma radiation is measured. The total energy of stepped leader emitted in gamma rays is estimated as 10{sup -3}-10{sup -2} J. The experimental results are in an agreement with the runaway breakdown mechanism.
Energy spectrum of lightning gamma emission
International Nuclear Information System (INIS)
Chubenko, A.P.; Karashtin, A.N.; Ryabov, V.A.; Shepetov, A.L.; Antonova, V.P.; Kryukov, S.V.; Mitko, G.G.; Naumov, A.S.; Pavljuchenko, L.V.; Ptitsyn, M.O.; Shalamova, S.Ya.; Shlyugaev, Yu.V.; Vildanova, L.I.; Zybin, K.P.; Gurevich, A.V.
2009-01-01
The results of gamma emission observations obtained during thunderstorms at Tien-Shan Mountain Cosmic Ray Station are presented. The energy spectrum radiation of the stepped leader gamma radiation is measured. The total energy of stepped leader emitted in gamma rays is estimated as 10 -3 -10 -2 J. The experimental results are in an agreement with the runaway breakdown mechanism.
Gamma sterilization of disposable medical products (DMP's)
International Nuclear Information System (INIS)
Brinston, R.M.
1990-01-01
Ten million cubic meters (361 million cubic feet) of disposable medical products (DMP) and related health care items are estimated to be sterilized in the world. In this paper, current conditions and perspectives of gamma sterilization is discussed in comparison with ethylene oxide gas and electron beams. Of the total sterilization estimates for DMP, 2.8 million cubic meters (99 million cubic feet) are sterilized with gamma radiation, with a market share of 27%. Gamma radiation is becoming increased from both general market growth and the introduction of new products, as well as the conversion of product from ethylene oxide gas to cobalt-60. Regulatory pressures, legal considerations, and increasing publicity surrounding ethylene oxide usage are encouraging manufactures to switch to gamma radiation. Gamma's performance features include: no temperature change during the sterilization, high penetration, even through hermetically sealed packages, no residues, and no post-sterilization treatment or quarantine period. Gamma sterilization is economically beneficial in large volumes of product. Cost saving to the end user of gamma sterilization has meant lower minimum dose levels than 25 KGy. Despite of an increasingly accepted gamma radiation, there are still four factors to be considered, including cobalt-60 availability, price, transportation, and disposal. The price of cobalt-60 is based on neutron cost. In the future, cobalt-60 price is expected to be flat and enables gamma processing to become even more competitive with other sterilization methods. Gamma radiation using cobalt-60 has been proven as a safe, effective, and cost-competitive sterilization method for treating DMP and related health care items. It's wide use and many processing advantages will continue to make it a preferred sterilization method. (N.K.)
Initial studies of the gamma resonance of the 109mAg isomer with a gravitational gamma spectrometer
International Nuclear Information System (INIS)
Alpatov, V. G.; Bayukov, Yu. D.; Davydov, A. V.; Isaev, Yu. N.; Kartashov, G. R.; Korotkov, M. M.; Migachev, V. V.
2008-01-01
The problem of observing the Moessbauer resonance absorption of gamma rays from long-lived isomers is briefly outlined, first and foremost for 109m Ag taken as an example. Experiments indicative of a small broadening of the Moessbauer gamma line of this isomer in metallic silver are described. This circumstance made it possible to develop and manufacture a gravitational gamma spectrometer and to perform the first experiments with it, which confirm once again the previous data on a small width of the gamma line in question. The broadening factor obtained from these data proved to be 6.3 -1.9 +5.2 .
Gamma ray astronomy from satellites and balloons
International Nuclear Information System (INIS)
Schoenfelder, V.
1986-01-01
A survey is given of gamma ray astronomy topics presented at the Cosmic Ray Conference. The major conclusions at the Cosmic Ray Conference in the field of gamma ray astronomy are given. (1) MeV-emission of gamma-ray bursts is a common feature. Variations in duration and energy spectra from burst to burst may explain the discrepancy between the measured log N - log S dependence and the observed isotropy of bursts. (2) The gamma-ray line at 1.809 MeV from Al(26) is the first detected line from a radioactive nucleosynthesis product. In order to understand its origin it will be necessary to measure its longitude distribution in the Milky Way. (3) The indications of a gamma-ray excess found from the direction of Loop I is consistent with the picture that the bulk of cosmic rays below 100 GeV is produced in galactic supernova remnants. (4) The interpretation of the large scale distribution of gamma rays in the Milky Way is controversial. At present an extragalactic origin of the cosmic ray nuclei in the GeV-range cannot be excluded from the gamma ray data. (5) The detection of MeV-emission from Cen A is a promising step towards the interesting field of extragalactic gamma ray astronomy
ICIT contribution to JET gamma-ray diagnostics enhancement
International Nuclear Information System (INIS)
Soare, S.; Curuia, M.; Zoita, V.
2010-01-01
Full text: Gamma-ray emission of tokamak plasmas is the result of the interaction of fast ions (fusion reaction products, including alpha particles, NBI ions, ICRH-accelerated ions) with main plasma impurities (e.g., carbon, beryllium). Gamma-ray diagnostics involve both gamma-ray imaging (cameras) and gamma-ray spectrometry (spectrometers). For the JET tokamak, gamma-ray diagnostics have been used to provide information on the characteristics of the fast ion population in plasmas. Two gamma-ray diagnostics enhancements project have been launched by JET and the MEdC/EURATOM Association has agreed to lead both of them with ICIT as projects leader. (authors)
Gamma-ray angular distribution and correlation measurement. II
International Nuclear Information System (INIS)
Twin, P.J.
1975-01-01
Angular correlations of γ-rays following nuclear reactions depend, in general, on some alignment of the γ-emitting initial state. The methods of alignment are briefly discussed and then the techniques and experimental methods associated with direct angular distributions, particle-gamma correlations, gamma-gamma correlations and linear polarization correlations are dealt with. Finally the inherent ambiguities which arise when different spin and delta values give identical correlations are discussed for the simple direct and particle-gamma correlations together with the question whether the larger information content of gamma-gamma and linear polarization correlations can resolve these ambiguities. (Auth.)
Chierakul, Wirongrong; de Fost, Maaike; Suputtamongkol, Yupin; Limpaiboon, Roongreung; Dondorp, Arjen; White, Nicholas J.; van der Poll, Tom
2004-01-01
Interferon (IFN)-gamma plays an important role in the induction of a type 1 immune response against intracellular pathogens. We compared the plasma levels of IFN-gamma and IFN-gamma-inducing cytokines in adult Thai patients with scrub typhus, caused by the obligate intracellular bacterium Orientia
Interferon gamma-1b injection is used to reduce the frequency and severity of serious infections in people with chronic ... severe, malignant osteopetrosis (an inherited bone disease). Interferon gamma-1b is in a class of medications called ...
Thermal neutron capture gamma-rays
International Nuclear Information System (INIS)
Tuli, J.K.
1983-01-01
The energy and intensity of gamma rays as seen in thermal neutron capture are presented. Only those (n,α), E = thermal, reactions for which the residual nucleus mass number is greater than or equal to 45 are included. These correspond to evaluations published in Nuclear Data Sheets. The publication source data are contained in the Evaluated Nuclear Structure Data File (ENSDF). The data presented here do not involve any additional evaluation. Appendix I lists all the residual nuclides for which the data are included here. Appendix II gives a cumulated index to A-chain evaluations including the year of publication. The capture gamma ray data are given in two tables - the Table 1 is the list of all gamma rays seen in (n,#betta#) reaction given in the order of increasing energy; the Table II lists the gamma rays according to the nuclide
Gamma-Knife: operation ohne Skalpell
АБЛЯЕВА В.И.; НИКОЛАЕВА Н.А.; ДЕНИСОВА О.С.
2015-01-01
Das Gamma-Knife ist ein Operationsroboter, mit dem Ärzte durch Photonenstrahlen im Körper operieren können. Die Photonen beschädigen die DNA von Zellen, so dass diese sich nicht mehr teilen können. Gutartige Tumoren vernarben in den Wochen und Monaten nach der Behandlung, bösartige zerfallen. Mit dem Gamma-Knife können unterschiedliche Arten von Tumoren behandelt werden, gutartige ebenso wie bösartige. Zu den Diagnosen, bei denen das Gamma-Knife in Frage kommt, gehören zum Beispiel Akustikusn...
X-ray and gamma radiography devices
International Nuclear Information System (INIS)
Abdul Nassir Ibrahim; Azali Muhammad; Ab. Razak Hamzah; Abd. Aziz Mohamed; Mohamad Pauzi Ismail
2008-01-01
When we are using this technique, we also must familiar with the device and instrument that used such as gamma projector, crawler, x-ray tubes and others. So this chapter discussed detailed on device used for radiography work. For the x-ray and gamma, their characteristics are same but the source to produce is a big different. X-ray produced from the machine meanwhile, gamma produce from the source such as Co-60 and IR-192. Both are electromagnetic waves. So, the reader can have some knowledge on what is x-ray tube, discrete x-ray and characteristic x-ray, how the machine works and how to control a machine, what is source for gamma emitter, how to handle the projector and lastly difference between x-ray and gamma. Of course this cannot be with the theory only, so detailed must be learned practically.
International Nuclear Information System (INIS)
Esmaeili-sani, Vahid; Moussavi-zarandi, Ali; Boghrati, Behzad; Afarideh, Hossein
2012-01-01
Geophysical bore-hole data represent the physical properties of rocks, such as density and formation lithology, as a function of depth in a well. Properties of rocks are obtained from gamma ray transport logs. Transport of gamma rays, from a 137 Cs point gamma source situated in a bore-hole tool, through rock media to detectors, has been simulated using a GEANT4 radiation transport code. The advanced Compton scattering concepts were used to gain better analyses about well formation. The simulation and understanding of advanced Compton scattering highly depends on how accurately the effects of Doppler broadening and Rayleigh scattering are taken into account. A Monte Carlo package that simulates the gamma-gamma well logging tools based on GEANT4 advanced low energy Compton scattering (GALECS).
Pellizza, L. J.
Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH
Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Aşılar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Knünz, Valentin; König, Axel; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Matsushita, Takashi; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Strauss, Josef; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Lauwers, Jasper; Luyckx, Sten; Ochesanu, Silvia; Rougny, Romain; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; Daci, Nadir; De Bruyn, Isabelle; Deroover, Kevin; Heracleous, Natalie; Keaveney, James; Lowette, Steven; Moreels, Lieselotte; Olbrechts, Annik; Python, Quentin; Strom, Derek; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Van Parijs, Isis; Barria, Patrizia; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dobur, Didar; Fasanella, Giuseppe; Favart, Laurent; Gay, Arnaud; Grebenyuk, Anastasia; Lenzi, Thomas; Léonard, Alexandre; Maerschalk, Thierry; Marinov, Andrey; Perniè, Luca; Randle-conde, Aidan; Reis, Thomas; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Crucy, Shannon; Fagot, Alexis; Garcia, Guillaume; Gul, Muhammad; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Poyraz, Deniz; Ryckbosch, Dirk; Salva Diblen, Sinem; Sigamani, Michael; Strobbe, Nadja; Tytgat, Michael; Van Driessche, Ward; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jafari, Abideh; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Mertens, Alexandre; Nuttens, Claude; Perrini, Lucia; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Beliy, Nikita; Hammad, Gregory Habib; Aldá Júnior, Walter Luiz; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Dos Reis Martins, Thiago; Hensel, Carsten; Mora Herrera, Clemencia; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; De Souza Santos, Angelo; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Moon, Chang-Seong; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Genchev, Vladimir; Hadjiiska, Roumyana; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Cheng, Tongguang; Du, Ran; Jiang, Chun-Hua; Plestina, Roko; Romeo, Francesco; Shaheen, Sarmad Masood; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Zhang, Huaqiao; Asawatangtrakuldee, Chayanit; Ban, Yong; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Zou, Wei; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Micanovic, Sasa; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Bodlak, Martin; Finger, Miroslav; Finger Jr, Michael; Aly, Reham; Aly, Shereen; El-khateeb, Esraa; Lotfy, Ahmad; Mohamed, Amr; Radi, Amr; Salama, Elsayed; Ali, Ahmed; Calpas, Betty; Kadastik, Mario; Murumaa, Marion; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Zghiche, Amina; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Chapon, Emilien; Charlot, Claude; Dahms, Torsten; Davignon, Olivier; Filipovic, Nicolas; Florent, Alice; Granier de Cassagnac, Raphael; Lisniak, Stanislav; Mastrolorenzo, Luca; Miné, Philippe; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Regnard, Simon; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Le Bihan, Anne-Catherine; Merlin, Jeremie Alexandre; Skovpen, Kirill; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Bouvier, Elvire; Carrillo Montoya, Camilo Andres; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Courbon, Benoit; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Ruiz Alvarez, José David; Sabes, David; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Xiao, Hong; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Edelhoff, Matthias; Feld, Lutz; Heister, Arno; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Ostapchuk, Andrey; Preuten, Marius; Raupach, Frank; Sammet, Jan; Schael, Stefan; Schulte, Jan-Frederik; Verlage, Tobias; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Brodski, Michael; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Künsken, Andreas; Lingemann, Joschka; Nehrkorn, Alexander; Nowack, Andreas; Nugent, Ian Michael; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Asin, Ivan; Bartosik, Nazar; Behnke, Olaf; Behrens, Ulf; Bell, Alan James; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dolinska, Ganna; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Flucke, Gero; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Gunnellini, Paolo; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Karacheban, Olena; Kasemann, Matthias; Katsas, Panagiotis; Kieseler, Jan; Kleinwort, Claus; Korol, Ievgen; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Nayak, Aruna; Ntomari, Eleni; Perrey, Hanno; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Roland, Benoit; Sahin, Mehmet Özgür; Saxena, Pooja; Schoerner-Sadenius, Thomas; Schröder, Matthias; Seitz, Claudia; Spannagel, Simon; Trippkewitz, Karim Damun; Wissing, Christoph; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Erfle, Joachim; Garutti, Erika; Goebel, Kristin; Gonzalez, Daniel; Görner, Martin; Haller, Johannes; Hoffmann, Malte; Höing, Rebekka Sophie; Junkes, Alexandra; Klanner, Robert; Kogler, Roman; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Marconi, Daniele; Nowatschin, Dominik; Ott, Jochen; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Pietsch, Niklas; Poehlsen, Jennifer; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schwandt, Joern; Seidel, Markus; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Akbiyik, Melike; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Frensch, Felix; Giffels, Manuel; Gilbert, Andrew; Hartmann, Frank; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kornmayer, Andreas; Lobelle Pardo, Patricia; Mozer, Matthias Ulrich; Müller, Thomas; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Röcker, Steffen; Roscher, Frank; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Psallidas, Andreas; Topsis-Giotis, Iasonas; Agapitos, Antonis; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Loukas, Nikitas; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Bencze, Gyorgy; Hajdu, Csaba; Hazi, Andras; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Makovec, Alajos; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Mal, Prolay; Mandal, Koushik; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Gupta, Ruchi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Mehta, Ankita; Mittal, Monika; Nishu, Nishu; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Kumar, Arun; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Sharma, Varun; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dey, Sourav; Dutta, Suchandra; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukherjee, Swagata; Mukhopadhyay, Supratik; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Abdulsalam, Abdulla; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Banerjee, Sudeshna; Bhowmik, Sandeep; Chatterjee, Rajdeep Mohan; Dewanjee, Ram Krishna; Dugad, Shashikant; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Mahakud, Bibhuprasad; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mitra, Soureek; Mohanty, Gagan Bihari; Parida, Bibhuti; Sarkar, Tanmay; Sudhakar, Katta; Sur, Nairit; Sutar, Bajrang; Wickramage, Nadeesha; Sharma, Seema; Bakhshiansohi, Hamed; Behnamian, Hadi; Etesami, Seyed Mohsen; Fahim, Ali; Goldouzian, Reza; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Caputo, Claudio; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Calvelli, Valerio; Ferro, Fabrizio; Lo Vetere, Maurizio; Monge, Maria Roberta; Robutti, Enrico; Tosi, Silvano; Brianza, Luca; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Gerosa, Raffaele; Ghezzi, Alessio; Govoni, Pietro; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Esposito, Marco; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lanza, Giuseppe; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Bacchetta, Nicola; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; Dall'Osso, Martino; Fanzago, Federica; Gasparini, Fabrizio; Gasparini, Ugo; Gonella, Franco; Gozzelino, Andrea; Kanishchev, Konstantin; Margoni, Martino; Maron, Gaetano; Meneguzzo, Anna Teresa; Montecassiano, Fabio; Passaseo, Marina; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Zanetti, Marco; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fedi, Giacomo; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Gelli, Simone; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Micheli, Francesco; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Traczyk, Piotr; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Dughera, Giovanni; Finco, Linda; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Musich, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Schizzi, Andrea; Umer, Tomo; Zanetti, Anna; Chang, Sunghyun; Kropivnitskaya, Anna; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Sakharov, Alexandre; Son, Dong-Chul; Brochero Cifuentes, Javier Andres; Kim, Hyunsoo; Kim, Tae Jeong; Ryu, Min Sang; Song, Sanghyeon; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Yongsun; Lee, Byounghoon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Park, Sung Keun; Roh, Youn; Yoo, Hwi Dong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Donghyun; Kwon, Eunhyang; Lee, Jongseok; Yu, Intae; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Casimiro Linares, Edgar; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Hernandez-Almada, Alberto; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Carpinteyro, Severiano; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Reucroft, Steve; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khan, Wajid Ali; Khurshid, Taimoor; Shoaib, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Leonardo, Nuno; Lloret Iglesias, Lara; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Vischia, Pietro; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Konoplyanikov, Viktor; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Vlasov, Evgueni; Zhokin, Alexander; Bylinkin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Myagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Ekmedzic, Marko; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Navarro De Martino, Eduardo; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Palencia Cortezon, Enrique; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Castiñeiras De Saa, Juan Ramon; De Castro Manzano, Pablo; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Graziano, Alberto; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Benaglia, Andrea; Bendavid, Joshua; Benhabib, Lamia; Benitez, Jose F; Berruti, Gaia Maria; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Di Marco, Emanuele; Dobson, Marc; Dordevic, Milos; Du Pree, Tristan; Dupont, Niels; Elliott-Peisert, Anna; Eugster, Jürg; Franzoni, Giovanni; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Glege, Frank; Guida, Roberto; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Hansen, Magnus; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kirschenmann, Henning; Kortelainen, Matti J; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Nemallapudi, Mythra Varun; Neugebauer, Hannes; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Piparo, Danilo; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ruan, Manqi; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Sharma, Archana; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Steggemann, Jan; Stieger, Benjamin; Stoye, Markus; Takahashi, Yuta; Treille, Daniel; Tsirou, Andromachi; Veres, Gabor Istvan; Wardle, Nicholas; Wöhri, Hermine Katharina; Zagoździńska, Agnieszka; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Buchmann, Marco-Andrea; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eller, Philipp; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Lustermann, Werner; Mangano, Boris; Marini, Andrea Carlo; Marionneau, Matthieu; Martinez Ruiz del Arbol, Pablo; Masciovecchio, Mario; Meister, Daniel; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrozzi, Luca; Peruzzi, Marco; Quittnat, Milena; Rossini, Marco; Starodumov, Andrei; Takahashi, Maiko; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Wallny, Rainer; Weber, Hannsjoerg Artur; Aarrestad, Thea Klaeboe; Amsler, Claude; Caminada, Lea; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Galloni, Camilla; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Ngadiuba, Jennifer; Pinna, Deborah; Robmann, Peter; Ronga, Frederic Jean; Salerno, Daniel; Taroni, Silvia; Yang, Yong; Cardaci, Marco; Chang, Chiu-ping; Chen, Kuan-Hsin; Doan, Thi Hien; Ferro, Cristina; Konyushikhin, Maxim; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Volpe, Roberta; Yu, Shin-Shan; Bartek, Rachel; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Fiori, Francesco; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Miñano Moya, Mercedes; Petrakou, Eleni; Tsai, Jui-fa; Tzeng, Yeng-Ming; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Cerci, Salim; Dozen, Candan; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Tali, Bayram; Topakli, Huseyin; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Bilin, Bugra; Bilmis, Selcuk; Isildak, Bora; Karapinar, Guler; Surat, Ugur Emrah; Yalvac, Metin; Zeyrek, Mehmet; Albayrak, Elif Asli; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Yetkin, Taylan; Cankocak, Kerem; Sen, Sercan; Vardarlı, Fuat Ilkehan; Grynyov, Boris; Levchuk, Leonid; Sorokin, Pavel; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Senkin, Sergey; Smith, Dominic; Smith, Vincent J; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Thomas, Laurent; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Worm, Steven; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Bundock, Aaron; Burton, Darren; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Cripps, Nicholas; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Dunne, Patrick; Elwood, Adam; Ferguson, William; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Iles, Gregory; Karapostoli, Georgia; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Seez, Christopher; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Pastika, Nathaniel; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Gastler, Daniel; Lawson, Philip; Rankin, Dylan; Richardson, Clint; Rohlf, James; St John, Jason; Sulak, Lawrence; Zou, David; Alimena, Juliette; Berry, Edmund; Bhattacharya, Saptaparna; Cutts, David; Dhingra, Nitish; Ferapontov, Alexey; Garabedian, Alex; Heintz, Ulrich; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Sagir, Sinan; Sinthuprasith, Tutanon; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Ko, Winston; Lander, Richard; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Rakness, Gregory; Saltzberg, David; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Ivova PANEVA, Mirena; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Olmedo Negrete, Manuel; Shrinivas, Amithabh; Wei, Hua; Wimpenny, Stephen; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; D'Agnolo, Raffaele Tito; Holzner, André; Kelley, Ryan; Klein, Daniel; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Welke, Charles; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Barge, Derek; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Incandela, Joe; Justus, Christopher; Mccoll, Nickolas; Mullin, Sam Daniel; Richman, Jeffrey; Stuart, David; Suarez, Indara; To, Wing; West, Christopher; Yoo, Jaehyeok; Anderson, Dustin; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Pierini, Maurizio; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhu, Ren-Yuan; Azzolini, Virginia; Calamba, Aristotle; Carlson, Benjamin; Ferguson, Thomas; Iiyama, Yutaro; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Gaz, Alessandro; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Mulholland, Troy; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Eggert, Nicholas; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Sun, Werner; Tan, Shao Min; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Wittich, Peter; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Hu, Zhen; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Jung, Andreas Werner; Klima, Boaz; Kreis, Benjamin; Kwan, Simon; Lammel, Stephan; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mishra, Kalanand; Mrenna, Stephen; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Whitbeck, Andrew; Yang, Fan; Yin, Hang; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Carnes, Andrew; Carver, Matthew; Curry, David; Das, Souvik; Di Giovanni, Gian Piero; Field, Richard D; Fisher, Matthew; Furic, Ivan-Kresimir; Hugon, Justin; Konigsberg, Jacobo; Korytov, Andrey; Low, Jia Fu; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Rank, Douglas; Rossin, Roberto; Shchutska, Lesya; Snowball, Matthew; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Jordon Rowe; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Khatiwada, Ajeeta; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Bhopatkar, Vallary; Hohlmann, Marcus; Kalakhety, Himali; Mareskas-palcek, Darren; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Kurt, Pelin; O'Brien, Christine; Sandoval Gonzalez, Irving Daniel; Silkworth, Christopher; Turner, Paul; Varelas, Nikos; Wu, Zhenbin; Zakaria, Mohammed; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tan, Ping; Tiras, Emrah; Wetzel, James; Yi, Kai; Anderson, Ian; Barnett, Bruce Arnold; Blumenfeld, Barry; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Martin, Christopher; Nash, Kevin; Osherson, Marc; Swartz, Morris; Xiao, Meng; Xin, Yongjie; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Bruner, Christopher; Gray, Julia; Kenny III, Raymond Patrick; Majumder, Devdatta; Malek, Magdalena; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Wang, Quan; Wood, Jeffrey Scott; Chakaberia, Irakli; Ivanov, Andrew; Kaadze, Ketino; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Svintradze, Irakli; Toda, Sachiko; Lange, David; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Gomez, Jaime; Hadley, Nicholas John; Jabeen, Shabnam; Kellogg, Richard G; Kolberg, Ted; Kunkle, Joshua; Lu, Ying; Mignerey, Alice; Pedro, Kevin; Shin, Young Ho; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Barbieri, Richard; Baty, Austin; Bierwagen, Katharina; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; Demiragli, Zeynep; Di Matteo, Leonardo; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Mcginn, Christopher; Mironov, Camelia; Niu, Xinmei; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Sumorok, Konstanty; Varma, Mukund; Velicanu, Dragos; Veverka, Jan; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Yang, Mingming; Zhukova, Victoria; Dahmes, Bryan; Finkel, Alexey; Gude, Alexander; Hansen, Peter; Kalafut, Sean; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Keller, Jason; Knowlton, Dan; Kravchenko, Ilya; Lazo-Flores, Jose; Meier, Frank; Monroy, Jose; Ratnikov, Fedor; Siado, Joaquin Emilo; Snow, Gregory R; Alyari, Maral; Dolen, James; George, Jimin; Godshalk, Andrew; Iashvili, Ia; Kaisen, Josh; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Zhang, Jinzhong; Hahn, Kristan Allan; Kubik, Andrew; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael Henry; Stoynev, Stoyan; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Won, Steven; Brinkerhoff, Andrew; Dev, Nabarun; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Pearson, Tessa; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Hart, Andrew; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Rodenburg, Marissa; Winer, Brian L; Wulsin, Howard Wells; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Palmer, Christopher; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Barnes, Virgil E; Benedetti, Daniele; Bortoletto, Daniela; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Kurt; Kress, Matthew; Miller, David Harry; Neumeister, Norbert; Primavera, Federica; Radburn-Smith, Benjamin Charles; Shi, Xin; Shipsey, Ian; Silvers, David; Sun, Jian; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Zablocki, Jakub; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Betchart, Burton; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Hindrichs, Otto; Khukhunaishvili, Aleko; Petrillo, Gianluca; Verzetti, Mauro; Demortier, Luc; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Foerster, Mark; Riley, Grant; Rose, Keith; Spanier, Stefan; York, Andrew; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Krutelyov, Vyacheslav; Montalvo, Roy; Mueller, Ryan; Osipenkov, Ilya; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Roe, Jeffrey; Rose, Anthony; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Undleeb, Sonaina; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Lin, Chuanzhe; Neu, Christopher; Wolfe, Evan; Wood, John; Xia, Fan; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Carlsmith, Duncan; Cepeda, Maria; Christian, Allison; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Friis, Evan; Gomber, Bhawna; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ross, Ian; Ruggles, Tyler; Sarangi, Tapas; Savin, Alexander; Sharma, Archana; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel
2016-02-10
A search is described for a Higgs boson decaying into two photons, one of which has an internal conversion to a muon or an electron pair ($\\ell\\ell\\gamma$). The analysis is performed using proton-proton collision data recorded with the CMS detector at the LHC at a centre-of-mass energy of 8 TeV, corresponding to an integrated luminosity of 19.7 fb$^{-1}$. The events selected have an opposite-sign muon or electron pair and a high transverse momentum photon. No excess above background has been found in the three-body invariant mass range $ 120 < m_{\\ell\\ell\\gamma} < 150$ GeV, and limits have been derived for the Higgs boson production cross section times branching fraction for the decay $\\mathrm{H} \\to \\gamma^* \\gamma \\to \\ell \\ell \\gamma$, where the dilepton invariant mass is less than 20 GeV. For a Higgs boson with $m_{\\mathrm{H}} =$ 125 GeV, a 95% confidence level (CL) exclusion observed (expected) limit is 7.7 (6.4$^{+3.1}_{-2.0}$) times the standard model prediction. Additionally, an upper limit at 9...
