Energy Technology Data Exchange (ETDEWEB)
Silva, Cleomacio Miguel da
2000-04-01
There is only scarce information on the presence of radionuclides in water for public consumption in Brazil. A recently issued federal regulation requires that waters from public supplies be screened to determine their content of alpha and beta emitters. In order to comply with this requirement the present work was carried out with the purpose of determining the concentration of natural uranium, {sup 222} Rn and {sup 210} Po in water supplies in the metropolitan region of Recife, Brazil. The analyses were performed in 17 points of supply of superficial water and 94 points of groundwater supply. The concentrations of uranium were determined by the fluorimetric method, whereas the liquid scintillation method was used to determine the concentration of {sup 222} Rn. Polonium-210, on the other hand, was determined by alpha spectrometry, following its spontaneous deposition on copper disks. The water analyzer presented uranium concentrations varying from 35.3 to 1146.5 mBq/L for superficial resources and from 20.2 to 919.15 mBq/L for underground sources. The concentration of uranium in superficial water showed significant correlation with some parameters such as conductivity, alkalinity and total hardness, as well as, with the concentrations of Ca, Mg, Cl, K, SO{sub 4} and Mn. No correlation, however, was shown with the concentrations of Fe, NO{sub 2} and NO{sub 3}. The concentrations of {sup 222} Rn varied from 5.3 to 83.7 Bq/L in