POISONING WITH GAMMA-HYDROXYBUTYRATE, GAMMA-BUTYROLACTONE AND 1.4-BUTANDIOL
Directory of Open Access Journals (Sweden)
Miran Brvar
2002-09-01
Full Text Available Background. Gamma-hydroxybutyrate (GHB is a popular recreational drug. GHB overdose typically presents with decreased level of consciousness, miosis, bradycardia, respiratory depression and death. Typically, combativeness, confusion and vomiting occur once the patient begins to recover. Gamma-butyrolactone (GBL and 1.4-butandiol (1.4-BD are the prodrugs of GHB and have similar clinical presentation. We present the case of GHB poisoning in Ljubljana.Conclusions. Physicians should suspect GHB poisoning in young ravers who present with CNS depression. Treatment is symptomatic. There is no specific antidote. Gastric lavage is not beneficial but activated charcoal is recommended.
Multiwavelength Study of Gamma-Ray Bright Blazars
Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.
2011-01-01
We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.
Librarian driven analysis of gamma ray spectra
International Nuclear Information System (INIS)
Kondrashov, V.; Petersone, I.
2002-01-01
For a set of a priori given radionuclides extracted from a general nuclide data library, the authors use median estimates of the gamma-peak areas and estimates of their errors to produce a list of possible radionuclides matching gamma ray line(s). The identification of a given radionuclide is obtained by searching for a match with the energy information of a database. This procedure is performed in an interactive graphic mode by markers that superimpose, on the spectral data, the energy information and yields provided by a general gamma ray data library. This library of experimental data includes approximately 17,000 gamma ray energy lines related to 756 known gamma emitter radionuclides listed by the ICRP. (author)
Xie, Mengtao
Directionally solidified (D.S.) gamma(Ni)/gamma'(Ni 3A1)-delta(Ni3Nb) eutectic alloys were considered as candidate turbine blade materials. Currently, the properties of polycrystalline gamma/gamma'-delta alloys are of interest as they inherit many advantageous attributes from the D.S. gamma/gamma'-delta alloys. This thesis is therefore dedicated towards the development of a fundamental understanding of these novel eutectic alloys from several important perspectives. This thesis will first be focused on quantifying the effect of several elements. A set of Ni-Cr-Al-Nb alloy compositions with increasing levels of Cr was designed to investigate the influence of Cr on the primary phase formation, solidus and liquidus temperatures and g-d eutectic morphology. A matrix of complex gamma/gamma'-delta alloy compositions with the same (Ta+Nb) content but varying Ta/Nb ratios was designed to study the influence of Ta on elemental segregation and solid state partitioning behaviors. Thermodynamic predicaitons using the Computherm Pandat database (PanNi7) were compared to experimental results in these investigations. The second part of this thesis will provide a more general understanding of the effects of common elements. A large number of experimental alloys covering a broad range of compositions were selected for the analysis. Important alloy attributes were characterized as a function of element concentration. Linear regression analysis was performed to reveal the relative effectiveness of different elements. An extensive comparison between the experimental observations and Pandat predictions was provided to critically evaluate the strength and weakness of existing thermodynamic database model in this novel alloy system. The last part of this thesis emphasizes the development of cast and wrought processes for cast gamma/gamma'-delta alloys as a cost effective alternative to the powder metallurgy route. Hot rolling of workpieces encapsulated within a steel can was performed on
Electron-gamma directional correlations; Correlations directionnelles electron-gamma
Energy Technology Data Exchange (ETDEWEB)
Gerholm, T R [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)
1966-10-01
The theory of the angular correlation between conversion electrons and gamma rays is briefly outlined. The experimental methods used for the study of the electron-gamma correlation are described. The effects of the formation of a hole and the hyperfine structure magnetic coupling dependent on time are then considered. The experimental results showed that the attenuations found for different metallic media plainly conform to a simple quadrupolar interaction mechanism. For a source surrounded by an insulator, however, the results show that a rapidly disappearing coupling occurs as a supplement to the quadrupolar interaction mechanism. This coupling attenuates the angular correlation by about 75% of the non-perturbed value. It was concluded that for an intermediate half life of the level of the order of the nanosecond, the attenuations produced by the secondary effects of the hole formation can not be completely neglected. The metallic media considered were Ag, Au, Al, and Ga. In the study of E2 conversion processes, the radical matrix elements governing the E2 conversion process in the 412-KeV transition of {sup 198}Hg were determined. The results exclude the presence of dynamic contributions within the limits of experimental error. The values b{sub 2} (E2) and {alpha}-k (E2) obtained indirectly from the experimentally determined b{sub 4} particle parameter are in complete agreement with the theoretical values obtained by applying the corrections due to the shielding effect and to the finite dimension of the nucleus and excluding the dynamic contributions. The value for the internal conversion coefficient was also in good agreement. Experimental results from the intensity ratios between the peak and the continuum, however, seem to show significant deviations with respect to other experimental and theoretical values. There is good agreement between experimental and theoretical results on the internal conversion of {sup 203}Tl, {sup 201}Tl, and {sup 181}Ta. The theory
Directory of Open Access Journals (Sweden)
Sabes-Figuera Ramon
2012-08-01
Full Text Available Abstract Background Fatigue is common and has been shown to result in high economic costs to society. The aim of this study is to compare the cost-effectiveness of two active therapies, graded-exercise (GET and counselling (COUN with usual care plus a self-help booklet (BUC for people presenting with chronic fatigue. Methods A randomised controlled trial was conducted with participants consulting for fatigue of over three months’ duration recruited from 31 general practices in South East England and allocated to one of three arms. Outcomes and use of services were assessed at 6-month follow-up. The main outcome measure used in the economic evaluation was clinically significant improvements in fatigue, measured using the Chalder fatigue scale. Cost-effectiveness was assessed using the net-benefit approach and cost-effectiveness acceptability curves. Results Full economic and outcome data at six months were available for 163 participants; GET = 51, COUN = 58 and BUC = 54. Those receiving the active therapies (GET and COUN had more contacts with care professionals and therefore higher costs, these differences being statistically significant. COUN was more expensive and less effective than the other two therapies. The incremental cost-effectiveness ratio of GET compared to BUC was equal to £987 per unit of clinically significant improvement. However, there was much uncertainty around this result. Conclusion This study does not provide a clear recommendation about which therapeutic option to adopt, based on efficiency, for patients with chronic fatigue. It suggests that COUN is not cost-effective, but it is unclear whether GET represents value for money compared to BUC. Clinical Trial Registration number at ISRCTN register: 72136156
Bone scintigraphy on chronic hemodialyzed patients
International Nuclear Information System (INIS)
Koizumi, Yoshiko
1990-01-01
Patients with renal osteodystrophy (ROD) are classified into four types (secondary hyperparathyroidism: HPT, osteomalasia, ectopic calcification and normal bone scintigram type) according to findings of whole body bone scintigrams. Markedly high accumulations of Tc-99m-MDP are seen in the skull, especially in patients with HPT. For a quantitative evaluation of bone mineral dynamics, factor analysis (FA) was performed on bone scintigraphy in 36 patients with ROD and in 17 controls. Four were examined before and after parathyroidectomy (PTX). In the early phase (20 min) of bone scintigraphy, the bone factor was clearly extracted by FA. Two original parameters were calculated, one is bone radionuclide (RN) uptake count (BUC), the product of the total RN uptake count of the head and the contribution ratio, the other is bone RN uptake count ratio (BUR) derived by the time activity curve (physiological component of bone) of FA. Bone factor shown by FA is significantly different among patients with HPT, osteomalasia and controls. The value of BUC in patients with HPT is high compared to findings in the controls. The results of FA of ROD correlate well with planar images of bone scintigrams and with data on bone minerals, measured by quantitative methods such as single photon absorptiometry, CT attenuation number of the frontal bone, RN activity ratio ([frontal bone]/[brain]), using SPECT of bone scan. In the cases of PTX, the value of BUC was improved compared to preoperative data. FA of bone scintigraphy is a sensitive and useful method for quantitative evaluation of bone mineral dynamics and to assess the therapeutic effects in ROD. (author)
Energy Technology Data Exchange (ETDEWEB)
Esmaeili-sani, Vahid, E-mail: vaheed_esmaeely80@yahoo.com [Department of Nuclear Engineering and Physics, Amirkabir University of Technology, P.O. Box 4155-4494, Tehran (Iran, Islamic Republic of); Moussavi-zarandi, Ali; Boghrati, Behzad; Afarideh, Hossein [Department of Nuclear Engineering and Physics, Amirkabir University of Technology, P.O. Box 4155-4494, Tehran (Iran, Islamic Republic of)
2012-02-01
Geophysical bore-hole data represent the physical properties of rocks, such as density and formation lithology, as a function of depth in a well. Properties of rocks are obtained from gamma ray transport logs. Transport of gamma rays, from a {sup 137}Cs point gamma source situated in a bore-hole tool, through rock media to detectors, has been simulated using a GEANT4 radiation transport code. The advanced Compton scattering concepts were used to gain better analyses about well formation. The simulation and understanding of advanced Compton scattering highly depends on how accurately the effects of Doppler broadening and Rayleigh scattering are taken into account. A Monte Carlo package that simulates the gamma-gamma well logging tools based on GEANT4 advanced low energy Compton scattering (GALECS).
Device for gamma-chamber transducer alignment
International Nuclear Information System (INIS)
Mirkhodzhaev, A.Kh.; Kuznetsov, N.K.; Ostryj, Yu.E.
1987-01-01
The device consists of the upper part of the gamma chamber pilar to which a rod is rigidly fastened with a disk of acrylic plastic moving freely on the opposite end. The disk is placed coaxially and is equal to the gamma chamber detector crystal. The device makes it possible to use ordinary medical couches covered with a porolone mattress when the gamma chamber detector is placed below
Gamma-Gompertz life expectancy at birth
Trifon I. Missov
2013-01-01
BACKGROUND The gamma-Gompertz multiplicative frailty model is the most common parametric modelapplied to human mortality data at adult and old ages. The resulting life expectancy hasbeen calculated so far only numerically. OBJECTIVE Properties of the gamma-Gompertz distribution have not been thoroughly studied. The focusof the paper is to shed light onto its first moment or, demographically speaking, characterizelife expectancy resulting from a gamma-Gompertz force of mortality. The paperprov...
Energy Technology Data Exchange (ETDEWEB)
Vidal-Sicart, Sergi; Paredes, Pilar [Hospital Clinic Barcelona, Nuclear Medicine Department (CDIC), Barcelona (Spain); Institut d' Investigacio Biomedica Agusti Pi Sunyer (IDIBAPS), Barcelona (Spain); Vermeeren, Lenka; Valdes-Olmos, Renato A. [Netherlands Cancer Institute-Antoni van Leeuwenhoek Hospital (NKI-AVL), Nuclear Medicine Department, Amsterdam (Netherlands); Sola, Oriol [Hospital Clinic Barcelona, Nuclear Medicine Department (CDIC), Barcelona (Spain)
2011-04-15
Planar lymphoscintigraphy is routinely used for preoperative sentinel node visualization, but large gamma cameras are not always available. We evaluated the reproducibility of lymphatic mapping with a smaller and portable gamma camera. In two centres, 52 patients with breast cancer received preoperative lymphoscintigraphy with a conventional gamma camera with a field of view of 40 x 40 cm. Static anterior and lateral images were performed at 15 min, 2 h and 4 h after injection of the radiotracer ({sup 99m}Tc-nanocolloid). At 2 h after injection, anterior and oblique images were also performed with a portable gamma camera (Sentinella, Oncovision) positioned to obtain a field of view of 20 x 20 cm. Visualization of lymphatic drainage on conventional images and images with the portable device were compared for number of nodes depicted, their intensity and localization of sentinel nodes. The images performed with the conventional gamma camera depicted sentinel nodes in 94%, while the portable gamma camera showed drainage in 73%. There was however no significant difference in visualization between the two devices when a lead shield was used to mask the injection area in 43 patients (95 vs 88%, p = 0.25). Second-echelon nodes were visualized in 62% of the patients with the conventional gamma camera and in 29% of the cases with the portable gamma camera. Preoperative imaging with a portable gamma camera fitted with a pinhole collimator to obtain a field of view of 20 x 20 cm is able to depict sentinel nodes in 88% of the cases, if a lead shield is used to mask the injection site. This device may be useful in centres without the possibility to perform a preoperative image. (orig.)
International Nuclear Information System (INIS)
Vidal-Sicart, Sergi; Paredes, Pilar; Vermeeren, Lenka; Valdes-Olmos, Renato A.; Sola, Oriol
2011-01-01
Planar lymphoscintigraphy is routinely used for preoperative sentinel node visualization, but large gamma cameras are not always available. We evaluated the reproducibility of lymphatic mapping with a smaller and portable gamma camera. In two centres, 52 patients with breast cancer received preoperative lymphoscintigraphy with a conventional gamma camera with a field of view of 40 x 40 cm. Static anterior and lateral images were performed at 15 min, 2 h and 4 h after injection of the radiotracer ( 99m Tc-nanocolloid). At 2 h after injection, anterior and oblique images were also performed with a portable gamma camera (Sentinella, Oncovision) positioned to obtain a field of view of 20 x 20 cm. Visualization of lymphatic drainage on conventional images and images with the portable device were compared for number of nodes depicted, their intensity and localization of sentinel nodes. The images performed with the conventional gamma camera depicted sentinel nodes in 94%, while the portable gamma camera showed drainage in 73%. There was however no significant difference in visualization between the two devices when a lead shield was used to mask the injection area in 43 patients (95 vs 88%, p = 0.25). Second-echelon nodes were visualized in 62% of the patients with the conventional gamma camera and in 29% of the cases with the portable gamma camera. Preoperative imaging with a portable gamma camera fitted with a pinhole collimator to obtain a field of view of 20 x 20 cm is able to depict sentinel nodes in 88% of the cases, if a lead shield is used to mask the injection site. This device may be useful in centres without the possibility to perform a preoperative image. (orig.)
Ma, Wenxiu; Zou, Lifang; Ji, Zhiyuan; Xu, Xiameng; Xu, Zhengyin; Yang, Yangyang; Alfano, James R; Chen, Gongyou
2018-04-28
Xanthomonas oryzae pv. oryzae (Xoo), causal agent of bacterial blight (BB) of rice, uses transcription activator-like effectors (TALEs) to interact with the basal transcription factor gama subunit OsTFIIAγ5 (Xa5) and activates transcription of host genes. However, how OsTFIIAγ1, the other OsTFIIAγ protein, functions in the presence of TALEs remains unclear. In this study, we show that OsTFIIAγ1 plays a compensatory role in the absence of Xa5. The expression of OsTFIIAγ1, which is activated by TALE PthXo7, increased the expression of host genes targeted by avirulent and virulent TALEs. Defective OsTFIIAγ1 rice lines showed reduced expression of the TALE-targeted susceptibility (S) genes, OsSWEET11 and OsSWEET14, which resulted in increased BB resistance. Selected TALEs (PthXo1, AvrXa7, and AvrXa27) were evaluated for interactions with OsTFIIAγ1, Xa5 and xa5 (naturally-occurring mutant form of Xa5) using biomolecular fluorescence complementation (BiFC) and microscale thermophoresis (MST). BiFC and MST demonstrated that the three TALEs bind Xa5 and OsTFIIAγ1 with a stronger affinity than xa5. These results provide insight into the complex roles of OsTFIIAγ1 and OsTFIIAγ5 in TALE-mediated host gene transcription. This article is protected by copyright. All rights reserved. © 2018 BSPP and John Wiley & Sons Ltd.
Yamamoto, Daisuke S; Sumitani, Megumi; Hatakeyama, Masatsugu; Matsuoka, Hiroyuki
2018-02-01
Anopheline mosquitoes are major vectors of malaria parasites. When the gametocytes of the malaria parasite are transferred from a vertebrate to mosquitoes, they differentiate into gametes, and are fertilized in the midguts of mosquitoes. Xanthurenic acid (XA), a waste product of the ommochrome synthesis pathway, has been shown to induce exflagellation during microgametogenesis in vitro; however, it currently remains unclear whether endogenous XA affects the infectivity of anopheline mosquitoes to malaria parasites in vivo due to the lack of appropriate experimental systems such as a XA-deficient line. In the present study, we produced a XA-deficient line in Anopheles stephensi using transcription activator-like effector nuclease (TALEN)-mediated gene targeting (knockout) of the kynurenine 3-monooxygenase (kmo) gene, which encodes an enzyme that participates in the ommochrome synthesis pathway. The knockout of kmo resulted in the absence of XA, and oocyst formation was inhibited in the midguts of these XA-deficient mosquitoes, which, in turn, reduced sporozoite numbers in their salivary glands. These results suggest that endogenous XA stimulates exflagellation, and enhances the infectivity of anopheline mosquitoes to malaria parasites in vivo. The XA-deficient line of the anopheline mosquito provides a useful system for analyzing and understanding the associated factors of malaria gametogenesis in the mosquito midgut.
Directory of Open Access Journals (Sweden)
Carmine Vecchione
2017-05-01
Full Text Available The kynurenine pathway of tryptophan metabolism is activated by pro-inflammatory cytokines. L-kynurenine, an upstream metabolite of the pathway, acts as a putative endothelium-derived relaxing factor, and has been hypothesized to play a causative role in the pathophysiology of inflammation-induced hypotension. Here, we show that xanthurenic acid (XA, the transamination product of 3-hydroxykynurenine, is more efficacious than L-kynurenine in causing relaxation of a resistance artery, but fails to relax pre-contracted aortic rings. In the mesenteric artery, XA enhanced activating phosphorylation of endothelial nitric oxide synthase (NOS, and the relaxing action of XA was abrogated by pharmacological inhibition of NOS and endothelial-derived hyperpolarizing factor. Systemic injection of XA reduced blood pressure in mice, and serum levels of XA increased by several fold in response to a pulse with the endotoxin, lipopolysaccharide (LPS. LPS-induced hypotension in mice was prevented by pre-treatment with the kynurenine monooxygenase (KMO inhibitor, Ro-618048, which lowered serum levels of XA but enhanced serum levels of L-kynurenine. UPF 648, another KMO inhibitor, could also abrogate LPS-induced hypotension. Our data identify XA as a novel vasoactive compound and suggest that formation of XA is a key event in the pathophysiology of inflammation-induced hypotension.
The gamma contamination food factor
International Nuclear Information System (INIS)
Kukoc, A.H.; Anicin, I.V.; Adzic, P.R.
1992-01-01
We suggest that radioactive food contamination, as determined solely by a quantitative gamma-ray spectroscopic measurement, may, apart from the total activity per unit mass, be for quick reference conveniently characterized by another single figure which we call the ''Gamma Contamination Food Factor'' (GCFF). This factor may be defined as the ratio of the total specific activity of gamma-ray-emitting radionuclides in the food sample (except that of 40 K) to the specific activity of 40 K either in the sample itself or in an ''average man''. We discuss briefly the meaning and advantages of these definitions. (author)
International Nuclear Information System (INIS)
Wilson, G.V.H.; George, E.P.; Hora, H.
1976-01-01
A method is described for controlling the emission and direction of gamma rays from excited nuclei contained in a sample source of suitable geometry having its major axis parallel to the proposed direction of gamma ray emission, comprising subjecting said sample source to thermal or dynamic polarization at temperatures approaching absolute zero in the presence of a strong magnetic field, and when a pulse of coherent gamma radiation is required along said major axis rotating the active nuclei through 90 0 by employing a short pulse of radio frequency oscillations in an auxilliary coil around the sample source
International Nuclear Information System (INIS)
Cesarsky, C.; Cesarsky, J.P.
1986-01-01
This article overviews the gamma astronomy research. Sources already observed, and what causes to give to them; the galactic radiation and its interpretation; techniques already used and current projects [fr
Sterilization plants equipped with the isotopic gamma radiation sources
International Nuclear Information System (INIS)
Mehta, K.; Chmielewski, A.G.
2007-01-01
Presentation describes different isotopic gamma radiation sources applicable for sterilization of food and medical materials. Certain gamma pallet irradiators, mini gamma irradiators and different scale gamma tote irradiators are presented. It is concluded, that about two hundreds plants with gamma radiation sources operates in different countries. However, industrially developed countries must construct much more plants than operates now
Prospects of squark and slepton searches at a gamma-gamma collider
International Nuclear Information System (INIS)
Choudhury, Debajyoti; Datta, Anindya
2001-01-01
We examine the prospects of detecting sfermions at a gamma-gamma collider. Once produced, a slepton can decay into a pair of quarks (jets) through R-parity violating interactions. Similarly, a squark may decay into a lepton-quark pair. Analyzing the corresponding Standard Model backgrounds, namely 4-jet and dilepton plus dijet final states respectively, we show that the sfermion can be detected almost right upto the kinematic limit and its mass determined to a fair degree of accuracy. Similar statements also hold for nonsupersymmetric leptoquarks and diquarks
International Nuclear Information System (INIS)
Artsybashev, V.A.; Volkov, A.A.
1981-01-01
Experimental and calculated data on the effect of intermediate zone on results of gamma-gamma and X-ray spectrum logging of quarry wells at chalcopyrite deposits are presented. The measurements have been carried out using 57 Co and 109 Cd sources for intermediate zone represented by water, air and mud. Requirements for technical conditions of wells have been formulated. According to the requirements the application of gamma- gamma method is possible when the thickness of the intermediate zone does not exceed several millimetres and that of X-ray spectrum method - when the thickness does not exceed several hundredths of a millimetre [ru
Cosmic gamma-ray background radiation. Current understandings and problems
International Nuclear Information System (INIS)
Inoue, Yoshiyuki
2015-01-01
The cosmic gamma-ray background radiation is one of the most fundamental observables in the gamma-ray band. Although the origin of the cosmic gamma-ray background radiation has been a mystery for a long time, the Fermi gamma-ray space telescope has recently measured it at 0.1-820 GeV and revealed that the cosmic GeV gamma-ray background is composed of blazars, radio galaxies, and star-forming galaxies. However, Fermi still leaves the following questions. Those are dark matter contribution, origins of the cosmic MeV gamma-ray background, and the connection to the IceCube TeV-PeV neutrino events. In this proceeding, I will review the current understandings of the cosmic gamma-ray background and discuss future prospects of cosmic gamma-ray background radiation studies. (author)
Energy Technology Data Exchange (ETDEWEB)
Kim, Jaehun; Sung, Nakyun; Kim, Jeongsoo; Jo, Euri; Choi, Jongil; Park, Jongheum; Lee, Juwoon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Lee, Kwangwon [Eulji Univ. Hospital, Daejeon (Korea, Republic of); Kwon, Jungkee [Chonbuk National Univ., Jeonju (Korea, Republic of); Kim, Taewoon [Jeonbuk Technopark, Jeonju (Korea, Republic of)
2012-03-15
This study was to determine the prevention effect of poly-gamma-glutamic acid (PGA) on tissue damage induced by gamma irradiation for development of xenograft. PGA (MW 2000 kDa) extracted from permeated soy bean (natto) was used in this study as natural compound, and glutaraldehyde (GA) and 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) were used as a control, chemical based cross-linking agents. GA, EDC and PGA treated porcine tendons were gamma-irradiated at the dose of 30 kGy. Prevention effects against tissue damage were measured as the result of tensile strength, hydroxyproline contents and tissue morphological analysis. Tensile of porcine tendon was remarkably decreased by gamma irradiation, but increased in PGA treated group. Morphological analysis showed that collagen structure was broken by gamma irradiation, but attenuated by PGA treatment. Base on the results, it demonstrated that gamma irradiation can induce severe alteration of porcine tendon, but PGA can effectively improve the tissue damage.
International Nuclear Information System (INIS)
Kim, Jaehun; Sung, Nakyun; Kim, Jeongsoo; Jo, Euri; Choi, Jongil; Park, Jongheum; Lee, Juwoon; Lee, Kwangwon; Kwon, Jungkee; Kim, Taewoon
2012-01-01
This study was to determine the prevention effect of poly-gamma-glutamic acid (PGA) on tissue damage induced by gamma irradiation for development of xenograft. PGA (MW 2000 kDa) extracted from permeated soy bean (natto) was used in this study as natural compound, and glutaraldehyde (GA) and 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) were used as a control, chemical based cross-linking agents. GA, EDC and PGA treated porcine tendons were gamma-irradiated at the dose of 30 kGy. Prevention effects against tissue damage were measured as the result of tensile strength, hydroxyproline contents and tissue morphological analysis. Tensile of porcine tendon was remarkably decreased by gamma irradiation, but increased in PGA treated group. Morphological analysis showed that collagen structure was broken by gamma irradiation, but attenuated by PGA treatment. Base on the results, it demonstrated that gamma irradiation can induce severe alteration of porcine tendon, but PGA can effectively improve the tissue damage
gamma. -ray. Present status and problems
Energy Technology Data Exchange (ETDEWEB)
Okudaira, K [Rikkyo Univ., Tokyo (Japan). Faculty of Science
1975-01-01
As ..gamma..-ray advances straightly through space, the study on cosmic ..gamma..-ray will give the information concerning the origin directly. However, the intensity is weak, and the avoidance of background is a serious problem. The wide-spread components were studied by OSO-3. The intensity of the galactic disc component around 100 MeV was reported as (3.4+-1.0)x10/sup -5/ photons (cm/sup 2/, radian, sec)/sup -1/ by OSO-3 and 0.2x10/sup -4/ photons (cm/sup 2/, radian sec)/sup -1/ by SAS-2, and corresponds to the calculated ..gamma.. yield from ..pi../sup 0/. The strong disc component, so-called galactic center region, has been observed, and is due to the mixture of ..gamma..-ray from ..pi../sup 0/ and inverse Compton ..gamma..-ray. A peak at 476+-24 KeV was found as well as the continuous component. Special care must be taken for the observation of isotropic component, since it is hardly distinguished from the background. It is considered that the isotropic component is due to the inverse Compton scattering of 3/sup 0/K radiation in super-galactic space and the contribution from outer galaxy. The nearest point source of ..gamma..-ray is the sun. Among the other point sources, the crab nebula is the most reliable one. The energy flux of pulse component showed the spectrum of E/sup -1/. ..gamma..-ray bursts were observed by man-made satellites Vela-5 and 6. Theoretical explanation is still incomplete regarding the bursts. (Kato, T.).
Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels
Benkhelifa, Fatma; Alouini, Mohamed-Slim; Rezki, Zouheir
2013-01-01
free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-o ff power control scheme.
A Search for High Mass Photon Pairs in $p\\bar{p} \\to \\gamma\\gamma jj$ Events at 1.8-TeV
Energy Technology Data Exchange (ETDEWEB)
Lauer, Bryan Adrian [Iowa State U.
1997-01-01
A search for new physics in the channel $p\\bar{p} \\to \\gamma\\gamma jj$ has been carried out. In some extended Higgs models, a light neutral scalar Higgs boson is produced with suppressed couplings to fermions and standard model(SM) strength couplings to vector bosons(bosonic Higgs), thus enhancing the $H \\to \\gamma\\gamma$ channel....
Energy Technology Data Exchange (ETDEWEB)
Baek, Sang Yeol; Park, Dae Kyu; Ahn, Sang Bok; Ju, Yong Sun; Jeon, Yong Bum
1997-06-01
The gamma scanning system which is installed in IMEF is the equipment obtaining the gamma ray spectrum from irradiated fuels. This equipment could afford the useful data relating spent fuels like as burn-up measurements. We describe the specifications of the equipment and its accessories, and also described its operation procedure so that an operator can use this report as the operation procedure. (author). 1 tab., 11 figs., 11 refs.
International Nuclear Information System (INIS)
Baek, Sang Yeol; Park, Dae Kyu; Ahn, Sang Bok; Ju, Yong Sun; Jeon, Yong Bum.
1997-06-01
The gamma scanning system which is installed in IMEF is the equipment obtaining the gamma ray spectrum from irradiated fuels. This equipment could afford the useful data relating spent fuels like as burn-up measurements. We describe the specifications of the equipment and its accessories, and also described its operation procedure so that an operator can use this report as the operation procedure. (author). 1 tab., 11 figs., 11 refs
Gamma ray astronomy and the COS-B satellite
International Nuclear Information System (INIS)
Cesarsky, C.J.; Paul, J.A.
1984-01-01
The European satellite COS-B, operating in space for almost seven years, has produced a full chart of the sky in gamma radiation. This chart is discussed in detail, as well as gamma astronomy, high energy photons, gamma photons, strange stars, young pulsars, stars seething with activity and quasar 3C273. Other gamma astronomy programmes are briefly mentioned. (U.K.)
Drawing of uranium in {gamma} phase; Filage de l'uranium en phase gamma
Energy Technology Data Exchange (ETDEWEB)
Stohr, J A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Chevigny, R [Conpagnie, Pechiney, 73 - Chambery (France)
1955-07-01
It describes the study of working and drawing of uranium in {gamma} phase. In a first part, the forgeable characteristics of uranium metal in the three different phases ({alpha}, {beta} and {gamma}) are compared by using BASTIEN-PORTEVIN method. The different experiments are testing the behaviour metal in each phase under different stresses and a temperature gradient as slow and shock traction, slow and shock compression, resilience, flexibility. Results show that optimum conditions for uranium drawing is uranium in phase {gamma}. In a second part, it described the drawing method and process. The uranium rods obtained by this technique are of very good quality. In addition, the material wear is very low which permits a low production cost. Finally, the uranium rod physical properties are studied. (M.P.)
Local gamma ray events as tests of the antimatter theory of gamma ray bursts
International Nuclear Information System (INIS)
Sofia, S.; Wilson, R.E.
1976-01-01
Nearby examples of the antimatter 'chunks' postulated by Sofia and Van Horn to explain the cosmic gamma ray bursts may produce detectable gamma ray events when struck by solar system meteoroids. These events would have a much shorter time scale and higher energy spectrum than the bursts already observed. In order to have a reasonably high event rate, the local meteoroid population must extend to a distance from the Sun of the order of 0.1 pc, but the required distance could become much lower if the instrumental threshold is improved. The expected gamma ray flux for interaction of the antimatter bodies with the solar wind is also examined, and found to be far below present instrumental capabilities. (Auth.)
X-ray echoes from gamma-ray bursts
International Nuclear Information System (INIS)
Dermer, C.D.; Hurley, K.C.; Hartmann, D.H.
1991-01-01
The identification of an echo of reflected radiation in time histories of gamma-ray burst spectra can provide important information about the existence of binary companions or accretion disks in gamma-ray burst systems. Because of the nature of Compton scattering, the spectrum of the echo will be attenuated at gamma-ray energies compared with the spectrum of the primary burst emission. The expected temporal and spectral signatures of the echo and a search for such echoes are described, and implications for gamma-ray burst models are discussed. 35 refs
Strength of Gamma Rhythm Depends on Normalization
Ray, Supratim; Ni, Amy M.; Maunsell, John H. R.
2013-01-01
Neuronal assemblies often exhibit stimulus-induced rhythmic activity in the gamma range (30–80 Hz), whose magnitude depends on the attentional load. This has led to the suggestion that gamma rhythms form dynamic communication channels across cortical areas processing the features of behaviorally relevant stimuli. Recently, attention has been linked to a normalization mechanism, in which the response of a neuron is suppressed (normalized) by the overall activity of a large pool of neighboring neurons. In this model, attention increases the excitatory drive received by the neuron, which in turn also increases the strength of normalization, thereby changing the balance of excitation and inhibition. Recent studies have shown that gamma power also depends on such excitatory–inhibitory interactions. Could modulation in gamma power during an attention task be a reflection of the changes in the underlying excitation–inhibition interactions? By manipulating the normalization strength independent of attentional load in macaque monkeys, we show that gamma power increases with increasing normalization, even when the attentional load is fixed. Further, manipulations of attention that increase normalization increase gamma power, even when they decrease the firing rate. Thus, gamma rhythms could be a reflection of changes in the relative strengths of excitation and normalization rather than playing a functional role in communication or control. PMID:23393427
Gamma-ray burst observations: the present situation
International Nuclear Information System (INIS)
Vedrenne, G.
1984-01-01
Recent results in gamma ray burst investigations concerning the spectral variability on a short time scale, precise locations, and the discovery of optical flashes in gamma ray burst positions on archival plates are presented. The implications of optical and X-ray observations of gamma ray burst error boxes are also discussed. 72 references
Discoveries by the Fermi Gamma Ray Space Telescope
Gehrels, Neil
2011-01-01
Fermi is a large space gamma-ray mission developed by NASA and the DOE with major contributions from France, Germany, Italy, Japan and Sweden. It was launched in June 2008 and has been performing flawlessly since then. The main instrument is the Large Area Telescope (LAT) operating in the 20 MeV to 300 GeV range and a smaller monitor instrument is the Gamma-ray Burst Monitor (GBM) operating in the 8 keV to 40 MeV range. New findings are occurring every week. Some of the key discoveries are: 1) Discovery of many new gamma-ray pulsars, including gamma-ray only and millisecond pulsars. 2) Detection of high energy gamma-ray emission from globular clusters, most likely due to summed emission from msec pulsars. 3) Discovery of delayed and extended high energy gamma-ray emission from short and long gamma-ray busts. 4) Detection of approximately 250 gamma-ray bursts per year with the GBM instrument. 5) Most accurate measurement of the cosmic ray electron spectrum between 30 GeV and 1 TeV, showing some excess above the conventional diffusion model. The talk will present the new discoveries and their implications.
Indirect probes of the trilinear Higgs coupling: $gg \\to h$ and $h \\to \\gamma \\gamma$
Gorbahn, Martin
2016-10-18
In the framework of the Standard Model effective field theory, we examine the indirect constraints on the trilinear Higgs coupling $\\lambda$ that arise from Higgs production in gluon-gluon-fusion and diphoton Higgs decays. We calculate 2-loop contributions to the $gg \\to h$ and $h \\to \\gamma \\gamma$ amplitudes that are affected by modifications of the trilinear Higgs-boson vertex. This calculation involves both the computation of anomalous dimensions and finite matching corrections. Based on our new results, we analyse the sensitivity of present and future measurements of the $hgg$ and $h \\gamma \\gamma$ couplings to shifts in $\\lambda$. Under the assumption that $O_6 = - \\lambda \\left (H^\\dagger H \\right )^3$ is the only dimension-6 operator that alters the trilinear Higgs interactions, we find that at present the considered loop-level probes provide stronger constraints than $pp \\to 2h$. At future high-energy colliders indirect ${\\cal O} (5)$ determinations of the trilinear Higgs coupling may be possible, ma...
High-energy gamma-ray emission in compact binaries
International Nuclear Information System (INIS)
Cerutti, Benoit
2010-01-01
Four gamma-ray sources have been associated with binary systems in our Galaxy: the micro-quasar Cygnus X-3 and the gamma-ray binaries LS I +61 degrees 303, LS 5039 and PSR B1259-63. These systems are composed of a massive companion star and a compact object of unknown nature, except in PSR B1259-63 where there is a young pulsar. I propose a comprehensive theoretical model for the high-energy gamma-ray emission and variability in gamma-ray emitting binaries. In this model, the high-energy radiation is produced by inverse Compton scattering of stellar photons on ultra-relativistic electron-positron pairs injected by a young pulsar in gamma-ray binaries and in a relativistic jet in micro-quasars. Considering anisotropic inverse Compton scattering, pair production and pair cascade emission, the TeV gamma-ray emission is well explained in LS 5039. Nevertheless, this model cannot account for the gamma-ray emission in LS I +61 degrees 303 and PSR B1259-63. Other processes should dominate in these complex systems. In Cygnus X-3, the gamma-ray radiation is convincingly reproduced by Doppler-boosted Compton emission of pairs in a relativistic jet. Gamma-ray binaries and micro-quasars provide a novel environment for the study of pulsar winds and relativistic jets at very small spatial scales. (author)
Production of modified starches by gamma irradiation
International Nuclear Information System (INIS)
Kang, Il-Jun; Byun, Myung-Woo; Yook, Hong-Sun; Bae, Chun-Ho; Lee, Hyun-Soo; Kwon, Joong-Ho; Chung, Cha-Kwon
1999-01-01
As a new processing method for the production of modified starch, gamma irradiation and four kinds of inorganic peroxides were applied to commercial corn starch. The addition of inorganic peroxides without gamma irradiation or gamma irradiation without the addition of inorganic peroxides effectively decreased initial viscosity, but did not sufficiently keep viscosity stable. The combination of adding ammonium persulfate (APS) and gamma irradiation showed the lowest initial viscosity and the best stability out of the tested four kinds of inorganic peroxides. Among the tested mixing methods of APS, soaking was found to be more effective than dry blending or spraying. Therefore, the production of modified starch with low viscosity as well as with sufficient viscosity stability became feasible by the control of gamma irradiation dose levels and the amount of added APS to starch
Gehrels, Neil; Meszaros, Peter
2012-01-01
Gamma-ray bursts (GRBs) are bright flashes of gamma-rays coming from the cosmos. They occur roughly once per day ,last typically lOs of seconds and are the most luminous events in the universe. More than three decades after their discovery, and after pioneering advances from space and ground experiments, they still remain mysterious. The launch of the Swift and Fermi satellites in 2004 and 2008 brought in a trove of qualitatively new data. In this review we survey the interplay between these recent observations and the theoretical models of the prompt GRB emission and the subsequent afterglows.
Impact of image noise on gamma index calculation
International Nuclear Information System (INIS)
Chen, M; Mo, X; Parnell, D; Olivera, G; Galmarini, D; Lu, W
2014-01-01
Purpose: The Gamma Index defines an asymmetric metric between the evaluated image and the reference image. It provides a quantitative comparison that can be used to indicate sample-wised pass/fail on the agreement of the two images. The Gamma passing/failing rate has become an important clinical evaluation tool. However, the presence of noise in the evaluated and/or reference images may change the Gamma Index, hence the passing/failing rate, and further, clinical decisions. In this work, we systematically studied the impact of the image noise on the Gamma Index calculation. Methods: We used both analytic formulation and numerical calculations in our study. The numerical calculations included simulations and clinical images. Three different noise scenarios were studied in simulations: noise in reference images only, in evaluated images only, and in both. Both white and spatially correlated noises of various magnitudes were simulated. For clinical images of various noise levels, the Gamma Index of measurement against calculation, calculation against measurement, and measurement against measurement, were evaluated. Results: Numerical calculations for both the simulation and clinical data agreed with the analytic formulations, and the clinical data agreed with the simulations. For the Gamma Index of measurement against calculation, its distribution has an increased mean and an increased standard deviation as the noise increases. On the contrary, for the Gamma index of calculation against measurement, its distribution has a decreased mean and stabilized standard deviation as the noise increases. White noise has greater impact on the Gamma Index than spatially correlated noise. Conclusions: The noise has significant impact on the Gamma Index calculation and the impact is asymmetric. The Gamma Index should be reported along with the noise levels in both reference and evaluated images. Reporting of the Gamma Index with switched roles of the images as reference and
Impact of Image Noise on Gamma Index Calculation
Chen, M.; Mo, X.; Parnell, D.; Olivera, G.; Galmarini, D.; Lu, W.
2014-03-01
Purpose: The Gamma Index defines an asymmetric metric between the evaluated image and the reference image. It provides a quantitative comparison that can be used to indicate sample-wised pass/fail on the agreement of the two images. The Gamma passing/failing rate has become an important clinical evaluation tool. However, the presence of noise in the evaluated and/or reference images may change the Gamma Index, hence the passing/failing rate, and further, clinical decisions. In this work, we systematically studied the impact of the image noise on the Gamma Index calculation. Methods: We used both analytic formulation and numerical calculations in our study. The numerical calculations included simulations and clinical images. Three different noise scenarios were studied in simulations: noise in reference images only, in evaluated images only, and in both. Both white and spatially correlated noises of various magnitudes were simulated. For clinical images of various noise levels, the Gamma Index of measurement against calculation, calculation against measurement, and measurement against measurement, were evaluated. Results: Numerical calculations for both the simulation and clinical data agreed with the analytic formulations, and the clinical data agreed with the simulations. For the Gamma Index of measurement against calculation, its distribution has an increased mean and an increased standard deviation as the noise increases. On the contrary, for the Gamma index of calculation against measurement, its distribution has a decreased mean and stabilized standard deviation as the noise increases. White noise has greater impact on the Gamma Index than spatially correlated noise. Conclusions: The noise has significant impact on the Gamma Index calculation and the impact is asymmetric. The Gamma Index should be reported along with the noise levels in both reference and evaluated images. Reporting of the Gamma Index with switched roles of the images as reference and
Energy Technology Data Exchange (ETDEWEB)
d' Enterria, David; /ICC, Barcelona U. /ICREA, Barcelona; Lansberg, Jean-Philippe; /Ecole Polytechnique, CPHT /SLAC
2010-08-26
We explore for the first time the possibilities to measure an intermediate-mass (m{sub H} = 115-140 GeV/c{sup 2}) Standard-Model Higgs boson in electromagnetic proton-lead (p Pb) interactions at the CERN Large Hadron Collider (LHC) via its b{bar b} decay. Using equivalent Weizsacker-Williams photon fluxes and Higgs effective field theory for the coupling {gamma}{gamma} {yields} H, we obtain a leading-order cross section of the order of 0.3 pb for exclusive Higgs production in elastic (p Pb {yields} {gamma}{gamma} p H Pb) and semielastic (p Pb {yields} {gamma}{gamma} X H Pb) processes at {radical}S{sub NN} = 8.8 TeV. After applying various kinematics cuts to remove the main backgrounds ({gamma}{gamma} {yields} b{bar b} and misidentified {gamma}{gamma} {yields} q{bar q} events), we find that a Higgs boson with m{sub H} = 120 GeV/c{sup 2} could be observed in the b{bar b} channel with a 3{sigma}-significance integrating 300 pb{sup -1} with an upgraded pA luminosity of 10{sup 31} cm{sup -2}s{sup -1}. We also provide for the first time semielastic Higgs cross sections, along with elastic t{bar t} cross sections, for electromagnetic pp, pA and AA collisions at the LHC.
High resolution {sup 12}C({gamma},p) experiments at E{sub {gamma}} {approx_equal} 25-75 MeV
Energy Technology Data Exchange (ETDEWEB)
Ruijter, H
1995-08-01
Absolute differential cross sections for the {sup 12}C({gamma},p){sup 11}B reaction have been measured over proton detection angels ranging from 30 to 150 deg, using tagged photons of 25-75 MeV energy, for low-lying regions of residual excitation energy in {sup 11}B. Four experiments were performed at the MAX laboratory in Lund in order to provide data. Previously reported cross sections for the reaction had systematic uncertainties of a magnitude which made them agree, in spite of a large spread in absolute values. The cross sections reported, with a systematic uncertainty of 8%, remove previous ambiguities for E{sub {gamma}}=40-75 MeV. A reinterpretation of the states excited in{sup 11}B at E about 7 MeV is also presented. The data are compared with quasi-elastic (e,e`p) results in PWIA in the same recoil momentum range. It is found that the momentum distributions do not scale for the two reaction types. Furthermore, the data are compared with the results for the inverse reaction (p,{gamma}) in the centre-of-momentum system by detailed balance. The comparison with respect to missing momentum indicates an angular dependence in the ({gamma},p) reaction which is not present in the inverse (p,{gamma}) reaction. Recent results from the MAX laboratory for the ({gamma},n) reaction are compared to the ({gamma},p) results. The mirror nuclei {sup 11}C and {sup 11}B have almost identical excitation energy spectra at E{sub {gamma}}=60 MeV. It is concluded that HF-RPA calculations with essential contributions of meson exchange currents provide a qualitative description of the angular distributions obtained for the ({gamma},p) reaction. An extension of the spherical symmetric basis for the wave function is suggested for the states at E about 7 MeV in {sup 11}B. 108 refs, 83 figs.
Energy Technology Data Exchange (ETDEWEB)
Iliadis, C; Schange, T; Rolfs, C; Schroeder, U; Somorjai, E; Trautvetter, H P; Wolke, K [Muenster Univ. (Germany, F.R.). Inst. fuer Kernphysik; Endt, P M; Kikstra, S W [Rijksuniversiteit Utrecht (Netherlands). Robert van de Graaff Lab.; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics; Arnould, M; Paulus, G [Universite Libre de Bruxelles (Belgium). Inst. d' Astronomie et d' Astrophysique
1990-06-11
Gamma-ray decay schemes have been measured with bare and Compton-suppressed Ge detectors at low-energy resonances (E{sub p}<340 keV) in the (p, {gamma}) reactions on {sup 25}Mg, {sup 26}Mg and {sup 27}Al. Althogether 58 new decay branches have been observed and a new {sup 26}Mg(p, {gamma}){sup 27}Al resonance has been found at E{sub p}=154.5{plus minus}1.0 keV. The new branchings lead to J{sup {pi}}; T determinations (or limitations) for two states in {sup 26}Al and four states in {sup 28}Si. The absolute strengths of the {sup 25}Mg(p, {gamma}){sup 26}Al and {sup 26}Mg(p, {gamma}){sup 27}Al resonances have also been obtained, and the uncertainties of the stellar rates, deduced from the available data for both reactions, are significantly reduced. Some astrophysical consequences are discussed. (orig.).
Energy Technology Data Exchange (ETDEWEB)
Lu, C L; Lv, J G; Xu, L; Guo, X F; Hou, W H [Key Laboratory of Mesoscopic Chemistry of MOE, School of Chemistry and Chemical Engineering, Nanjing University, Nanjing 210093 (China); Hu, Y; Huang, H [State Key Laboratory of Materials-Oriented Chemical Engineering, Nanjing University of Technology, Nanjing 210009 (China)], E-mail: guoxf@nju.edu.cn, E-mail: whou@nju.edu.cn
2009-05-27
Crystalline nanotubes of {gamma}-AlOOH and {gamma}-Al{sub 2}O{sub 3} have been synthesized. An anionic surfactant-assisted hydrothermal process yields {gamma}-AlOOH nanotubes, and appropriate calcination treatment of the {gamma}-AlOOH nanotubes yields {gamma}-Al{sub 2}O{sub 3} nanotubes. The nanotubes were characterized by XRD, SEM, TEM, TG-DSC, FTIR and nitrogen adsorption-desorption techniques. Both the {gamma}-AlOOH and {gamma}-Al{sub 2}O{sub 3} nanotubes are crystalline, with a representative length of {approx}500 nm and diameters of 20-40 nm. The {gamma}-Al{sub 2}O{sub 3} nanotubes exhibit a very high mesoporous specific surface area (SSA) of 201.0 m{sup 2} g{sup -1} and a high mesopore volume of 0.68 cm{sup 3} g{sup -1} with an average mesopore size of 27.7 nm, as well as a high microporous SSA of 186.0 m{sup 2} g{sup -1} and a micropore volume of 0.08 cm{sup 3} g{sup -1} with an average micropore size of 0.53 nm. The formation process was discussed and a possible mechanism was proposed, in which a lamellar phase was first formed by camphorsulfonic anions and Al(III) species, and then rolled up to form the crystalline nanotubes under the hydrothermal condition. The catalytic performance of the obtained {gamma}- Al{sub 2}O{sub 3} nanotubes was tested by using the dehydration of ethanol to ethylene as a probe reaction and it was shown that the obtained {gamma}- Al{sub 2}O{sub 3} nanotubes catalyst possesses a higher catalytic activity compared with the {gamma}- Al{sub 2}O{sub 3} nanoparticles.
Vinck, Martin; Bosman, Conrado A.
2016-01-01
During visual stimulation, neurons in visual cortex often exhibit rhythmic and synchronous firing in the gamma-frequency (30–90 Hz) band. Whether this phenomenon plays a functional role during visual processing is not fully clear and remains heavily debated. In this article, we explore the function of gamma-synchronization in the context of predictive and efficient coding theories. These theories hold that sensory neurons utilize the statistical regularities in the natural world in order to improve the efficiency of the neural code, and to optimize the inference of the stimulus causes of the sensory data. In visual cortex, this relies on the integration of classical receptive field (CRF) data with predictions from the surround. Here we outline two main hypotheses about gamma-synchronization in visual cortex. First, we hypothesize that the precision of gamma-synchronization reflects the extent to which CRF data can be accurately predicted by the surround. Second, we hypothesize that different cortical columns synchronize to the extent that they accurately predict each other’s CRF visual input. We argue that these two hypotheses can account for a large number of empirical observations made on the stimulus dependencies of gamma-synchronization. Furthermore, we show that they are consistent with the known laminar dependencies of gamma-synchronization and the spatial profile of intercolumnar gamma-synchronization, as well as the dependence of gamma-synchronization on experience and development. Based on our two main hypotheses, we outline two additional hypotheses. First, we hypothesize that the precision of gamma-synchronization shows, in general, a negative dependence on RF size. In support, we review evidence showing that gamma-synchronization decreases in strength along the visual hierarchy, and tends to be more prominent in species with small V1 RFs. Second, we hypothesize that gamma-synchronized network dynamics facilitate the emergence of spiking output that
‘Gamma Anna’: a classroom demonstration for teaching the concepts of gamma imaging
Wolff, Nicola; Griffiths, Jennifer; Yerworth, Rebecca
2017-01-01
Gamma imaging is at the interface of medicine and physics and thus its teaching is important in both fields. Pedagogic literature highlights the benefits of interactive demonstrations in teaching: an increase in enjoyment and interest, as well as improvement in academic achievement. However gamma imaging uses radioactive sources, which are potentially dangerous and thus their use is tightly controlled. We have developed a demonstration which uses a localised exothermic reaction within a rag doll as an analogue of radioactivity. This can be safely used in classrooms to demonstrate the principles of gamma imaging. The tool is easy to make, cheap, robust and portable. The supplementary material in this paper gives teacher notes and a description of how to make the rag doll demonstrator. We have tested the tool using six participants, acting as ‘teachers’, who carried out the demonstration and described the doll as easy to use, and the ‘tumour’ clearly identifiable. The teaching tool was separately demonstrated to a group of 12 GCSE physics students and a group of 12 medical students. Feedback showed increased student engagement, enjoyment and understanding of gamma imaging. Previous research has shown that these benefits have an impact on learning and academic outcomes.
Niemantsverdriet, J.W.; Butz, Tilman; Ertl, G.; Knözinger, H.; Schüth, F.
2008-01-01
No abstract. The sections in this article are 1 Introduction 2 Mössbauer Spectroscopy 3 Time-Differential Perturbed Angular Correlations (TDPAC) 4 Conclusions and Outlook Keywords: Mössbauer spectroscopy; gamma spectroscopy; perturbed angular correlation; TDPAC
Gamma-Ray Imaging Spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy
International Nuclear Information System (INIS)
Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; Maccallum, C.J.; Stang, P.D.; Sandia Labs., Albuquerque, NM)
1985-01-01
High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload, a balloon program was initiated to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments
Ras p21 and other Gn proteins are detected in mammalian cell lines by [gamma-35S]GTP gamma S binding
International Nuclear Information System (INIS)
Comerford, J.G.; Gibson, J.R.; Dawson, A.P.; Gibson, I.
1989-01-01
The presence of guanine nucleotide binding proteins in mouse and human cell lines was investigated using [gamma- 35 S]GTP gamma S and [gamma-32P]GTP. Cell lysate polypeptides were separated by sodium dodecyl sulphate polyacrylamide gel electrophoresis and transferred to nitrocellulose. Incubation of the nitrocellulose blots with [gamma- 35 S]GTP gamma S identified 9 distinct GTP-binding polypeptides in all lysates. One of these is the ras oncogene product, p21, as demonstrated by subsequent immunochemical staining of the nitrocellulose blots. We have shown that this procedure provides a sensitive method for detection of p21 in culture cell lines
Use of digital computers for correction of gamma method and neutron-gamma method indications
International Nuclear Information System (INIS)
Lakhnyuk, V.M.
1978-01-01
The program for the NAIRI-S computer is described which is intended for accounting and elimination of the effect of by-processes when interpreting gamma and neutron-gamma logging indications. By means of slight corrections it is possible to use the program as a mathematical basis for logging diagram standardization by the method of multidimensional regressive analysis and estimation of rock reservoir properties
Gamma-ray spectroscopy on irradiated fuel rods
International Nuclear Information System (INIS)
Terremoto, Luis Antonio Albiac
2009-01-01
The recording of gamma-ray spectra along an irradiated fuel rod allows the fission products to be qualitatively and quantitatively examined. Among all nondestructive examinations performed on irradiated fuel rods by gamma-ray spectroscopy, the most comprehensive one is the average burnup measurement, which is quantitative. Moreover, burnup measurements by means of gamma-ray spectroscopy are less time-consuming and waste-generating than burnup measurements by radiochemical, destructive methods. This work presents the theoretical foundations and experimental techniques necessary to measure, using nondestructive gamma-ray spectroscopy, the average burnup of irradiated fuel rods in a laboratory equipped with hot cells. (author)
SGR-76 gamma radiation level indicator
International Nuclear Information System (INIS)
Chubinskij-Nadezhdin, I.V.
1978-01-01
The design of a gamma-radiation level indicator is described; the instrument is part of a mobile radiometric laboratory (MRL). The design of the instrument permits gamma-radiation dose rates recording at 0.2-200 R/hr, and signals on gamma-background levels. The instrument has two separate threshold levels of signalling actuation. The light signalling at the first level is precautionary, and the sound signalling at the second level indicates the necessity of taking a decision as to whether or not the MRL can remain in the gamma-radiation field. Halogenic counters operating in a current mode are used as detectors. The basic error in recording the dose rate amounts to +-25%. Overall dimensions of the instrument 150x280x100 mm; weight less than 2.5 kg
Gamma-rays from decaying dark matter
Energy Technology Data Exchange (ETDEWEB)
Bertone, G. [Paris-6 Univ., 75 (France). Inst. d' Astrophysique; Buchmueller, W.; Covi, L.; Ibarra, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2007-10-15
We study the prospects for detecting gamma-rays from decaying Dark Matter (DM), focusing in particular on gravitino DM in R-parity breaking vacua. Given the substantially different angular distribution of the predicted gamma-ray signal with respect to the case of annihilating DM, and the relatively poor (of order 0.1 ) angular resolution of gamma-ray detectors, the best strategy for detection is in this case to look for an exotic contribution to the gamma-ray flux at high galactic latitudes, where the decaying DM contribution would resemble an astrophysical extragalactic component, similar to the one inferred by EGRET observations. Upcoming experiments such as GLAST and AMS-02 may identify this exotic contribution and discriminate it from astrophysical sources, or place significant constraints on the mass and lifetime of DM particles. (orig.)
Institute of Scientific and Technical Information of China (English)
Jiao Wu; Haichuan Yu; Haofu Dai; Wenli Mei; Xin Huang; Shuifang Zhu; Ming Peng
2012-01-01
The metabolic changes of bacterial blight-resistant line C418/Xa23 generated by molecular marker-assisted selection (n =12),transgenic variety C418-Xa21 generated by using the Agrobacterium-mediated system (n =12),and progenitor cultivar C418 (n =12) were monitored using gas chromatography/mass spectrometry.The validation,discrimination,and establishment of correlative relationships between metabolite signals were performed by cluster analysis,principal component analysis,and partial least squares-discriminant analysis.Significant and unintended changes were observed in 154 components in C418/Xa23 and 48 components in C418-Xa21 compared with C418 (P < 0.05,Fold change > 2.0).The most significant decreases detected (P< 0.001) in both C418/Xa23 and C418-Xa21 were in three amino acids: glycine,tyrosine,and alanine,and four identified metabolites: malic acid,ferulic acid,succinic acid,and glycerol.Linoleic acid was increased specifically in C418/Xa23 which was derived from traditional breeding.This line,possessing a distinctive metabolite profile as a positive control,shows more differences vs.the parental than the transgenic line.Only succinic acid that falls outside the boundaries of natural variability between the two non-transgenic varieties C418 and C418/Xa23 should be further investigated with respect to safety or nutritional impact.
Study of Triple-Gauge-Boson Couplings ZZZ, ZZ$\\gamma$ and Z$\\gamma\\gamma$ at LEP
Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung9, S U; Cieslik19, K; Collins9, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt9, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E; Kernel, G; Kersevan, B P; Kerzel, U; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M
2007-01-01
Neutral triple-gauge-boson couplings ZZZ, ZZgam and Zgamgam have been studied with the DELPHI detector using data at energies between 183 and 208 GeV. Limits are derived on these couplings from an analysis of the reactions e+e- -> Zgam, using data from the final states gamma f fbar, with f = q or neutrino, from e+e- -> ZZ, using data from the four-fermion final states q qbar q qbar, q qbar mu+ mu-, q qbar e+ e-, q qbar nu nubar, mu+ mu- nu nubar and e+ e- nu nubar, and from e+e- -> Zgam*, in which the final state gamma is off mass-shell, using data from the four-fermion final states q qbar e+ e- and q qbar mu+ mu-. No evidence for the presence of such couplings is observed, in agreement with the predictions of the Standard Model.
Experience gained in gamma spectroscopy; Experience acquise dans la spectrometrie gamma
Energy Technology Data Exchange (ETDEWEB)
Jeanmaire, L [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1960-07-01
There are two types of method which make it possible to estimate the internal contamination of individuals. On the one hand these are the indirect techniques based on measurements of the excreted products, on the other there are the direct techniques in which attempts are made to measure directly the radio-activity existing in the organism. We propose to give a few of the results obtained by the direct method using equipment built by the Commissariat a l'Energie Atomique. The apparatus consists of a {gamma} spectrometer. It includes: 1) A crystal of sodium iodide 20 cm in diameter and 10 cm high. The large size of this crystal ensures a good sensitivity and makes it possible to carry out rapid measurements. 2) A 25 channel type SAE 25 selector which classifies the pulses according to their amplitude. It is therefore possible to distinguish between {gamma} rays of varying energy. 3) A comparatively very light radiation protection, consisting of only 5 cm thickness of lead which diminishes the ambient {gamma} ray intensity to a sufficient level for the majority of the measurements. A certain collimation is thus obtained which makes it possible to localise the source approximately and to reduce the undesirable effects of external contamination. (author) [French] Deux types de methodes permettent d'apprecier la contamination interne d'un individu. D'une part, les techniques indirectes basees sur la mesure des produits excretes, d'autre part, les techniques directes au moyen desquelles on essaie de mesurer directement la radioactivite existant dans l'organisme. Nous nous proposons d'indiquer quelques resultats obtenus par la methode directe, au moyen d'ensembles realises par le Commissariat a l'Energie Atomique. L'appareillage est un spectrometre {gamma}. II comprend: 1) Un cristal d'iodure de sodium de 20 cm de diametre et 10 cm de hauteur. La grande taille de ce cristal assure une bonne sensibilite et permet d'effectuer des mesures rapides. 2) Un selecteur a 25 canaux
GAMMA RAYS FROM STAR FORMATION IN CLUSTERS OF GALAXIES
International Nuclear Information System (INIS)
Storm, Emma M.; Jeltema, Tesla E.; Profumo, Stefano
2012-01-01
Star formation in galaxies is observed to be associated with gamma-ray emission, presumably from non-thermal processes connected to the acceleration of cosmic-ray nuclei and electrons. The detection of gamma rays from starburst galaxies by the Fermi Large Area Telescope (LAT) has allowed the determination of a functional relationship between star formation rate and gamma-ray luminosity. Since star formation is known to scale with total infrared (8-1000 μm) and radio (1.4 GHz) luminosity, the observed infrared and radio emission from a star-forming galaxy can be used to quantitatively infer the galaxy's gamma-ray luminosity. Similarly, star-forming galaxies within galaxy clusters allow us to derive lower limits on the gamma-ray emission from clusters, which have not yet been conclusively detected in gamma rays. In this study, we apply the functional relationships between gamma-ray luminosity and radio and IR luminosities of galaxies derived by the Fermi Collaboration to a sample of the best candidate galaxy clusters for detection in gamma rays in order to place lower limits on the gamma-ray emission associated with star formation in galaxy clusters. We find that several clusters have predicted gamma-ray emission from star formation that are within an order of magnitude of the upper limits derived in Ackermann et al. based on non-detection by Fermi-LAT. Given the current gamma-ray limits, star formation likely plays a significant role in the gamma-ray emission in some clusters, especially those with cool cores. We predict that both Fermi-LAT over the course of its lifetime and the future Cerenkov Telescope Array will be able to detect gamma-ray emission from star-forming galaxies in clusters.
Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels
Benkhelifa, Fatma
2013-01-27
In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-o ff power control scheme.
Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels
Benkhelifa, Fatma
2013-02-23
In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme.
Low SNR Capacity of FSO Links over Gamma-Gamma Atmospheric Turbulence Channels
Benkhelifa, Fatma; Alouini, Mohamed-Slim; Rezki, Zouheir
2013-01-01
In this paper, we study the ergodic capacity of free space optical communication systems over Gamma-Gamma atmospheric turbulence fading channels with perfect channel state information at both the transmitter and the receiver. In our framework, we mainly focus on the low signal-to-noise ratio range and show that the ergodic capacity scales proportionally to SNR log^4(1/SNR). We show also that one-bit CSI feedback at the transmitter is enough to achieve this capacity using an on-off power control scheme.
International Nuclear Information System (INIS)
Mendes, Mariana E.; Souza, Priscilla L.G.; Brandao, Jose Odinilson de C.; Santos, Joelan A.L.; Vilela, Eudice C.; Lima, Fabiana F.; Calixto, Merilane S.; Santos, Neide
2011-01-01
The estimate on approximate dose in exposed individual can be made through conventional cytogenetic analysis of dicentric, this technique has been used to support physical dosimetry. It is important to estimate the absorbed dose in case of accidents with the aim of developing an appropriate treatment and biological dosimetry can be very useful in case where the dosimetry is unavailable. Exposure to gamma and neutron radiation leads to the same biological effects such as chromosomal alterations and cancer. However, neutrons cause more genetic damage, such as mutation or more structural damage, such as chromosome alterations. The aim of research is to compare frequencies of unstable chromosome alterations induced by a gamma beam with those from neutron-gamma mixed field. Two blood samples were obtained from one healthy donor and irradiated at different sources. The first sample was exposed to mixed field neutron-gamma sources 241 AmBe at the Neutron Calibration Laboratory (NCL - CRCN/NE - PE - Brazil) and the second one was exposed to 137 Cs gamma rays at 137 Cs Laboratory (CRCN/NE - PE - Brazil), both exposures resulting in an absorbed dose of 0.66Gy. Mitotic metaphase cells were obtained by lymphocyte culture for chromosomal analysis and slides were stained with Giemsa 5%. These preliminary results showed a similarity in associated dicentrics frequency per cell (0.041 and 0.048) after 137 Cs and 241 AmBe sources irradiations, respectively. However, it was not observed centric rings frequency per cell (0.0 and 0.027). This study will be continue to verify the frequencies of unstable chromosome alterations induced by only gamma beam and neutron-gamma mixed field. (author)
Energy Technology Data Exchange (ETDEWEB)
Mendes, Mariana E.; Souza, Priscilla L.G.; Brandao, Jose Odinilson de C.; Santos, Joelan A.L.; Vilela, Eudice C.; Lima, Fabiana F. [Centro Regional de Ciencias Nucleares (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Calixto, Merilane S.; Santos, Neide [Universidade Federal de Pernanmbuco (CCB/UFPE), Recife, PE (Brazil). Centro de Ciencias Biologicas. Dept. de Genetica
2011-07-01
The estimate on approximate dose in exposed individual can be made through conventional cytogenetic analysis of dicentric, this technique has been used to support physical dosimetry. It is important to estimate the absorbed dose in case of accidents with the aim of developing an appropriate treatment and biological dosimetry can be very useful in case where the dosimetry is unavailable. Exposure to gamma and neutron radiation leads to the same biological effects such as chromosomal alterations and cancer. However, neutrons cause more genetic damage, such as mutation or more structural damage, such as chromosome alterations. The aim of research is to compare frequencies of unstable chromosome alterations induced by a gamma beam with those from neutron-gamma mixed field. Two blood samples were obtained from one healthy donor and irradiated at different sources. The first sample was exposed to mixed field neutron-gamma sources {sup 241}AmBe at the Neutron Calibration Laboratory (NCL - CRCN/NE - PE - Brazil) and the second one was exposed to {sup 137}Cs gamma rays at {sup 137}Cs Laboratory (CRCN/NE - PE - Brazil), both exposures resulting in an absorbed dose of 0.66Gy. Mitotic metaphase cells were obtained by lymphocyte culture for chromosomal analysis and slides were stained with Giemsa 5%. These preliminary results showed a similarity in associated dicentrics frequency per cell (0.041 and 0.048) after {sup 137}Cs and {sup 241}AmBe sources irradiations, respectively. However, it was not observed centric rings frequency per cell (0.0 and 0.027). This study will be continue to verify the frequencies of unstable chromosome alterations induced by only gamma beam and neutron-gamma mixed field. (author)
Bulk density calculations from prompt gamma ray yield
International Nuclear Information System (INIS)
Naqvi, A.A.; Nagadi, M.M.; Al-Amoudi, O.S.B.; Maslehuddin, M.
2006-01-01
Full text: The gamma ray yield from a Prompt Gamma ray Neutron Activation Analysis (PGNAA) setup is a linear function of element concentration and neutron flux in a the sample with constant bulk density. If the sample bulk density varies as well, then the element concentration and the neutron flux has a nonlinear correlation with the gamma ray yield [1]. The measurement of gamma ray yield non-linearity from samples and a standard can be used to estimate the bulk density of the samples. In this study the prompt gamma ray yield from Blast Furnace Slag, Fly Ash, Silica Fumes and Superpozz cements samples have been measured as a function of their calcium and silicon concentration using KFUPM accelerator-based PGNAA setup [2]. Due to different bulk densities of the blended cement samples, the measured gamma ray yields have nonlinear correlation with calcium and silicon concentration of the samples. The non-linearity in the yield was observed to increase with gamma rays energy and element concentration. The bulk densities of the cement samples were calculated from ratio of gamma ray yield from blended cement and that from a Portland cement standard. The calculated bulk densities have good agreement with the published data. The result of this study will be presented
DEFF Research Database (Denmark)
Johansen, H K; Hougen, H P; Rygaard, J
1996-01-01
In a rat model of chronic Pseudomonas aeruginosa lung infection mimicking cystic fibrosis (CF), we studied whether the inflammatory response could be altered by intraperitoneal treatment with recombinant rat interferon-gamma (rrIFN-gamma). Rats were treated either before or after intratracheal ch...
Review of the Czubek--Jonas gamma-log program
International Nuclear Information System (INIS)
Matthews, M.
1978-11-01
Several gamma-ray logs were computer processed using the Czubek--Jones and DOE's MDDAT gamma-log programs. Both of these programs convert counts per second from the gamma-ray logs to percent eU 3 O 8 . The results of these programs were compared to each other and to the core analysis (percent U 3 O 8 ) of the logged boreholes. The two gamma-log programs produced similar results. The core analysis did not compare favorably with the results of either gamma-log program. This unfavorable comparison is probably due to an incorrect assumption of secular equilibrium for the ore surrounding the boreholes. The Czubek--Jonas program requires a knowledge of the linear attenuation coefficient of the rocks surrounding a borehole. This limits the usefulness of the program because this coefficient is generally not known and varies for different gamma-ray energies. It is recommended that the MDDAT program continue to be used for estimating the grade (percent eU 3 O 8 ) from gamma-log data and not be replaced by the Czubek--Jonas program
Observational techniques of gamma rays astronomy in low energy
International Nuclear Information System (INIS)
Costa, J.M. da.
1982-02-01
Due to the absorption of great part of the gamma-ray spectrum of cosmic origin, by the earth's atmosphere at heights above 20Km, gamma-ray astronomy achieved its full development only after the advent of the space age. Ballons and satellites are the space vehicles which have been used to transport gamma-ray telescopes to observational heights in the atmosphere, or out of it. The results of these experiments can determine the sources, the energy spectra and the intensities of the cosmic gamma-rays, and provide other important information of astrophysical interest. The detection of gamma-rays of cosmic origin is very difficult. The observational techniques used in gamma-ray astronomy are dependent on the energy range of the gamma-rays which one desires to detect. The most common telescopes of low energy gamma-ray astronomy (50KeV - 20MeV) use NaI(Tl) scintillators, or germanium diodes, as principal detectors, surrounded by an active shield (anticoincidence) of organic or inorganic scintillators. (Author) [pt
Design of a software for gamma detector efficiency
International Nuclear Information System (INIS)
Lopez, G.
2011-01-01
Gamma spectroscopy with highly-pure-germanium detector is one of the most used method for qualitative and quantitative analysis of samples. Nevertheless Gamma spectroscopy results require to be corrected, first for taking into account the self-shielding effect that represents the absorption of the photons by the sample itself and secondly for correcting the fact that 2 photons emitted simultaneously with energy E 1 and E 2 are likely to be simultaneously detected and then counted as a single photon with an energy E 1 +E 2 . This effect is called gamma-gamma coincidence. A software has been designed to simulate both effect and produce correcting factors in the case of cylindrical geometries. This software has been validated on Americium 241 for the self-shielding effect and on Cesium 134 for gamma-gamma coincidence. (A.C.)
Upgrade of the JET gamma-ray cameras
International Nuclear Information System (INIS)
Soare, S.; Curuia, M.; Anghel, M.; Constantin, M.; David, E.; Craciunescu, T.; Falie, D.; Pantea, A.; Tiseanu, I.; Kiptily, V.; Prior, P.; Edlington, T.; Griph, S.; Krivchenkov, Y.; Loughlin, M.; Popovichev, S.; Riccardo, V; Syme, B.; Thompson, V.; Lengar, I.; Murari, A.; Bonheure, G.; Le Guern, F.
2007-01-01
Full text: The JET gamma-ray camera diagnostics have already provided valuable information on the gamma-ray imaging of fast ion in JET plasmas. The applicability of gamma-ray imaging to high performance deuterium and deuterium-tritium JET discharges is strongly dependent on the fulfilment of rather strict requirements for the characterisation of the neutron and gamma-ray radiation fields. These requirements have to be satisfied within very stringent boundary conditions for the design, such as the requirement of minimum impact on the co-existing neutron camera diagnostics. The JET Gamma-Ray Cameras (GRC) upgrade project deals with these issues with particular emphasis on the design of appropriate neutron/gamma-ray filters ('neutron attenuators'). Several design versions have been developed and evaluated for the JET GRC neutron attenuators at the conceptual design level. The main design parameter was the neutron attenuation factor. The two design solutions, that have been finally chosen and developed at the level of scheme design, consist of: a) one quasi-crescent shaped neutron attenuator (for the horizontal camera) and b) two quasi-trapezoid shaped neutron attenuators (for the vertical one). The second design solution has different attenuation lengths: a short version, to be used together with the horizontal attenuator for deuterium discharges, and a long version to be used for high performance deuterium and DT discharges. Various neutron-attenuating materials have been considered (lithium hydride with natural isotopic composition and 6 Li enriched, light and heavy water, polyethylene). Pure light water was finally chosen as the attenuating material for the JET gamma-ray cameras. The neutron attenuators will be steered in and out of the detector line-of-sight by means of an electro-pneumatic steering and control system. The MCNP code was used for neutron and gamma ray transport in order to evaluate the effect of the neutron attenuators on the neutron field of the
(Biodegradable Ionomeric Polyurethanes Based on Xanthan: Synthesis, Properties, and Structure
Directory of Open Access Journals (Sweden)
T. V. Travinskaya
2017-01-01
Full Text Available New (biodegradable environmentally friendly film-forming ionomeric polyurethanes (IPU based on renewable biotechnological polysaccharide xanthan (Xa have been obtained. The influence of the component composition on the colloidal-chemical and physic-mechanical properties of IPU/Xa and based films, as well as the change of their properties under the influence of environmental factors, have been studied. The results of IR-, PMS-, DMA-, and X-ray scattering study indicate that incorporation of Xa into the polyurethane chain initiates the formation of a new polymer structure different from the structure of the pure IPU (matrix: an amorphous polymer-polymer microdomain has occurred as a result of the chemical interaction of Xa and IPU. It predetermines the degradation of the IPU/Xa films as a whole, unlike the mixed polymer systems, and plays a key role in the improvement of material performance. The results of acid, alkaline hydrolysis, and incubation into the soil indicate the increase of the intensity of degradation processes occurring in the IPU/Xa in comparison with the pure IPU. It has been shown that the introduction of Xa not only imparts the biodegradability property to polyurethane, but also improves the mechanical properties.
International Nuclear Information System (INIS)
Brehm, E.H.; Holst, T.
1975-01-01
In this report the development of methods of evaluating gamma ray protection factors (GSF) of ships for various situations of radioactive fall-out is described. The joining calculations of gamma ray protection factors are performed by the newly developed computer procedure GASUFA. These protection factors determine - in connection with a measured gamma radiation dose at a given detector point - the gamma radiation in different compartments of the ships. The computer program GASUFA is able to perform calculations considering the dependence of energy, place and time for the following situations: - the ship is under a radioactive cloud without fall-out; - the ship is under a radioactive cloud with fall-out; - the ship is contaminated by radioactive fall-out; - the clean or decontaminated ship is going through a zone, which is contaminated by radioactive fall-out; - the ship and the surrounding water surface are contaminated by radioactive fall-out. (orig.) [de
Gamma Ray Tomographic Scan Method for Large Scale Industrial Plants
International Nuclear Information System (INIS)
Moon, Jin Ho; Jung, Sung Hee; Kim, Jong Bum; Park, Jang Geun
2011-01-01
The gamma ray tomography systems have been used to investigate a chemical process for last decade. There have been many cases of gamma ray tomography for laboratory scale work but not many cases for industrial scale work. Non-tomographic equipment with gamma-ray sources is often used in process diagnosis. Gamma radiography, gamma column scanning and the radioisotope tracer technique are examples of gamma ray application in industries. In spite of many outdoor non-gamma ray tomographic equipment, the most of gamma ray tomographic systems still remained as indoor equipment. But, as the gamma tomography has developed, the demand on gamma tomography for real scale plants also increased. To develop the industrial scale system, we introduced the gamma-ray tomographic system with fixed detectors and rotating source. The general system configuration is similar to 4 th generation geometry. But the main effort has been made to actualize the instant installation of the system for real scale industrial plant. This work would be a first attempt to apply the 4th generation industrial gamma tomographic scanning by experimental method. The individual 0.5-inch NaI detector was used for gamma ray detection by configuring circular shape around industrial plant. This tomographic scan method can reduce mechanical complexity and require a much smaller space than a conventional CT. Those properties make it easy to get measurement data for a real scale plant
Application of nuclear gamma methods in mining
International Nuclear Information System (INIS)
Simon, L.; Bosak, J.
1980-01-01
A brief review is presented of basic physical characteristics of laboratory, field and operating gamma methods, of their classifications and principles. The measuring instrumentation used and the current state of applications of nuclear gamma methods in coal and ore mining and related branches are described in detail. Principles and practical recommendations are given for safety at work when handling gamma sources. (B.S.)
Gamma spectrometry of infinite 4Π geometry
International Nuclear Information System (INIS)
Nordemann, D.J.R.
1987-07-01
Owing to the weak absorption og gamma radiation by matter, gamma-ray spectrometry may be applied to samples of great volume. A very interesting case is that of the gamma-ray spectrometry applied with 4Π geometry around the detector on a sample assumed to be of infinite extension. The determination of suitable efficiencies allows this method to be quantitative. (author) [pt
Sensitivity of Gamma-Ray Detectors to Polarization
Yadigaroglu, I. -A.
1996-01-01
Previous studies have shown that the largest gamma-ray detector to date, EGRET, does not have useful polarization sensitivity. We have explored here some improved approaches to analyzing gamma-ray pair production events, leading to important gains in sensitivity to polarization. The performance of the next generation gamma-ray instrument GLAST is investigated using a detailed Monte Carlo simulation of the complete detector.
Airborne and total gamma absorbed dose rates at Patiala - India
International Nuclear Information System (INIS)
Tesfaye, Tilahun; Sahota, H.S.; Singh, K.
1999-01-01
The external gamma absorbed dose rate due to gamma rays originating from gamma emitting aerosols in air, is compared with the total external gamma absorbed dose rate at the Physics Department of Punjabi University, Patiala. It has been found out that the contribution, to the total external gamma absorbed dose rate, of radionuclides on particulate matter suspended in air is about 20% of the overall gamma absorbed dose rate. (author)
SYSTEMATIC STUDY OF GAMMA-RAY-BRIGHT BLAZARS WITH OPTICAL POLARIZATION AND GAMMA-RAY VARIABILITY
Energy Technology Data Exchange (ETDEWEB)
Itoh, Ryosuke; Fukazawa, Yasushi; Kanda, Yuka; Shiki, Kensei; Kawabata, Miho; Nakaoka, Tatsuya; Takaki, Katsutoshi; Takata, Koji; Ui, Takahiro [Department of Physical Science, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Nalewajko, Krzysztof; Madejski, Greg M. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Stanford University, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Uemura, Makoto; Tanaka, Yasuyuki T.; Kawabata, Koji S.; Akitaya, Hiroshi; Ohsugi, Takashi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Schinzel, Frank K. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Moritani, Yuki [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo Institutes for Advanced Study, The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Sasada, Mahito [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Yamanaka, Masayuki, E-mail: itoh@hep01.hepl.hiroshima-u.ac.jp, E-mail: itoh@hp.phys.titech.ac.jp [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); and others
2016-12-10
Blazars are highly variable active galactic nuclei that emit radiation at all wavelengths from radio to gamma rays. Polarized radiation from blazars is one key piece of evidence for synchrotron radiation at low energies, and it also varies dramatically. The polarization of blazars is of interest for understanding the origin, confinement, and propagation of jets. However, even though numerous measurements have been performed, the mechanisms behind jet creation, composition, and variability are still debated. We performed simultaneous gamma-ray and optical photopolarimetry observations of 45 blazars between 2008 July and 2014 December to investigate the mechanisms of variability and search for a basic relation between the several subclasses of blazars. We identify a correlation between the maximum degree of optical linear polarization and the gamma-ray luminosity or the ratio of gamma-ray to optical fluxes. Since the maximum polarization degree depends on the condition of the magnetic field (chaotic or ordered), this result implies a systematic difference in the intrinsic alignment of magnetic fields in parsec-scale relativistic jets between different types of blazars (flat-spectrum radio quasars vs. BL Lacs) and consequently between different types of radio galaxies (FR I versus FR II).
Scintillation counter, maximum gamma aspect
International Nuclear Information System (INIS)
Thumim, A.D.
1975-01-01
A scintillation counter, particularly for counting gamma ray photons, includes a massive lead radiation shield surrounding a sample-receiving zone. The shield is disassembleable into a plurality of segments to allow facile installation and removal of a photomultiplier tube assembly, the segments being so constructed as to prevent straight-line access of external radiation through the shield into radiation-responsive areas. Provisions are made for accurately aligning the photomultiplier tube with respect to one or more sample-transmitting bores extending through the shield to the sample receiving zone. A sample elevator, used in transporting samples into the zone, is designed to provide a maximum gamma-receiving aspect to maximize the gamma detecting efficiency. (U.S.)
Catalog of gamma-rays unplaced in radioactive decay schemes
International Nuclear Information System (INIS)
Narita, Tsutomu; Kitao, Kensuke.
1991-03-01
A catalog is made for gamma-rays emitted in decay of radioactive nuclides but not placed in their decay schemes. It consists of two tables. In Table 1, the number of these unplaced gamma-ray components by a nuclide is given together with the fraction of total intensity of these gamma-rays to that of all observed gamma-rays. In Table 2, the unplaced gamma-rays are arranged in order of increasing energy. Each line of this table contains the gamma-ray energy, intensity, nuclide identification, and energies and intensities of the most prominent gamma-rays from the decay of the radionuclides. This catalog is a compilation from Evaluated Nuclear Structure Data File (ENSDF) maintained by National Nuclear Data Center at Brookhaven National Laboratory, of at February 1990. (author)
Energy Technology Data Exchange (ETDEWEB)
Nielsen, J. M.; Kornberg, H. A. [Battelle Memorial Institute, Pacific Northwest Laboratory, Richland, WA (United States)
1965-10-15
Multidimensional gamma-ray spectrometry is a new technique for the measurement of radionuclides which has special application in biology. This instrumental technique allows direct identification and measurement of individual gamma-ray emitters in complex mixtures of radionuclides in diverse sample matrices without prior chemical treatment. The detector system is designed to provide: high sensitivity through use of two large (6-in diam., 4-in thick) Nal(Tl) detectors; high selectivity by using coincidence counting techniques which separate gamma ray spectra by taking advantage of the gamma-ray decay characteristics of each radionuclide ; and ultra-low background and reduced Compton interference through a surrounding anticoincidence annulus detector (a NaI(Tl) crystal 11 Vulgar-Fraction-One-Half -in thick with a 6 Vulgar-Fraction-One-Half - in - diam. hole). A 4096-channel multidimensional analyser analyses the two gamma-rays in coincidence according to their energies and stores them in the plane of the 64 X 64-channel memory while non-coincident events are stored only on the axes of the memory. This effectively decreases the background and Compton interference by orders of magnitude while greatly improving the selectivity. Direct gamma-ray spectrometric measurement of trace levels of radionuclides in biological samples has been inhibited by the presence of relatively large amounts of natural 4 Degree-Sign K whose 1.47 MeV gamma-radiation has interfered with their measurement. Since most radionuclides decay through emission of two or more gamma-rays in cascade the new technique does provide a direct selective measurement and permits wider application. For example, {sup 22}Na (a naturally occurring cosmic-ray produced radionuclide), {sup 134}Cs and {sup 137}Cs (fission products) can be readily measured at existing levels (in some cases at less than 1 dpmAg) in meat, fish, foodstuffs, as well as in urine, so that uptake-excretion studies are possible. This technique
A study on gamma dose rate in Seoul (I)
International Nuclear Information System (INIS)
Kim, You Hyun; Kim, Chang Kyun; Choi, Jong Hak; Kim, Jeong Min
2001-01-01
This study was conducted to find out gamma dose rate in Seoul, from January to December in 2000, and the following results were achieved : The annual gamma dose rate in Seoul was 17.24 μR/hr as average. The annual gamma dose rate in subway of Seoul was 14.96 μR/hr as average. The highest annual gamma dose rate was Dong-daemon ku. Annual gamma dose rate in Seoul was higher autumn than winter
Banaee, Nooshin; Asgari, Sepideh; Nedaie, Hassan Ali
2018-07-01
The accuracy of penumbral measurements in radiotherapy is pivotal because dose planning computers require accurate data to adequately modeling the beams, which in turn are used to calculate patient dose distributions. Gamma knife is a non-invasive intracranial technique based on principles of the Leksell stereotactic system for open deep brain surgeries, invented and developed by Professor Lars Leksell. The aim of this study is to compare the penumbra widths of Leksell Gamma Knife model C and Gamma ART 6000. Initially, the structure of both systems were simulated by using Monte Carlo MCNP6 code and after validating the accuracy of simulation, beam profiles of different collimators were plotted. MCNP6 beam profile calculations showed that the penumbra values of Leksell Gamma knife model C and Gamma ART 6000 for 18, 14, 8 and 4 mm collimators are 9.7, 7.9, 4.3, 2.6 and 8.2, 6.9, 3.6, 2.4, respectively. The results of this study showed that since Gamma ART 6000 has larger solid angle in comparison with Gamma Knife model C, it produces better beam profile penumbras than Gamma Knife model C in the direct plane. Copyright © 2017 Elsevier Ltd. All rights reserved.
Feasibility study of gamma-ray medical radiography
International Nuclear Information System (INIS)
Alyassin, Abdalmajeid M.; Maqsoud, Hamza A.; Mashat, Ahmad M.; Al-Mohr, Al-Sayed; Abdulwajid, Subhan
2013-01-01
This research explores the feasibility of using gamma-ray radiography in medical imaging. We will show that gamma-ray medical radiography has the potential to provide alternative diagnostic medical information to X-ray radiography. Approximately one Ci Am-241 radioactive source which emits mono-energetic 59.5 keV gamma rays was used. Several factors that influence the feasibility of this study were tested. They were the radiation source uniformity, image uniformity, and image quality parameters such as contrast, noise, and spatial resolution. In addition, several gamma-ray and X-ray images were acquired using humanoid phantoms. These images were recorded on computed radiography image receptors and displayed on a standard monitor. Visual assessments of these images were then conducted. The Am-241 radioactive source provided relatively uniform radiation exposure and images. Image noise and image contrast were mainly dependent on the exposure time and source size, whereas spatial resolution was dependent on source size and magnification factor. The gamma-ray humanoid phantom images were of lower quality than the X-ray images mainly due to the low radioactivity used and not enough exposure time. Nevertheless, the gamma-ray images displayed most of the main structures contained in the humanoid phantoms. Higher exposure rates and thus lower exposure times were estimated for different pure Am-241 source sizes that are hypothesized to provide high quality images similar to X-ray images. For instance, a 10 mm source size of pure Am-241 with 7 s exposure time should produce images similar in contrast and noise to X-ray images. This research paves the way for the production and usage of a highly radioactive Am-241 source with the potential to lead to the feasibility of acceptable quality medical gamma-ray radiography. - Highlights: ► Characterized the performance of gamma-ray radiography. ► Displayed medical images of humanoid phantoms using gamma radiography. ► Am-241
Possible galactic origin of. gamma. -ray bursts
Energy Technology Data Exchange (ETDEWEB)
Manchanda, R K; Ramsden, D [Southampton Univ. (UK). Dept. of Physics
1977-03-31
It is stated that extragalactic models for the origin of non-solar ..gamma..-ray bursts include supernova bursts in remote galaxies, and the collapse of the cores of active stars, whilst galactic models are based on flare stars, thermonuclear explosions in neutron stars and the sudden accretion of cometary gas on to neutron stars. The acceptability of any of these models may be tested by the observed size spectrum of the ..gamma..-ray bursts. The extragalactic models predict a power law spectrum with number index -1.5, whilst for the galactic models the number index will be -1. Experimental data on ..gamma..-ray bursts is, however, still meagre, and so far only 44 confirmed events have been recorded by satellite-borne instruments. The number spectrum of the observed ..gamma..-ray bursts indicates that the observed distribution for events with an energy < 10/sup -4/ erg/cm/sup 2/ is flat; this makes the choice of any model completely arbitrary. An analysis of the observed ..gamma..-ray events is here presented that suggests very interesting possibilities for their origin. There appears to be a preferred mean energy for ..gamma..-ray bursts; some 90% of the recorded events show a mean energy between 5 x 10/sup -5/ and 5 x 10/sup -4/ erg/cm/sup 2/, contrary to the predicted characteristics of the number spectrum of various models. A remarkable similarity is found between the distribution of ..gamma..-ray bursts and that of supernova remnants, suggesting a genetic relationship between the two and the galactic origin of the ..gamma..-ray bursts, and the burst source could be identified with completely run down neutron stars, formed during supernova explosions.
Directory of Open Access Journals (Sweden)
Patrícia D. Oliveira
2013-01-01
Full Text Available O presente trabalho teve como objetivo determinar a adequabilidade de três amostras de biopolímero xantana (Xa 06, Xa 82 e Xa 106 e uma clairana como viscosificantes de fluidos de perfuração de poços de petróleo, comparando com uma amostra de xantana comercial, Xanvis®. Foram realizadas análises reológicas, determinados os conteúdos de acetil, piruvato e íons Na+ K+ e Ca2+, e avaliada a capacidade viscosificante segundo norma específica da Petrobras. Os conteúdos de grupos acetil e piruvato para as xantanas e clairana diferiram significativamente entre si, mas foram compatíveis com valores preconizados ou citados na literatura concernente. Com relação ao conteúdo de íons, a xantana comercial apresentou quantidade de cálcio superior, as amostras Xa 06, Xa 82 e Xa 106 tiveram maior teor de potássio e a clairana maior teor de sódio. A viscosidade e a viscoelasticidade da amostra de xantana comercial foram superiores às demais amostras analisadas. Na análise como viscosificante para fluidos de perfuração as amostras de xantana comercial e Xa 106 atingiram os requisitos estabelecidos para os parâmetros n, K e força gel da norma Petrobras N-2605. Com a interpretação conjunta dos resultados obtidos pode-se inferir que apenas as xantanas Xanvis® e Xa 106 apresentam características adequadas à utilização como viscosificante em fluido de perfuração de petróleo. As demais amostras possuem características reológicas adequadas à utilização como espessantes ou estabilizantes em outros segmentos industriais, como em alimentos, tintas e cosméticos.The aim of this study was to determine the suitability of three xanthans (Xa 06, Xa 82 and Xa 106 and a clairana biopolymer for use as drilling fluid thickeners and comparing them against a commercial sample, Xanvis®. Rheological analyses were performed to determine the acetyl, pyruvate and Na+ K+ and Ca2+ ion content and their thickening ability, according to Petrobras
International Nuclear Information System (INIS)
Millegan, D.R.; Nixon, K.V.
1982-01-01
Nuclear safeguards requires sensitive, easily operated instruments for rapid inspection of personnel and vehicles to ensure that no uranium or plutonium is being diverted. Two portable gamma-ray detection systems have been developed. The Modular Gamma System (MGS) is very sensitive and two or more systems can be connected for even better performance. The multiunit configuration can be deployed by motor vehicle for search of large areas too extensive to search on foot. The Programmable Rate Monitor (PRM) is less sensitive but much smaller and therefore is more suitable for search of vehicles, personnel, or smaller areas. The PRM is programmable, which implements measurement and alarm algorithms for individual applications
Directory of Open Access Journals (Sweden)
Kazuya Hosokawa
Full Text Available Dabigatran and rivaroxaban are novel oral anticoagulants that specifically inhibit thrombin and factor Xa, respectively. The aim of this study is to elucidate antithrombotic properties of these anticoagulant agents under arterial and venous shear conditions. Whole blood samples treated with dabigatran or rivaroxaban at 250, 500, and 1000 nM, with/without aspirin and AR-C66096, a P2Y12 antagonist, were perfused over a microchip coated with collagen and tissue thromboplastin at shear rates of 240 and 600 s(-1. Fibrin-rich platelet thrombus formation was quantified by monitoring flow pressure changes. Dabigatran at higher concentrations (500 and 1000 nM potently inhibited thrombus formation at both shear rates, whereas 1000 nM of rivaroxaban delayed, but did not completely inhibit, thrombus formation. Dual antiplatelet agents weakly suppressed thrombus formation at both shear rates, but intensified the anticoagulant effects of dabigatran and rivaroxaban. The anticoagulant effects of dabigatran and rivaroxaban were also evaluated under static conditions using thrombin generation (TG assay. In platelet-poor plasma, dabigatran at 250 and 500 nM efficiently prolonged the lag time (LT and moderately reduce peak height (PH of TG, whereas rivaroxaban at 250 nM efficiently prolonged LT and reduced PH of TG. In platelet-rich plasma, however, both anticoagulants efficiently delayed LT and reduced PH of TG. Our results suggest that dabigatran and rivaroxaban may exert distinct antithrombotic effects under flow conditions, particularly in combination with dual antiplatelet therapy.
The supernova-gamma-ray burst-jet connection.
Hjorth, Jens
2013-06-13
The observed association between supernovae and gamma-ray bursts represents a cornerstone in our understanding of the nature of gamma-ray bursts. The collapsar model provides a theoretical framework for this connection. A key element is the launch of a bipolar jet (seen as a gamma-ray burst). The resulting hot cocoon disrupts the star, whereas the (56)Ni produced gives rise to radioactive heating of the ejecta, seen as a supernova. In this discussion paper, I summarize the observational status of the supernova-gamma-ray burst connection in the context of the 'engine' picture of jet-driven supernovae and highlight SN 2012bz/GRB 120422A--with its luminous supernova but intermediate high-energy luminosity--as a possible transition object between low-luminosity and jet gamma-ray bursts. The jet channel for supernova explosions may provide new insights into supernova explosions in general.
Project Marna Natural Gamma Radiation MAP
International Nuclear Information System (INIS)
Suarez, E.; Fernandez, J.A.
1997-01-01
The confusion created by the accident that occurred in one of the Chernobyl reactors in April of 1986 made the general public and governments aware of the need for improved monitoring of environmental radiation levels. The levels of total gamma radiation or total gamma exposure rate over large areas reached values as high as 400 micro Roentgen/hour (mu R/h) and at points exceeded 1000 mu R/h. It should be borne in mind that, depending on the type of geological formations, normal values range from 5 to 30 mu R/h. The IAEA recommended to all countries that natural gamma radiation maps be made available to evaluate the levels of natural gamma radiation and possible increases, and it also indicated its concern that information be standardized. In addition, it stressed the advisability of using data obtained from uranium prospecting. (Author)
Gamma scanning of the irradiated HANARO fuels
International Nuclear Information System (INIS)
Hong, Kwon Pyo; Lee, K. S.; Park, D. G.; Baik, S. Y.; Song, W. S.; Kim, T. Y.; Seo, C. K.
1997-02-01
To conform the burnup state of the fuels, we have transported the irradiated HANARO fuels from the reactor to IMEF (Irradiated Material Examination Facility), and executed gamma scanning for the fuels. By measuring the gamma-rays from the irradiated fuels we could see the features of the relative burnup distributions in the fuel bundles. All of 17 fuel bundles were taken in and out between HANARO and IMEF from March till August in 1996, and we carried out the related regulations. Longitudinal gamma scanning and angular gamma scanning are done for each fuel bundle without dismantlement of the bundles. (author). 5 tabs., 25 figs
EPR investigation of some gamma-irradiated medicines
International Nuclear Information System (INIS)
Aleksieva, Katerina; Yordanov, Nicola
2016-01-01
The results of EPR studies on three medical tablets – Galanthamine, Cytisine and Tribulus terrestris before and after gamma-irradiation are reported. Before irradiation Galanthamine and Cytisine tablets are EPR silent, whereas Tribulus terrestris show a broad singlet line with g factor 2.2084±0.002. The same spectrum is recorded after irradiation. After gamma-sterilization, however, Galanthamine and Cytisine tablets exhibit a typical EPR spectrum due to gamma induced free radicals in lactose used as an excipient. These stable free radicals can be used for identification of radiation processing for a long time after it. Key words: medical tablets, gamma-irradiation, EPR
Gamma radiation from PSR B1055-52
DEFF Research Database (Denmark)
Thompson, D.J.; Bailes, M.; Bertsch, D.L.
1999-01-01
The telescopes on the Compton Gamma Ray Observatory (CGRO) have observed PSR B1055-52 a number of times between 1991 and 1998. From these data a more detailed picture of the gamma radiation from this source has been developed, showing several characteristics that distinguish this pulsar: the light...... curve is complex; there is no detectable unpulsed emission; the energy spectrum is hat, with no evidence of a sharp high-energy cutoff up to greater than 4 GeV. Comparisons of the gamma-ray data with observations at longer wavelengths show that no two of the known gamma-ray pulsars have quite the same...
Review of GRANAT observations of gamma-ray bursts
DEFF Research Database (Denmark)
Terekhov, O.; Denissenko, D.; Sunyaev, R.
1995-01-01
The GRANAT observatory was launched into a high apogee orbit on 1 December, 1989. Three instruments onboard GRANAT - PHEBUS, WATCH and SIGMA are able to detect gamma-ray bursts in a very broad energy range from 6 keV up to 100 MeV. Over 250 gamma-ray bursts were detected. We discuss the results...... of the observations of the time histories and spectral evolution of the detected events provided by the different instruments in different energy ranges. Short Gamma-Ray Bursts ( 2 s) events. Evidence of the existence...... of four differently behaving componenents in gamma-ray burst spectra is discussed. Statistical properties of the gamma-ray burst sources based on the 5 years of observations with (∼ 10−6 erg/cm2) sensitivity as well as the results of high sensitivity (∼ 10−8 erg/cm2) search for Gamma-Ray Bursts within...
Ore sorting using natural gamma radiation
International Nuclear Information System (INIS)
Clark, G.J.; Dickson, B.L.; Gray, F.E.
1980-01-01
A method of sorting an ore which emits natural gamma radiation is described, comprising the steps of: (a) mining the ore, (b) placing, substantially at the mining location, the sampled or mined ore on to a moving conveyor belt, (c) measuring the natural gamma emission, water content and mass of the ore while the ore is on the conveyor belt, (d) using the gamma, water content and mass measurements to determine the ore grade, and (e) directing the ore to a location characteristic of its grade when it leaves the conveyor belt
Isothermal deformation of gamma titanium aluminide
International Nuclear Information System (INIS)
Srinivasan, R.; Singh, J.P.; Tuval, E.; Weiss, I.
1996-01-01
Gamma titanium aluminide has received considerable attention in recent years from the automotive industry as a potential material for making rotating and reciprocating components to produce a quieter and more efficient engine. The objectives of this study were to identify processing routes for the manufacture of automobile valves from gamma titanium aluminide. The issues considered were microstructure and composition of the material, and processing parameters such as deformation rates, temperatures, and total deformation. This paper examines isothermal deformation of gamma titanium aluminide in order to develop a processing window for this type of material
Prompt gamma-ray activation analysis (PGAA)
International Nuclear Information System (INIS)
Kern, J.
1996-01-01
The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs
Prompt gamma-ray activation analysis (PGAA)
Energy Technology Data Exchange (ETDEWEB)
Kern, J [Fribourg Univ. (Switzerland). Inst. de Physique
1996-11-01
The paper deals with a brief description of the principles of prompt gamma-ray activation analysis (PGAA), with the detection of gamma-rays, the PGAA project at SINQ and with the expected performances. 8 figs., 3 tabs., 10 refs.
Angular correlation for gamma-gamma transitions in 81Br and 83Br nuclei
International Nuclear Information System (INIS)
Matheus, R.
1984-01-01
The directional angular correlation of coincident gamma transitions in 81 Br and 83 Br have been measured following the β - decay of 81 Se(T sub(1/2) = 18.6 min) and 83 Se(T sub(1/2) = 22.6 min) respectively, using Ge(Li) - high purity Ge and Ge(Li)-NaI(Tl) spectrometers. The radioactive sources were prepared by irradiating with neutrons in the IEA-R1 reactor, metallic selenium (natural) to produce 81 Se and samples of metallic selenium enriched (to approx. 90% in 82 Se) to produce 83 Se. Measurements have been carried out for the gamma cascades 260-276 KeV, 290-276 KeV and 552-276 KeV in 81 Br and the gamma cascades 225(510)-356 KeV, 510-356 KeV, 572-(510)-356 KeV, 718-(225)-(510)-356 KeV, 1064-356 KeV, 718-225 KeV, 718-(225)-510 KeV, 836-718 KeV, 718-(225)-866 KeV, 883-718 KeV and 1895-799 KeV in 83 Br. The multipole mixing ratios, σ(E2/M1), were determined for 3 gamma transitions in 81 Br and 11 gamma transitions in 83 Br. In the case of 81 Br present results confirmed some of the earlier results. The spin and parity assignment were made to the majority of levels in 81 Br and 83 Br involved in the present study, some of them confirming the earlier results. A comparison of some of the nuclear properties of the 79 Br, 81 Br and 83 Br is made based on the available experimental data. The experimental results are also discussed qualitatively in terms of some nuclear models applicable for the description of the properties of odd-A bromine isotopes. (Author) [pt
Near stellar sources of gamma-ray bursts
Luchkov, B. I.; Markin, P. D.
2012-01-01
Correlation analysis of gamma-ray burst coordinates and nearby stars, registered on 2008-2011, revealed 5 coincidences with angular accuracy better than 0.1 degree. The random probability is $7\\times 10^{-7}$, so evidencing that coincident stars are indeed gamma-ray burst sources. The proposed method should be continued in order to provide their share in common balance of cosmic gamma-ray bursts.
GALIST, Decay Gamma Spectra Retrieval from ENSDF
International Nuclear Information System (INIS)
Ichimiya, Tsutomu
2002-01-01
Description of program or function: GALIST consists of two main programs, GAMRET and GNOI. - GAMRET retrieves from ENSDF or files with ENSDF-like format gamma rays following radioactive decay. GAMRET uses two auxiliary programs, ENSORT and AMSORT (see below under item 8). - GNOI makes a list of radionuclides and their gamma rays. In the decay data of ENSDF, however, not all gamma-ray intensities are included
Energy Technology Data Exchange (ETDEWEB)
Redon, Christophe E., E-mail: redonc@mail.nih.gov [NIH, NCI, CCR, Laboratory of Molecular Pharmacology, Bethesda, MD 20892 (United States); Nakamura, Asako J.; Gouliaeva, Ksenia [NIH, NCI, CCR, Laboratory of Molecular Pharmacology, Bethesda, MD 20892 (United States); Rahman, Arifur; Blakely, William F. [Armed Forces Radiobiology Research Institute, Uniformed Services University, Bethesda, MD 20889-5603 (United States); Bonner, William M. [NIH, NCI, CCR, Laboratory of Molecular Pharmacology, Bethesda, MD 20892 (United States)
2011-09-15
We previously used the {gamma}-H2AX assay as a biodosimeter for total-body irradiation (TBI) exposure ({gamma}-rays) in a rhesus macaque (Macaca mulatta) model. Utilizing peripheral blood lymphocytes and plucked hairs, we obtained statistically significant {gamma}-H2AX responses days after total-body exposure to 1-8.5 Gy ({sup 60}Co {gamma}-rays at 55 cGy min{sup -1}). Here, we introduce a partial-body exposure analysis method, Q{sub {gamma}-H2AX}, which is based on the number of {gamma}-H2AX foci per damaged cells as evident by having one or more {gamma}-H2AX foci per cell. Results from the rhesus monkey - TBI study were used to establish Q{sub {gamma}-H2AX} dose-response calibration curves to assess acute partial-body exposures. {gamma}-H2AX foci were detected in plucked hairs for several days after in vivo irradiation demonstrating this assay's utility for dose assessment in various body regions. The quantitation of {gamma}-H2AX may provide a robust biodosimeter for analyzing partial-body exposures to ionizing radiation in humans.
Radiation breeding researches in gamma field. Results of researches
International Nuclear Information System (INIS)
Morishita, Toshikazu
2006-01-01
Abstract of radiation breeding researches and outline of gamma field in IRB (Institute of Radiation Breeding) are described. The gamma field is a circular field of 100 m radius with 88.8TBqCo-60 source at the center. The field is surrounded by a shielding dike of 8 m in height. The effects of gamma irradiation on the growing plants, mutant by gamma radiation and plant molecular biological researches using mutant varieties obtained by the gamma field are explained. For examples, Japanese pear, chrysanthemum, Cytisus, Eustoma grandiflorum, Manila grass, tea and rose are reported. The mutant varieties in the gamma field, nine mutant varieties of flower colors in chrysanthemum, evergreen mutant lines in Manila grass, selection of self-compatible mutants in tea plant, and the plants of the gamma field recently are shown. (S.Y.)
Drawing of uranium in {gamma} phase; Filage de l'uranium en phase gamma
Energy Technology Data Exchange (ETDEWEB)
Stohr, J.A. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Chevigny, R. [Conpagnie, Pechiney, 73 - Chambery (France)
1955-07-01
It describes the study of working and drawing of uranium in {gamma} phase. In a first part, the forgeable characteristics of uranium metal in the three different phases ({alpha}, {beta} and {gamma}) are compared by using BASTIEN-PORTEVIN method. The different experiments are testing the behaviour metal in each phase under different stresses and a temperature gradient as slow and shock traction, slow and shock compression, resilience, flexibility. Results show that optimum conditions for uranium drawing is uranium in phase {gamma}. In a second part, it described the drawing method and process. The uranium rods obtained by this technique are of very good quality. In addition, the material wear is very low which permits a low production cost. Finally, the uranium rod physical properties are studied. (M.P.)
Airborne gamma-ray spectrometry
DEFF Research Database (Denmark)
Hovgaard, Jens
A new method - Noise Adjusted Singular Value Decomposition, NASVD - for processing gamma-ray spectra has been developed as part of a Ph.D. project. By using this technique one is able to decompose a large set of data - for example from airborne gamma-ray surveys - into a few spectral components....... By knowing the spectral components and their amplitudes in each of the measured spectra one is able to extract more information from the data than possible with the methods used otherwise....
Characterizing gamma fields using isomeric activation ratios
Venkataraman, Ramkumar; Fleming, Ronald F.
1994-12-01
Isomeric activities were induced in indium by gamma irradiation in three different gamma fields, through the reactions 115In(γ, γ') 115mIn and 113In(γ, γ') 113mIn. The irradiation fields were (i) the 15 kCi 60Co source available in the University, (ii) the spent fuel gamma irradiator in the pool of the University's Ford Nuclear Reactor (FNR) and (iii) south face of the core of the FNR during routine shut downs. Isomeric activation ratios can serve to characterize gamma fields, provided the response functions of the two (γ, γ') reactions sample different energy regimes of the gamma spectrum present in the irradiation fields. The response of an isomeric activation detector, in turn, depends on the number of activation energy levels of the nuclide and the probabilities with which the activation levels de-populate to the isomeric level. The reaction rate ratio RIn115m/ RIn113m was measured in the three gamma fields. The measured ratios were (i) 1.210 ± 0.011 in the 60Co source, (ii) 1.314 ± 0.060 in the spent fuel gamma irradiator and (iii) 1.298 ± 0.039 in a location alongside the FNR core during routine shut downs. The measured reaction rate ratios are not only close to each other, but close to unity as well. This indicates that the excitation functions for the reactions 115In(γ, γ') 115mIn and 113In(γ, γ') 113mIn have similar shapes and that for the nuclides 115In and 113In, the number of activation energy levels and the probabilities with which they populate the isomeric levels are very similar to each other. Thus, the ratio RIn115m/ RIn113m will not yield any information regarding the shape of gamma spectrum in the field of measurement. However by choosing (γ, γ') reactions with different shapes for the excitation functions one can measure a set of isomeric activation ratios that characterize a given gamma field.
Gamma radiation in space and in the atmosphere; Rayonnement gamma dans l'espace et dans l'atmosphere
Energy Technology Data Exchange (ETDEWEB)
Rocchia, R. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1966-07-01
We have shown that the {gamma} radiation existing in the atmosphere is caused mainly by the Bremsstrahlung of the electrons of the electromagnetic cascades ({approx} 50 per cent of the measured radiation), by the 511 keV radiation produced by the annihilation of positrons created in cascades (8 per cent of the measured intensity) and by the Compton {gamma} degradation of this line (30 per cent of the measured intensity). The rest, slightly over 10 per cent, must be attributed to secondary causes such as the nuclear de-excitation {gamma} to the internal Bremsstrahlung of charged particles created in nuclear stars, and to charged particles crossing our detector, since the latter was not fitted with a device for rejecting these particles. Experiments carried out in rockets at Colomb-Bechar confirm these results and have made it possible to detect and measure a primary {gamma} radiation having an intensity of {approx} 2 {gamma} cm{sup 2} s{sup -1} above 100 keV. The primary spectrum obeys an approximate E{sup -2} law. (author) [French] Nous avons montre que le rayonnement {gamma} existant dans l'atmosphere est provoque principalement por le bremsstrohlung des electrons des cascades electromagnetiques ({approx} 50 pour cent du rayonnement mesure), au rayonnement 511 keV provoque par l'annihilation des positrons crees dans les cascades (8 pour cent de l'intensite mesuree) et aux {gamma} de degradation Compton de cette raie (30 pour cent de l'intensite mesuree). Le reste, soit un peu plus de 10 pour cent, doit etre attribue a des causes secondaires telles que les {gamma} de desexcitation nucleaire, le bremsstrahlung interne des particules chargees creees dans les etoiles nucleaires, et aux particules chargees traversant notre detecteur car celui-ci ne comportait pas de dispositif de rejet de ces particules. Les experiences faites en fusees a Colomb-Bechar ont confirme ces resultats et permis de detecter et mesurer un rayonnement {gamma} primaire dont l
In-situ gamma spectrometry method for determination of environmental gamma dose
International Nuclear Information System (INIS)
Conti, Claudio de Carvalho
1995-07-01
This work tries to establish a methodology for germanium detectors calibration, normally used for in situ gamma ray spectrometry, for determining the environmental exposure rate in function of the energy of the incident photons. For this purpose a computer code has been developed, based on the stripping method, for the computational spectra analysis to calculate the contribution of the partial absorption of the gamma rays (Compton effect) in the active and nonactive parts of the detector. The resulting total absorption spectrum is then converted to fluence distribution in function of the energy for the photons reaching the detector, which is then used to calculate the exposure rate or kerma in air. The unfolding and fluency convention parameters are determined by detector calibration using point gamma sources. The method is validated by comparison of the results against the calculated exposure rate at a point of interest for the standards. This method is used for the direct measurement of the exposure rate distribution in function of the energy at the site, in situ measurement technic, leading to rapid results during an emergency situation and also used for indoor measurements. (author)
Complete system for portable gamma spectroscopy
International Nuclear Information System (INIS)
Fuess, D.A.
1978-01-01
The report described a system built around the Computing Gamma Spectrometer (PSA) LEA 74-008. The software primarily supports high-resolution gamma-ray spectroscopy using either a high-purity intrinsic germanium detector (HPGe) or a lithium-drifted germanium detector [Ge(Li)
Energy Technology Data Exchange (ETDEWEB)
Pla, E [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires
1969-07-01
After recalling the various modes of interaction of gamma rays with matter, the authors describe the design of a spectrometer for gamma energies of between 0.3 and 10 MeV. This spectrometer makes use of the Compton and pair-production effects without eliminating them. The collimator, the crystals and the electronics have been studied in detail and are described in their final form. The problem of calibrating the apparatus is then considered ; numerous graphs are given. The sensitivity of the spectrometer for different energies is determined mainly for the 'Compton effect' group. Finally, in the last part of the report, are given results of an experimental measurement of the gamma spectrum of a swimming-pool type reactor with new elements. (author) [French] Apres un rappel des differents modes d'interaction des rayons gamma avec la matiere, nous decrivons la conception d'un spectrometre pour les energies gamma s'etendant de 0,3 a 10 MeV. Ce spectrometre utilise les effets Compton et creation de paires sans les eliminer. Le collimateur, les cristaux et l'electronique sont entierement etudies et decrits dans leur realisation definitive. Ensuite, le probleme de l'etalonnage de l'appareil est envisage; de nombreuses courbes sont donnees. La sensibilite du spectrometre pour les differentes energies est determinee principalement pour le groupe ''effet Compton''. Enfin, les resultats d'une experience de mesure du spectre gamma d'une pile piscine avec elements neufs sont donnes dans la derniere partie. (auteur)
A novel dual mode neutron-gamma imager
International Nuclear Information System (INIS)
Cooper, Robert Lee; Gerling, Mark; Brennan, James S.; Mascarenhas, Nicholas; Mrowka, Stanley; Marleau, Peter
2010-01-01
The Neutron Scatter Camera (NSC) can image fission sources and determine their energy spectra at distances of tens of meters and through significant thicknesses of intervening materials in relatively short times (1). We recently completed a 32 element scatter camera and will present recent advances made with this instrument. A novel capability for the scatter camera is dual mode imaging. In normal neutron imaging mode we identify and image neutron events using pulse shape discrimination (PSD) and time of flight in liquid scintillator. Similarly gamma rays are identified from Compton scatter in the front and rear planes for our segmented detector. Rather than reject these events, we show it is possible to construct a gamma-ray image by running the analysis in a 'Compton mode'. Instead of calculating the scattering angle by the kinematics of elastic scatters as is appropriate for neutron events, it can be found by the kinematics of Compton scatters. Our scatter camera has not been optimized as a Compton gamma-ray imager but is found to work reasonably. We studied imaging performance using a Cs137 source. We find that we are able to image the gamma source with reasonable fidelity. We are able to determine gamma energy after some reasonable assumptions. We will detail the various algorithms we have developed for gamma image reconstruction. We will outline areas for improvement, include additional results and compare neutron and gamma mode imaging.
Development of gallium arsenide gamma spectrometric detector
International Nuclear Information System (INIS)
Kobayashi, T.; Kuru, I.
1975-03-01
GaAs semiconductor material has been considered to be a suitable material for gamma-ray spectrometer operating at room temperature since it has a wid-band gap, larger than that of silicon and germanium. The basic objective of this work is to develop a GaAs gamma-ray spectrometric detector which could be used for gamma spectrometric measurement of uranium and plutonium in nuclear fuel safeguards. Liquid phase epitaxial techniques using iron (Fe) as dopant have been developed in making high purity GaAs crystals suitable for gamma-ray spectrometer operating at room temperature. Concentration of Fe in the epitaxial crystal was controlled by initial growth temperature. The best quality epitaxial crystal was obtained under the following conditions: starting temperature is about 800degC, the proportion of Fe to Ga solvent is 1 to 300. Carrier concentration of epitaxial crystals grown distributed in the ranges of 10 12 cm -3 to 10 14 cm -3 at room temperature. The thickness of the crystals ranged from 38 μm to 120 μm. Au-GaAs surface barrier detector was made of epitaxial crystal. Some of the detector were encapsulated in a can with a 50 μm Be window by welding a can to the detector holder. The detector with high energy resolution and good charge collecting characteristics was selected by alpha spectrometry at room temperature. Energy resolution of the detector for gamma-rays up to about 200 keV was very good at room temperature operation. The best energy resolutions taken with a GaAs detector were 3 keV (fwhm) and 3.8 keV for 241 Am 59.6 keV and 57 Co 122 keV, respectively, at room temperature. In order to study the applicability of the detector for nuclear safeguards, the measurements of 235 U gamma-ray spectrum have been carried out at room temperature. It was clarified that the gamma-ray spectrum of enriched U sample could be measured in high resolution with GaAs detector at room temperature, and that the content of 235 U in enriched U sources could be determined by
Energy Technology Data Exchange (ETDEWEB)
Kim, Y.; Herrmann, H. W.; Mack, J. M.; Young, C. S.; Barlow, D. B.; Schillig, J. B.; Sims, J. R. Jr.; Lopez, F. E.; Mares, D.; Oertel, J. A.; Hayes-Sterbenz, A. C. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Hilsabeck, T. J.; Wu, W. [General Atomics, PO Box 85608, San Diego, California 92186 (United States); Moy, K. [National Security Technologies, Special Technologies Laboratory, Santa Barbara, California 93111 (United States); Stoeffl, W. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)
2012-10-15
The gamma-to-electron magnetic spectrometer, having better than 5% energy resolution, is proposed to resolve {gamma}-rays in the range of E{sub o}{+-} 20% in single shot, where E{sub o} is the central energy and is tunable from 2 to 25 MeV. Gamma-rays from inertial confinement fusion implosions interact with a thin Compton converter (e.g., beryllium) located at approximately 300 cm from the target chamber center (TCC). Scattered electrons out of the Compton converter enter an electromagnet placed outside the NIF chamber (approximately 600 cm from TCC) where energy selection takes place. The electromagnet provides tunable E{sub o} over a broad range in a compact manner. Energy resolved electrons are measured by an array of quartz Cherenkov converters coupled to photomultipliers. Given 100 detectable electrons in the energy bins of interest, 3 Multiplication-Sign 10{sup 14} minimum deuterium/tritium (DT) neutrons will be required to measure the 4.44 MeV {sup 12}C {gamma}-rays assuming 200 mg/cm{sup 2} plastic ablator areal density and 3 Multiplication-Sign 10{sup 15} minimum DT neutrons to measure the 16.75 MeV DT {gamma}-ray line.
The gamma knife in ophthalmology. Part One--Uveal melanoma.
Wygledowska-Promieńska, Dorota; Jurys, Małgorzata; Wilczyński, Tomasz; Drzyzga, Łukasz
2014-01-01
The Gamma Knife was designed by Lars Leksell in the early 1950's. It gave rise to a new discipline of medicine--stereotactic radiosurgery. Primarily dedicated to neurosurgery, the Gamma Knife has become an alternative, widely used surgery technique. According to Elekta's statistics, approximately 60,000 people are treated with Leksell Gamma Knife every year and it is the most extensively studied stereotactic radiosurgery system in the world. The Leksell Gamma Knife can also be used in ophthalmology. The gamma ray beam concentration enables effective treatment of uveal melanoma, choroidal hemangioma, orbital tumors or even choroidal neovascularization. The virtue of Leksell Gamma Knife is its extreme precision, non-invasiveness and the possibility of outpatient treatment, which significantly reduces costs and diminishes post-operative complications. Innovative solutions shorten a single session to a minimum, which is very comfortable and safe for both staff and patients. Advantages and possible side effects of gamma knife radiosurgery are well-documented in the professional literature. The objective of this review is to present the recognized applications of Leksell Gamma Knife in ophthalmology.
Energy Technology Data Exchange (ETDEWEB)
Anashin, V.V. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Aulchenko, V.M. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Novosibirsk State University, 2, Pirogova street, Novosibirsk, 630090 (Russian Federation); Baldin, E.M., E-mail: E.M.Baldin@inp.nsk.s [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Novosibirsk State University, 2, Pirogova street, Novosibirsk, 630090 (Russian Federation); Barladyan, A.K.; Barnyakov, A.Yu.; Barnyakov, M.Yu. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Baru, S.E. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Novosibirsk State University, 2, Pirogova street, Novosibirsk, 630090 (Russian Federation); Bedny, I.V. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Beloborodova, O.L. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Novosibirsk State University, 2, Pirogova street, Novosibirsk, 630090 (Russian Federation); Blinov, A.E. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Blinov, V.E. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation); Novosibirsk State Technical University, 20, Karl Marx prospect, Novosibirsk, 630092 (Russian Federation); Bobrov, A.V.; Bobrovnikov, V.S. [Budker Institute of Nuclear Physics, 11, akademika Lavrentieva prospect, Novosibirsk, 630090 (Russian Federation)
2010-03-01
The products of the electron width of the J/psi meson and the branching fraction of its decays to the lepton pairs were measured using data from the KEDR experiment at the VEPP-4M electron-positron collider. The results are GAMMA{sub ee}xGAMMA{sub ee}/GAMMA=0.3323+-0.0064(stat.)+-0.0048(syst.) keV, GAMMA{sub ee}xGAMMA{sub m}u{sub m}u/GAMMA=0.3318+-0.0052(stat.)+-0.0063(syst.) keV. Their combinations GAMMA{sub ee}x(GAMMA{sub ee}+GAMMA{sub m}u{sub m}u)/GAMMA=0.6641+-0.0082(stat.)+-0.0100(syst.) keV, GAMMA{sub ee}/GAMMA{sub m}u{sub m}u=1.002+-0.021(stat.)+-0.013(syst.) can be used to improve the accuracy of the leptonic and full widths and test leptonic universality. Assuming emu universality and using the world average value of the lepton branching fraction, we also determine the leptonic GAMMA{sub ll}=5.59+-0.12 keV and total GAMMA=94.1+-2.7 keV widths of the J/psi meson.
Abnormal X : autosome ratio, but normal X chromosome inactivation in human triploid cultures
Directory of Open Access Journals (Sweden)
Norwood Thomas H
2006-07-01
Full Text Available Abstract Background X chromosome inactivation (XCI is that aspect of mammalian dosage compensation that brings about equivalence of X-linked gene expression between females and males by inactivating one of the two X chromosomes (Xi in normal female cells, leaving them with a single active X (Xa as in male cells. In cells with more than two X's, but a diploid autosomal complement, all X's but one, Xa, are inactivated. This phenomenon is commonly thought to suggest 1 that normal development requires a ratio of one Xa per diploid autosomal set, and 2 that an early event in XCI is the marking of one X to be active, with remaining X's becoming inactivated by default. Results Triploids provide a test of these ideas because the ratio of one Xa per diploid autosomal set cannot be achieved, yet this abnormal ratio should not necessarily affect the one-Xa choice mechanism for XCI. Previous studies of XCI patterns in murine triploids support the single-Xa model, but human triploids mostly have two-Xa cells, whether they are XXX or XXY. The XCI patterns we observe in fibroblast cultures from different XXX human triploids suggest that the two-Xa pattern of XCI is selected for, and may have resulted from rare segregation errors or Xi reactivation. Conclusion The initial X inactivation pattern in human triploids, therefore, is likely to resemble the pattern that predominates in murine triploids, i.e., a single Xa, with the remaining X's inactive. Furthermore, our studies of XIST RNA accumulation and promoter methylation suggest that the basic features of XCI are normal in triploids despite the abnormal X:autosome ratio.
The Animated Gamma-ray Sky Revealed by the Fermi Gamma-ray Space Telescope
International Nuclear Information System (INIS)
Grenier, Isabelle
2009-01-01
The Fermi Gamma-ray Space Telescope has been observing the sky in gamma-rays since August 2008. In addition to breakthrough capabilities in energy coverage (20 MeV-300 GeV) and angular resolution, the wide field of view of the Large Area Telescope enables observations of 20% of the sky at any instant, and of the whole sky every three hours. It has revealed a very animated sky with bright gamma-ray bursts flashing and vanishing in minutes, powerful active galactic nuclei flaring over hours and days, many pulsars twinkling in the Milky Way, and X-ray binaries shimmering along their orbit. Most of these variable sources had not been seen by the Fermi predecessor, EGRET, and the wealth of new data already brings important clues to the origin of the high-energy emission and particles powered by the compact objects. The telescope also brings crisp images of the bright gamma-ray emission produced by cosmic-ray interactions in the interstellar medium, thus allowing to measure the cosmic nuclei and electron spectra across the Galaxy, to weigh interstellar clouds, in particular in the dark-gas phase. The telescope sensitivity at high energy will soon provide useful constraints on dark-matter annihilations in a variety of environments. I will review the current results and future prospects of the Fermi mission.
A study on gamma rays from electrochemical cells
International Nuclear Information System (INIS)
Shin, Seung Ai
1993-01-01
The energies and intensities of gamma rays emitted from 3 cells with Pd-cathodes of φ 1mm x 10mm, φ 2mm x 20mm, φ 1mm x 10mm were determined using HPGe-detector system and compared with Pd-neutron capture model. Very strong gamma rays of 512keC, 622keC, 1051keC and 8 more important ones were found to be identical with characteristic gamma rays of 106 Pd and 109 Pd. It is likely that the neutron capture reaction, A PD(n, γ) A+1 Pd, occurred in the cell and the neutrons came from the fusion reaction of two deutrons. It is necessary, however, to retest the model since another strong 84keV-gamma rays do not belong to any A+1 Pd-gamma spectra and two important 106 Pd-gamma rays 717keV, 1046KeV were not detected. Total amount of emitted gamma rays was large when the size of the Pd-cathod was large. Its depedence on the time of measurement and the preheating period did not have any regularities. Thus the replication is not an easy thing. (Author)
BFKL resummation effects in {gamma}{sup *}{gamma}{sup *}{yields}{rho}{rho}
Energy Technology Data Exchange (ETDEWEB)
Enberg, R. [Ecole Polytechnique, CPHT, Palaiseau (France); Lawrence Berkeley National Laboratory, Berkeley (United States); Pire, B. [Ecole Polytechnique, CPHT, Palaiseau (France); Szymanowski, L. [Soltan Institute for Nuclear Studies, Warsaw (Poland); Universite de Liege, Liege (Belgium); Wallon, S. [LPT, Universite Paris-Sud, Orsay (France)
2006-03-15
We calculate the leading order BFKL amplitude for the exclusive diffractive process {gamma}{sup *}{sub L}(Q{sub 1}{sup 2}){gamma}{sup *}{sub L}(Q{sub 2}{sup 2}){yields}{rho}{sub L}{sup 0}{rho}{sub L}{sup 0} in the forward direction, which can be studied in future high energy e{sup +}e{sup -} linear colliders. The resummation effects are very large compared to the fixed-order calculation. We also estimate the next-to-leading logarithmic corrections to the amplitude by using a specific resummation of higher order effects and find a substantial growth with energy, but smaller than in the leading logarithmic approximation. (orig.)
Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo
2013-08-01
Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models.
International Nuclear Information System (INIS)
Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo
2013-01-01
Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models
Apparatus for gamma radiography
International Nuclear Information System (INIS)
1983-06-01
The aim of the present standard is to fix the rules for the construction of gamma radiography instrumentation without prejudice to the present regulations. These apparatus have to be fitted with only sealed sources conformable to the experimental standard M 61-002. The present standard agrees with the international standard ISO 3999 of 1977 dealing with the same subject. Nevertheless, it is different on the three main following points: it does not accept the same limits of absorbed dose rates in the air calculated on the external surface of projectors; it precribes tightness, bending, crushing and tensile tests for some components of the gamma radiography it prescribes tests of endurance and resistance to breaking for the locking systems of the gamma radiography apparatus. The present standard also specifies the following points: symbols and indications to put on projectors and on the source-holder; identification of the source contained in the projector; and, accompanying documents. The regulation references are given in annexe [fr
High energy gamma-ray production in nuclear reactions
International Nuclear Information System (INIS)
Pinston, J.A.; Nifenecker, H.; Nifenecker, H.
1989-01-01
Experimental techniques used to study high energy gamma-ray production in nuclear reactions are reviewed. High energy photon production in nucleus-nucleus collisions is discussed. Semi-classical descriptions of the nucleus-nucleus gamma reactions are introduced. Nucleon-nucleon gamma cross sections are considered, including theoretical aspects and experimental data. High energy gamma ray production in proton-nucleus reactions is explained. Theoretical explanations of photon emission in nucleus-nucleus collisions are treated. The contribution of charged pion currents to photon production is mentioned
Inspection of high density materials by means of X and gamma radiography and X and gamma radioscopy
International Nuclear Information System (INIS)
Deleuze, M.
1985-11-01
We present the tests carried out on uranium for a comparative evaluation of the capabilities and limitations of gamma radiography and X and gamma radioscopy. The following comparison subjects are: the exposure and inspection times of uranium pieces from exposure charts, the radiographic contrast, the sensitivity of defect detection, the choice of radiation source. Theses tests made it possible to determine the limiting thicknesses of uranium able to be inspected by these two techniques. Accordingly, we decided to exchange 192 Ir gamma radiography for a 420 kV X radioscopy and radiography
Gamma spectrometry of EFTTRA T2BIS R280.2. Gamma scan wires 6 through 10
International Nuclear Information System (INIS)
Dassel, G.; Buurveld, H.A.; Plakman, J.C.
1996-11-01
In the frame work of the EFTTRA programme on recycling of actinides and fission products, five gamma scan wires which were included in the experiment R280.2 T2bis have been examined by gamma scanning. The results of the measurements have been described in this report. (orig.)
Evaluation of gamma-ray intensities
International Nuclear Information System (INIS)
Yoshizawa, Yasukazu; Inoue, Hikaru; Hoshi, Masaharu; Shizuma, Kiyoshi; Iwata, Yosei.
1980-04-01
Relative intensities and intensities per decay of gamma rays were evaluated for 16 nuclides, 22 Na, 24 Na, 46 Sc, 54 Mn, 60 Co, 85 Sr, 88 Y, 95 Nb, sup(108m)Ag, 134 Cs, 133 Ba, 139 Ce, sup(180m)Hf, 198 Au, 203 Hg and 207 Bi. For most of these nuclides disintegration rates can be determined by means of β-γ or X-γ coincidence method. Since decay schemes of these nuclides are established, intensities per decay of strong gamma rays were accurately evaluated by using weak beta-ray branching ratios, relative gamma-ray intensities and internal conversion coefficients. Half-lives of the nuclides were also evaluated. Use of the nuclides, therefore, are recommended for precision intensity calibration of the detectors. (author)
Shock response of a gamma titanium aluminide
International Nuclear Information System (INIS)
Shazly, Mostafa; Prakash, Vikas
2008-01-01
Potential use of γ-TiAl alloys in aerospace and other structural applications require knowledge of their impact behavior for better evaluation and modeling. In the present study plate impact experiments are conducted using a single-stage gas gun to better understand the shock behavior of the recently developed class of gamma titanium aluminide alloys--the Gamma-Met PX. The Gamma-Met PX showed superior shock properties when compared to the conventional titanium aluminide alloys. The spall strength of Gamma-Met PX is 1.8±0.09 GPa, which is four to six times higher than those reported for other gamma titanium aluminide alloys. Moreover, it has a Hugoniot elastic limit of 1.88 GPa at a target thickness of 3.86 mm, which drops to 1.15 GPa at target thickness of 15.8 mm. The decay in the elastic precursor is continuous without showing an asymptote to a constant level within the range of target thicknesses studied
Gamma ray energy tracking in GRETINA
Lee, I. Y.
2011-10-01
The next generation of stable and exotic beam accelerators will provide physics opportunities to study nuclei farther away from the line of stability. However, these experiments will be more demanding on instrumentation performance. These come from the lower production rate for more exotic beams, worse beam impurities, and large beam velocity from the fragmentation and inverse reactions. Gamma-ray spectroscopy will be one of the most effective tools to study exotic nuclei. However, to fully exploit the physics reach provided by these new facilities, better gamma-ray detector will be needed. In the last 10 years, a new concept, gamma-ray energy tracking array, was developed. Tracking arrays will increase the detection sensitivity by factors of several hundred compared to current arrays used in nuclear physics research. Particularly, the capability of reconstructing the position of the interaction with millimeters resolution is needed to correct the Doppler broadening of gamma rays emitted from high velocity nuclei. GRETINA is a gamma-ray tracking array which uses 28 Ge crystals, each with 36 segments, to cover ¼ of the 4 π of the 4 π solid angle. The gamma ray tracking technique requires detailed pulse shape information from each of the segments. These pulses are digitized using 14-bit 100 MHz flash ADCs, and digital signal analysis algorithms implemented in the on-board FPGAs provides energy, time and selection of pulse traces. A digital trigger system, provided flexible trigger functions including a fast trigger output, and also allows complicated trigger decisions to be made up to 20 microseconds. Further analyzed, carried out in a computer cluster, determine the energy, time, and three-dimensional positions of all gamma-ray interactions in the array. This information is then utilized, together with the characteristics of Compton scattering and pair-production processes, to track the scattering sequences of the gamma rays. GRETINA construction is completed in
Pathways to Adolescent Substance Use among Sexually Abused Girls.
Bailey, Jennifer A.; McCloskey, Laura Ann
2005-01-01
This study examined the link between childhood sexual abuse and adolescent substance use among girls, and evaluated depressive self-concept and behavioral under-control (BUC) as pathways to substance use for sexually abused girls. Participants (n = 150) were drawn from a longitudinal study of the impact of domestic violence on the lives of women…
Gamma ray imager on the DIII-D tokamak
Energy Technology Data Exchange (ETDEWEB)
Pace, D. C., E-mail: pacedc@fusion.gat.com; Taussig, D.; Eidietis, N. W.; Van Zeeland, M. A.; Watkins, M. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Cooper, C. M. [Oak Ridge Associated Universities, Oak Ridge, Tennessee 37830 (United States); Hollmann, E. M. [University of California-San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Riso, V. [State University of New York-Buffalo, 12 Capen Hall, Buffalo, New York 14260-1660 (United States)
2016-04-15
A gamma ray camera is built for the DIII-D tokamak [J. Luxon, Nucl. Fusion 42, 614 (2002)] that provides spatial localization and energy resolution of gamma flux by combining a lead pinhole camera with custom-built detectors and optimized viewing geometry. This diagnostic system is installed on the outer midplane of the tokamak such that its 123 collimated sightlines extend across the tokamak radius while also covering most of the vertical extent of the plasma volume. A set of 30 bismuth germanate detectors can be secured in any of the available sightlines, allowing for customizable coverage in experiments with runaway electrons in the energy range of 1–60 MeV. Commissioning of the gamma ray imager includes the quantification of electromagnetic noise sources in the tokamak machine hall and a measurement of the energy spectrum of background gamma radiation. First measurements of gamma rays coming from the plasma provide a suitable testbed for implementing pulse height analysis that provides the energy of detected gamma photons.
Radiosurgery with the gamma knife; Radiochirurgie mit dem Gamma-Knife
Energy Technology Data Exchange (ETDEWEB)
Wowra, B.; Reulen, H.J.
1996-05-10
Radiosurgery is a novel modality introduced by the neurosurgeon Lars Leksell. For the most important lesions, (arteriovenous angiomas, benign tumors in the base of the skull, formation of metastases in the brain), radiosurgery is a valuable additional tool in the range of therapies available to the benefit of patients. The gamma knife has been gaining a leading rank in the range of therapies applied in Germany. (orig.) [Deutsch] Radiochirurgie ist ein neues, von dem Neurochirurgen Lars Leksell konzipiertes Prinzip. Bei den wichtigsten Indikationen (arteriovenoese Angiome, gutartige Tumoren der Schaedelbasis, Hirnmetastasen etc.) bereichert und ergaenzt die Radiochirurgie das therapeutische Arsenal der Neurochirurgie zum Vorteil der Patienten betraechtlich. Dem Gamma-Knife kommt jetzt auch in Deutschland ein prominenter Platz unter den verschiedenen radiochirurgischen Verfahren zu. (orig.)
Physics and astrophysics with gamma-ray telescopes
Energy Technology Data Exchange (ETDEWEB)
Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)
2012-08-15
In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.
The making of analog module for gamma camera interface
International Nuclear Information System (INIS)
Yulinarsari, Leli; Rl, Tjutju; Susila, Atang; Sukandar
2003-01-01
The making of an analog module for gamma camera has been conducted. For computerization of planar gamma camera 37 PMT it has been developed interface hardware technology and software between the planar gamma camera with PC. With this interface gamma camera image information (Originally analog signal) was changed to digital single, therefore processes of data acquisition, image quality increase and data analysis as well as data base processing can be conducted with the help of computers, there are three gamma camera main signals, i.e. X, Y and Z . This analog module makes digitation of analog signal X and Y from the gamma camera that conveys position information coming from the gamma camera crystal. Analog conversion to digital was conducted by 2 converters ADC 12 bit with conversion time 800 ns each, conversion procedure for each coordinate X and Y was synchronized using suitable strobe signal Z for information acceptance
Buzi, L.; De Temmerman, G.; Unterberg, B.; M. Reinhart,; Dittmar, T.; Matveev, D.; Linsmeier, C.; Breuer, U.; Kreter, A.; Van Oost, G.
2015-01-01
The influence of surface temperature, particle flux density and material microstructure on the surface morphology and deuterium retention was studied by exposing tungsten targets (20xa0;μm and 40xa0;μm grain size) to deuterium plasma at the same particle fluence (1026xa0;m−2) and
Physical principles of neutron-gamma materials monitoring
Pekarskii, G. Sh.
1986-03-01
The physical principles of secondary radiation methods in nondestructive testing are discussed. Among the techniques considered are: neutron activation analysis (NAA); the induced-radiation method; and quasialbedo recording of secondary gamma-radiation. Emphasis is given to the neutron-gamma method which consists of exposing test material to a neutron flux and recording the secondary gamma-radiation by means of a spectrometer. The limitations of the method in detecting local inhomogeneous defects (filled pores cracks, and inclusions) in metal layers and multicomponents materials are described, and some advantages of the method over NAA are discussed. Formulas are derived for estimating the optimum density of the gamma-ray flux which is received by the detector.
Coincidence gamma-ray spectrometry
DEFF Research Database (Denmark)
Markovic, Nikola; Roos, Per; Nielsen, Sven Poul
2017-01-01
Gamma-ray spectrometry with high-purity germanium (HPGe) detectors is often the technique of choice in an environmental radioactivity laboratory. When measuring environmental samples associated activities are usually low so an important parameter that describes the performance of the spectrometer...... for a nuclide of interest is the minimum detectable activity (MDA). There are many ways for lowering the MDAs in gamma spectrometry. Recently, developments of fast and compact digital acquisition systems have led to growing number of multiple HPGe detector spectrometers. In these applications all detected...
Sp. Radicis-Lycopersici Using Mixture of Vegetable and Posidonia oceanica Compost
Directory of Open Access Journals (Sweden)
S. Kouki
2012-01-01
Full Text Available A compost of vegetable waste and Posidonia oceanica mixture (70 : 30% vol : vol was tested in vitro and in vivo for its efficacy against Fusarium oxysporum f.sp radicis-lycopersici (Forl, the causal agent of Fusarium wilt of Tomato (Lycopersicon esculentum cv. chourouk.The incorporation of non-sterilized VPC in the culture medium showed potent antifungal activity against Forl and complete inhibition of mycelium growth was observed for all the tested compost rates (0.5, 1, 2, 4, 6, 8, 10, 15 and 20%. However, only the highest rates (15 and 20% of a sterilized suspension of VPC were effective in preventing mycelial growth. Nine indigenous bacterial strains isolated from VPC exhibited antagonism against Forl. Based on 16S rDNA sequence analysis, the isolates were assigned to Bacillus sphaericus (B12 and BS2, Pseudomonas putida PPS7 and Burkholderia gladioli BuC16. Under green house condition, seed inoculation by B12, BS2, PP7 and BuC16 strains protected significantly tomato against Fusarium oxysporum f.sp radicis-lycopersici (Forl attacks.
Development of gamma camera and application to decontamination
International Nuclear Information System (INIS)
Yoshida, Akira; Moro, Eiji; Takahashi, Isao
2013-01-01
A gamma camera has been developed to support recovering from the contamination caused by the accident of Fukushima Dai-ichi Nuclear Power Plant of Tokyo Electric Power Company. The gamma camera enables recognition of the contamination by visualizing radioactivity. The gamma camera has been utilized for risk communication (explanation to community resident) at local governments in Fukushima. From now on, the gamma camera will be applied to solve decontaminations issues; improving efficiency of decontamination, visualizing the effect of decontamination work and reducing radioactive waste. (author)
Gamma-Ray Bursts: 4th Huntsville Symposium. Proceedings
International Nuclear Information System (INIS)
Meegan, C.A.; Preece, R.D.; Koshut, T.M.
1998-01-01
These proceedings represent papers presented at the Fourth Huntsville Gamma-Ray Bursts Symposium held in September, 1997 in Huntsville, Alabama, USA. This conference occurred at a crucial time in the history of the gamma-ray burst research. In early 1997, 30 years after the detection of the first gamma-ray burst by the Vela satellites, counterparts to bursts were finally detected at optical and radio wavelengths. The symposium attracted about 200 scientists from 16 countries. Some of the topics discussed include gamma-ray burst spectra, x-ray observations, optical observations, radio observations, host galaxies, shocks and afterglows and models of gamma-ray bursts. There were 183 papers presented, out of these, 16 have been abstracted for the Energy Science and Technology database
Found: A Galaxy's Missing Gamma Rays
Kohler, Susanna
2016-04-01
Recent reanalysis of data from the Fermi Gamma-ray Space Telescope has resulted in the first detection of high-energy gamma rays emitted from a nearby galaxy. This discovery reveals more about how supernovae interact with their environments.Colliding Supernova RemnantAfter a stellar explosion, the supernovas ejecta expand, eventually encountering the ambient interstellar medium. According to models, this generates a strong shock, and a fraction of the kinetic energy of the ejecta is transferred into cosmic rays high-energy radiation composed primarily of protons and atomic nuclei. Much is still unknown about this process, however. One open question is: what fraction of the supernovas explosion power goes into accelerating these cosmic rays?In theory, one way to answer this is by looking for gamma rays. In a starburst galaxy, the collision of the supernova-accelerated cosmic rays with the dense interstellar medium is predicted to produce high-energy gamma rays. That radiation should then escape the galaxy and be visible to us.Pass 8 to the RescueObservational tests of this model, however, have beenstumped by Arp 220. This nearby ultraluminous infrared galaxy is the product of a galaxy merger ~700 million years ago that fueled a frenzy of starbirth. Due to its dusty interior and extreme levels of star formation, Arp 220 has long been predicted to emit the gamma rays produced by supernova-accelerated cosmic rays. But though weve looked, gamma-ray emission has never been detected from this galaxy until now.In a recent study, a team of scientists led by Fang-Kun Peng (Nanjing University) reprocessed 7.5 years of Fermi observations using the new Pass 8 analysis software. The resulting increase in resolution revealed the first detection of GeV emission from Arp 220!Acceleration EfficiencyGamma-ray luminosity vs. total infrared luminosity for LAT-detected star-forming galaxies and Seyferts. Arp 220s luminosities are consistent with the scaling relation. [Peng et al. 2016
A matrix-inversion method for gamma-source mapping from gamma-count data - 59082
International Nuclear Information System (INIS)
Bull, Richard K.; Adsley, Ian; Burgess, Claire
2012-01-01
Gamma ray counting is often used to survey the distribution of active waste material in various locations. Ideally the output from such surveys would be a map of the activity of the waste. In this paper a simple matrix-inversion method is presented. This allows an array of gamma-count data to be converted to an array of source activities. For each survey area the response matrix is computed using the gamma-shielding code Microshield [1]. This matrix links the activity array to the count array. The activity array is then obtained via matrix inversion. The method was tested on artificially-created arrays of count-data onto which statistical noise had been added. The method was able to reproduce, quite faithfully, the original activity distribution used to generate the dataset. The method has been applied to a number of practical cases, including the distribution of activated objects in a hot cell and to activated Nimonic springs amongst fuel-element debris in vaults at a nuclear plant. (authors)
International Nuclear Information System (INIS)
Tschunt, E.; Platz, W.; Baer, Ul; Heinz, L.
1978-01-01
A gamma camera has a plurality of exchangeable collimators, one of which is replaceably mounted in the ray inlet opening of the camera, while the others are placed on separate supports. Supports are swingably mounted upon a column one above the other
Recent progress in low-level gamma imaging
International Nuclear Information System (INIS)
Mahe, C.; Girones, Ph.; Lamadie, F.; Le Goaller, C.
2007-01-01
The CEA's Aladin gamma imaging system has been operated successfully for several years in nuclear plants and during decommissioning projects with additional tools such as gamma spectrometry detectors and dose rate probes. The radiological information supplied by these devices is becoming increasingly useful for establishing robust and optimized decommissioning scenarios. Recent technical improvements allow this gamma imaging system to be operated in low-level applications and with shorter acquisition times suitable for decommissioning projects. The compact portable system can be used in places inaccessible to operators. It is quick and easy to implement, notably for onsite component characterization. Feasibility trials and in situ measurements were recently carried out under low-level conditions, mainly on waste packages and glove boxes for decommissioning projects. This paper describes recent low-level in situ applications. These characterization campaigns mainly concerned gamma emitters with γ energy < 700 keV. In many cases, the localization of hot spots by gamma camera was confirmed by additional measurements such as dose rate mapping and gamma spectrometry measurements. These complementary techniques associated with advanced calculation codes (MCNP, Mercure 6.2, Visiplan and Siren) offer a mobile and compact tool for specific assessment of waste packages and glove boxes. (authors)
Handbook on Mobile Gamma-ray Spectrometry
DEFF Research Database (Denmark)
Aage, Helle Karina; Korsbech, Uffe C C
2003-01-01
Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing......Basic physics and mathematics for Airborne and Car-borne Gamma-ray Spectrometry supplemented with practical examples and methods for advanced data processing...
Mu, Nan
Materials for high-pressure turbine blades must be able to operate in the high-temperature gases (above 1000°C) emerging from the combustion chamber. Accordingly, the development of nickel-based superalloys has been constantly motivated by the need to have improved engine efficiency, reliability and service lifetime under the harsh conditions imposed by the turbine environment. However, the melting point of nickel (1455°C) provides a natural ceiling for the temperature capability of nickel-based superalloys. Thus, surface-engineered turbine components with modified diffusion coatings and overlay coatings are used. Theses coatings are capable of forming a compact and adherent oxide scale, which greatly impedes the further transport of reactants between the high-temperature gases and the underlying metal and thus reducing attack by the atmosphere. Typically, these coatings contain beta-NiAl as a principal constituent phase in order to have sufficient aluminum content to form an Al2O3 scale at elevated temperatures. The drawbacks to the currently-used beta-based coatings, such as phase instabilities, associated stresses induced by such phase instabilities, and extensive coating/substrate interdiffusion, are major motivations in this study to seek next-generation coatings. The high-temperature oxidation resistance of novel Pt+Hf-modified gamma-Ni+gamma'-Ni 3Al-based alloys and coatings were investigated in this study. Both early-stage and 4-days isothermal oxidation behavior of single-phase gamma-Ni and gamma'-Ni3Al alloys were assessed by examining the weight changes, oxide-scale structures, and elemental concentration profiles through the scales and subsurface alloy regions. It was found that Pt promotes Al 2O3 formation by suppressing the NiO growth on both gamma-Ni and gamma'-Ni3Al single-phase alloys. This effect increases with increasing Pt content. Moreover, Pt exhibits this effect even at lower temperatures (˜970°C) in the very early stage of oxidation. It
Egret observations of the extragalactic gamma-ray emission
DEFF Research Database (Denmark)
Sreekumar, P.; Bertsch, D.L.; Dingus, B.L.
1998-01-01
The all-sky survey in high-energy gamma rays (E > 30 MeV) carried out by EGRET aboard the Compton Gamma Ray Observatory provides a unique opportunity to examine in detail the diffuse gamma-ray emission. The observed diffuse emission has a Galactic component arising from cosmic-ray interactions wi...
Contribution to gamma ray transport calculation in heterogeneous media
International Nuclear Information System (INIS)
Bourdet, L.
1985-04-01
This thesis presents the development of gamma transport calculation codes in three dimension heterogeneous geometries. These codes allow us to define the protection against gamma-rays or verify their efficiency. The laws that govern the interactions of gamma-rays with matters are briefly revised. A library with the all necessary constants for these codes is created. TRIPOLI-2, a code that treats in exact way the neutron transport in matters using Monte-Carlo method, has been adapted to deal with the transport of gamma-rays in matters as well. TRINISHI, a code which considers only one collision, has been realized to treat heterogeneous geometries containing voids. Elaborating a formula that calculates the albedo for gamma-ray reflection (the code ALBANE) allows us to solve the problem of gamma-ray reflection on plane surfaces. NARCISSE-2 deals with gamma-rays that suffer only one reflection on the inner walls of any closed volume (rooms, halls...) [fr
Gamma model and its analysis for phase measuring profilometry.
Liu, Kai; Wang, Yongchang; Lau, Daniel L; Hao, Qi; Hassebrook, Laurence G
2010-03-01
Phase measuring profilometry is a method of structured light illumination whose three-dimensional reconstructions are susceptible to error from nonunitary gamma in the associated optical devices. While the effects of this distortion diminish with an increasing number of employed phase-shifted patterns, gamma distortion may be unavoidable in real-time systems where the number of projected patterns is limited by the presence of target motion. A mathematical model is developed for predicting the effects of nonunitary gamma on phase measuring profilometry, while also introducing an accurate gamma calibration method and two strategies for minimizing gamma's effect on phase determination. These phase correction strategies include phase corrections with and without gamma calibration. With the reduction in noise, for three-step phase measuring profilometry, analysis of the root mean squared error of the corrected phase will show a 60x reduction in phase error when the proposed gamma calibration is performed versus 33x reduction without calibration.
Bisensory stimulation increases gamma-responses over multiple cortical regions.
Sakowitz, O W; Quiroga, R Q; Schürmann, M; Başar, E
2001-04-01
In the framework of the discussion about gamma (approx. 40 Hz) oscillations as information carriers in the brain, we investigated the relationship between gamma responses in the EEG and intersensory association. Auditory evoked potentials (AEPs) and visual evoked potentials (VEPs) were compared with bisensory evoked potentials (BEPs; simultaneous auditory and visual stimulation) in 15 subjects. Gamma responses in AEPs, VEPs and BEPs were assessed by means of wavelet decomposition. Overall maximum gamma-components post-stimulus were highest in BEPs (P < 0.01). Bisensory evoked gamma-responses also showed significant central, parietal and occipital amplitude-increases (P < 0.001, P < 0.01, P < 0.05, respectively; prestimulus interval as baseline). These were of greater magnitude when compared with the unisensory responses. As a correlate of the marked gamma responses to bimodal stimulation we suggest a process of 'intersensory association', i.e. one of the steps between sensory transmission and perception. Our data may be interpreted as a further example of function-related gamma responses in the EEG.
The gamma knife: Dose and risk evaluation
International Nuclear Information System (INIS)
Jones, E.D.; Alesso, H.P.; Banks, W.W.; Rathbun, P.A.
1992-01-01
This paper outlines a risk analysis approach designed to identify and assess most likely failure modes and high-risk, human initiated actions for nuclear medical devices. This approach is being developed under the auspices of the US Nuclear Regulatory Commission, Office of Nuclear Material Safety and Safeguards. The methodology is initiated intended to assess risk associated with the use of the Leksell Gamma Unit (LGU) or gamma knife, a gamma stereotactic radiosurgical device
International Nuclear Information System (INIS)
Batista, Wagner Fonseca; Zamboni, Cibele Bugno
2009-01-01
This study of the 127 Te β - decay was carried out by means of gamma spectroscopy measurements using high resolution Ge detector, in the region from 150 keV up to 1000 keV, aiming to get a better understanding of the 127 Te nuclear structure. Several gamma transitions were confirmed when compared with those published in the last compilation. These data resulting in lower uncertainty. (author)
Human gamma oscillations during slow wave sleep.
Directory of Open Access Journals (Sweden)
Mario Valderrama
Full Text Available Neocortical local field potentials have shown that gamma oscillations occur spontaneously during slow-wave sleep (SWS. At the macroscopic EEG level in the human brain, no evidences were reported so far. In this study, by using simultaneous scalp and intracranial EEG recordings in 20 epileptic subjects, we examined gamma oscillations in cerebral cortex during SWS. We report that gamma oscillations in low (30-50 Hz and high (60-120 Hz frequency bands recurrently emerged in all investigated regions and their amplitudes coincided with specific phases of the cortical slow wave. In most of the cases, multiple oscillatory bursts in different frequency bands from 30 to 120 Hz were correlated with positive peaks of scalp slow waves ("IN-phase" pattern, confirming previous animal findings. In addition, we report another gamma pattern that appears preferentially during the negative phase of the slow wave ("ANTI-phase" pattern. This new pattern presented dominant peaks in the high gamma range and was preferentially expressed in the temporal cortex. Finally, we found that the spatial coherence between cortical sites exhibiting gamma activities was local and fell off quickly when computed between distant sites. Overall, these results provide the first human evidences that gamma oscillations can be observed in macroscopic EEG recordings during sleep. They support the concept that these high-frequency activities might be associated with phasic increases of neural activity during slow oscillations. Such patterned activity in the sleeping brain could play a role in off-line processing of cortical networks.
Performance of BICM-based QAM-SIM OWC over gamma-gamma turbulence channels
Malik, Muhammad Talha
2015-05-01
We derive a series expression for the pair-wise error probability (PEP) of bit interleaved coded modulation (BICM)-based subcarrier intensity modulation (SIM) optical wireless communication (OWC) system employing M^{2}-ary quadrature amplitude modulation ( M^{2} -QAM) over the Gamma-Gamma turbulence channels. Using this expression, we develop an upper bound (UB) to predict the bit-error rate performance of such system. Simulation results are presented to verify the analytical results. We also develop an asymptotic UB which reveals that the diversity order depends on the smaller channel parameter and the free distance of the convolutional code. © 1997-2012 IEEE.
$\\gamma^{*}\\gamma^{*}$ total cross-section in the dipole picture of BFKL dynamics
Boonekamp, M; Royon, C; Wallon, S
1999-01-01
The total $\\gamma^*\\gamma^*$ cross-section is derived in the Leading Order QCD dipole picture of BFKL dynamics, and compared with the one from 2-gluon exchange. The Double Leading Logarithm approximation of the DGLAP cross-section is found to be small in the phase space studied. Cross sections are calculated for realistic data samples at the $e^+e^-$ collider LEP and a future high energy linear collider. Next to Leading order corrections to the BFKL evolution have been determined phenomenologically, and are found to give very large corrections to the BFKL cross-section, leading to a reduced sensitivity for observing BFKL.
Influence of the rock heterogeneity on the results of gamma-gamma logging
International Nuclear Information System (INIS)
Umiastowski, K.; Buniak, M.
1977-01-01
The influence of the grain size of granular rock and that of the empty holes size of porous rock on the results of gamma-gamma measurements was investigated. Monte-Carlo calculations and experiments were performed to establish this influence. For the grain (or empty holes) size greater than about 10mm the significant influence on the results of density measurements was found if a 137 Cs source was used. This effect is greater for the dry rock than for the water-saturated one. Formulae enabling the correct density value to be found, if the grain size is known, were proposed. (author)
Gamma dosimetry with CR-39 etch track detector
International Nuclear Information System (INIS)
Matiullah; Dogar, A.H.; Ahmad, N.; Amin, M.; Kudo, Katsuhisa
1999-01-01
To preserve and improve the safety of food for commercial purposes, it is exposed to high gamma-ray doses. The gamma-ray doses used for this purpose range from 0.15 kGy to 50 kGy. At such high doses, the etching characteristics of CR-39 are severely affected. This property, therefore, can be used to develop a CR-39-based gamma dosimeter. In this context, systematic studies were carried out and the bulk etching rate was determined as a function of gamma-ray dose using different methods. (author)
Residual water treatment for gamma radiation. Tratamiento de aguas residuales por radiacion gamma
Energy Technology Data Exchange (ETDEWEB)
Mendez, L [Universidad Nacional Mayor de San Marcos. Facultad de Quimica (Peru)
1990-07-01
The treatment of residual water by means of gamma radiation for its use in agricultural irrigation is evaluated. Measurements of physical, chemical, biological and microbiological contamination indicators were performed. For that, samples from the treatment center of residual water of San Juan de Miraflores were irradiated up to a 52.5 kGy dose. The study concludes that gamma radiation is effective to remove parasites and bacteria, but not for removal of the organic and inorganic matter. (author). 15 refs., 3 tabs., 4 figs.
Proprioceptive evoked gamma oscillations
DEFF Research Database (Denmark)
Arnfred, S.M.; Hansen, Lars Kai; Parnas, J.
2007-01-01
A proprioceptive stimulus consisting of a weight change of a handheld load has recently been shown to elicit an evoked potential. Previously, somatosensory gamma oscillations have only been evoked by electrical stimuli. We conjectured that a natural proprioceptive stimulus also would be able...... to evoke gamma oscillations. EEG was recorded using 64 channels in 14 healthy subjects. In each of three runs a stimulus of 100 g load increment in each hand was presented in 120 trials. Data were wavelet transformed and runs collapsed. Inter-trial phase coherence (ITPC) was computed as the best measure...
Well logging with natural gamma radiation
International Nuclear Information System (INIS)
Ellis, D.V.
1983-01-01
An invention is described for use in natural gamma radiation well logging in which measurements taken in a borehole are used in the search for valuable underground resources such as oil or gas. The invention comprises deriving a log of natural gamma radiation detected in selected energy windows for a selected borehole depth interval and converting it into a log of the selected subsurface materials, e.g. Th, U, K. This log is corrected for the effects of 1) either a gamma ray emitter in the borehole fluid, e.g. potassium salts and/or 2) a gamma ray attenuator in the borehole fluid, e.g. a strong attenuator such as barite and/or hematite. The Th, U, K log is particularly useful in the exploration of oil and gas resources since the Th, U, K concentrations are a good indication as to the presence, type and volume of shale and clay in the formations surrounding the borehole. (U.K.)
Gamma-Ray Pulsar Studies With GLAST
Energy Technology Data Exchange (ETDEWEB)
Thompson, D.J.; /NASA, Goddard
2011-11-23
Some pulsars have their maximum observable energy output in the gamma-ray band, offering the possibility of using these high-energy photons as probes of the particle acceleration and interaction processes in pulsar magnetospheres. After an extended hiatus between satellite missions, the recently-launched AGILE mission and the upcoming Gamma-ray Large Area Space Telescope (GLAST) Large Area Telescope (LAT) will allow gamma-ray tests of the theoretical models developed based on past discoveries. With its greatly improved sensitivity, better angular resolution, and larger energy reach than older instruments, GLAST LAT should detect dozens to hundreds of new gamma-ray pulsars and measure luminosities, light curves, and phase-resolved spectra with unprecedented resolution. It will also have the potential to find radio-quiet pulsars like Geminga, using blind search techniques. Cooperation with radio and X-ray pulsar astronomers is an important aspect of the LAT team's planning for pulsar studies.
International Nuclear Information System (INIS)
Levesque, Emily M.; Kewley, Lisa J.; Soderberg, Alicia M.; Berger, Edo
2010-01-01
We compare the redshifts, host galaxy metallicities, and isotropic (E γ,iso ) and beaming-corrected (E γ ) gamma-ray energy release of 16 long-duration gamma-ray bursts (LGRBs) at z γ,iso , or E γ . These results are at odds with previous theoretical and observational predictions of an inverse correlation between gamma-ray energy release and host metallicity, as well as the standard predictions of metallicity-driven wind effects in stellar evolutionary models. We consider the implications that these results have for LGRB progenitor scenarios, and discuss our current understanding of the role that metallicity plays in the production of LGRBs.
Neutron-gamma discrimination of boron loaded plastic scintillator
International Nuclear Information System (INIS)
Wang Dong; He Bin; Zhang Quanhu; Wu Chuangxin; Luo Zhonghui
2010-01-01
Boron loaded plastic scintillator could detect both fast neutrons thanks to hydrogen and thermal neutrons thanks to 10B. Both reactions have large cross sections, and results in high detection efficiency of incident neutrons. However, similar with other organic scintillators, boron loaded plastic scintillator is sensitive to gamma rays and neutrons. So gamma rays must be rejected from neutrons using their different behavior in the scintillator. In the present research zero crossing method was used to test neutron-gamma discrimination of BC454 boron loaded plastic scintillator. There are three Gaussian peaks in the time spectrum, they are corresponding to gamma rays, fast neutrons and flow neutrons respectively. Conclusion could be made that BC454 could clear discriminate slow neutrons and gamma, but the discrimination performance turns poor as the neutrons' energy becomes larger. (authors)
Secondary gamma-ray data for shielding calculation
International Nuclear Information System (INIS)
Miyasaka, Sunichi
1979-01-01
In deep penetration transport calculations, the integral design parameters is determined mainly by secondary particles which are produced by interactions of the primary radiation with materials. The shield thickness and the biological dose rate at a given point of a bulk shield are determined from the contribution from secondary gamma rays. The heat generation and the radiation damage in the structural and shield materials depend strongly on the secondary gamma rays. In this paper, the status of the secondary gamma ray data and its further problems are described from the viewpoint of shield design. The secondary gamma-ray data in ENDF/B-IV and POPOP4 are also discussed based on the test calculations made for several shield assemblies. (author)
The Gamma Gap and All-Cause Mortality.
Directory of Open Access Journals (Sweden)
Stephen P Juraschek
Full Text Available The difference between total serum protein and albumin, i.e. the gamma gap, is a frequently used clinical screening measure for both latent infection and malignancy. However, there are no studies defining a positive gamma gap. Further, whether it is an independent risk factor of mortality is unknown.This study examined the association between gamma gap, all-cause mortality, and specific causes of death (cardiovascular, cancer, pulmonary, or other in 12,260 participants of the National Health and Nutrition Examination Survey (NHANES from 1999-2004. Participants had a comprehensive metabolic panel measured, which was linked with vital status data from the National Death Index. Cause of death was based on ICD10 codes from death certificates. Analyses were performed with Cox proportional hazards models adjusted for mortality risk factors. The mean (SE age was 46 (0.3 years and the mean gamma gap was 3.0 (0.01 g/dl. The population was 52% women and 10% black. During a median follow-up period of 4.8 years (IQR: 3.3 to 6.2 years, there were 723 deaths. The unadjusted 5-year cumulative incidences across quartiles of the gamma gap (1.7-2.7, 2.8-3.0, 3.1-3.2, and 3.3-7.9 g/dl were 5.7%, 4.2%, 5.5%, and 7.8%. After adjustment for risk factors, participants with a gamma gap of ≥3.1 g/dl had a 30% higher risk of death compared to participants with a gamma gap <3.1 g/dl (HR: 1.30; 95%CI: 1.08, 1.55; P = 0.006. Gamma gap (per 1.0 g/dl was most strongly associated with death from pulmonary causes (HR 2.22; 95%CI: 1.19, 4.17; P = 0.01.The gamma gap is an independent risk factor for all-cause mortality at values as low as 3.1 g/dl (in contrast to the traditional definition of 4.0 g/dl, and is strongly associated with death from pulmonary causes. Future studies should examine the biologic pathways underlying these associations.
Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barillari, T.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Beeston, C.; Behnke, T.; Bell, A.N.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bloomer, J.E.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Bouwens, B.T.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davies, R.; De Jong, S.; del Pozo, L.A.; Desch, K.; Dienes, B.; Dixit, M.S.; do Couto e Silva, E.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Edwards, J.E.G.; Estabrooks, P.G.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ingram, M.R.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, G.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Morii, M.; Muller, U.; Mihara, S.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pearce, M.J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rees, D.L.; Rigby, D.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Ros, E.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Rylko, R.; Sachs, K.; Saeki, T.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schenk, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schultz-Coulon, H.C.; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Utzat, P.; Van Kooten, Rick J.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilkens, B.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
1998-01-01
The production rates of D^*+/- mesons in charm and bottom events at centre-of-mass energies of about 91 GeV and the partial width of primary cc(bar) pairs in hadronic Z^0 decays have been measured at LEP using almost 4.4 million hadronic Z^0 decays collected with the OPAL detector between 1990 and 1995. Using a combination of several charm quark tagging methods based on fully and partially reconstructed D^*+/- mesons, and a bottom tag based on identified muons and electrons, the hadronisation fractions of charm and bottom quarks into D^*+/- mesons have been found to be: f(b -> D^*+ X) = 0.173 +/- 0.016 +/- 0.012 and f(c -> D^*+ X) = 0.222 +/- 0.014 +/- 0.014 The fraction of cc(bar) events in hadronic Z^0 decays, Gamma_cc(bar)/Gamma_had = Gamma(Z^0 -> cc(bar))/Gamma(Z^0 -> hadrons), is determined to be Gamma_cc(bar)/Gamma_had = 0.180 +/- 0.011 +/- 0.012 +/- 0.006 In all cases the first error is statistical, and the second one systematic. The last error quoted for Gamma_cc(bar)/Gamma_had is due to external bran...
Inhomogeneity of neutron and gamma-ray attenuation in biological shields
Energy Technology Data Exchange (ETDEWEB)
El-bakkoush, F A; El-Ghobary, A M; Megahid, R M [Reactor and Neutron physics Department, Nuclear Research Center, A.E.A., Cairo (Egypt)
1997-12-31
Measurements have been carried-out to investigate the attenuation properties of some materials which are used as biological shields around nuclear radiation sources. Investigation was performed by measuring the transmitted fast neutron and gamma-spectra through cylindrical samples of magnetite- limonite, steel and cellulose shields. The neutron and gamma spectra were measured by a neutron-gamma spectrometer with stilbene scintillator. Discrimination between neutron and gamma pulses was achieved by a discrimination method. The obtained results are displayed in the form of neutron and gamma spectra and attenuation relations which are used to derive the total macroscopic cross-sections for neutrons and total linear attenuation coefficients for gamma-rays. The values of neutron and gamma relaxation lengths are also derived for the investigated materials. 10 figs., 1 tabs.
Radon-222 related influence on ambient gamma dose.
Melintescu, A; Chambers, S D; Crawford, J; Williams, A G; Zorila, B; Galeriu, D
2018-04-03
Ambient gamma dose, radon, and rainfall have been monitored in southern Bucharest, Romania, from 2010 to 2016. The seasonal cycle of background ambient gamma dose peaked between July and October (100-105 nSv h -1 ), with minimum values in February (75-80 nSv h -1 ), the time of maximum snow cover. Based on 10 m a.g.l. radon concentrations, the ambient gamma dose increased by around 1 nSv h -1 for every 5 Bq m -3 increase in radon. Radon variability attributable to diurnal changes in atmospheric mixing contributed less than 15 nSv h -1 to the overall variability in ambient gamma dose, a factor of 4 more than synoptic timescale changes in air mass fetch. By contrast, precipitation-related enhancements of the ambient gamma dose were 15-80 nSv h -1 . To facilitate routine analysis, and account in part for occasional equipment failure, an automated method for identifying precipitation spikes in the ambient gamma dose was developed. Lastly, a simple model for predicting rainfall-related enhancement of the ambient gamma dose is tested against rainfall observations from events of contrasting duration and intensity. Results are also compared with those from previously published models of simple and complex formulation. Generally, the model performed very well. When simulations underestimated observations the absolute difference was typically less than the natural variability in ambient gamma dose arising from atmospheric mixing influences. Consequently, combined use of the automated event detection method and the simple model of this study could enable the ambient gamma dose "attention limit" (which indicates a potential radiological emergency) to be reduced from 200 to 400% above background to 25-50%. Copyright © 2018 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Brun, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1966-04-01
A crystallographic study has been made of the {gamma} {yields} {alpha} + {gamma} transformation in the alloy containing 3 per cent by weight of molybdenum using electronic micro-diffraction; it has been possible to establish the orientational relationships governing the germination of the {alpha} phase in the {gamma} phase. One finds: (111){gamma} // (100) {alpha}, (112-bar){gamma} // (010) {alpha}, (11-bar 0){gamma} // (001){alpha}. By choosing a monoclinic lattice containing the same number of atoms as the orthorhombic lattice for defining the {gamma} mother phase, the change in structure has been explained by adding a homogeneous (112-bar){gamma} [111]{gamma} shearing deformation to a heterogeneous deformation brought about by slipping of the atoms which are not situated at the nodes of this lattice. The identity of the orientation relationships {gamma}/{alpha} and {gamma}/{alpha}''b and the loss of coherence {gamma} /{alpha} as a function of temperature or of time lead to the conclusion that, in the range studied, the {gamma} {yields} {alpha} transformation begins with a martensitic process and continues by germination and growth. (author) [French] Une etude cristallographique de la transformation {gamma} {yields} {alpha} + {gamma} dans l'alliage {alpha} 3 pour cent en poids de Mo, effectuee par microdiffraction electronique a permis d'etablir les relations d'orientation regissant la germination de {alpha} dans {gamma}. On a: (111){gamma} // (100){alpha}, (112-bar){gamma} // (010){alpha}, (11-bar 0){gamma} // (001){alpha}. En choisissant pour decrire la phase mere {gamma} une maille monoclinique contenant le meme nombre d'atomes que la maille orthorhombique {alpha}, le changement de structure a ete explique en superposant a une deformation homogene par cisaillement (112-bar){gamma} [111]{gamma} une deformation heterogene par glissement des atomes non situes aux noeuds de cette maille. L identite des relations d'orientation {gamma}/{alpha} et {gamma} /{alpha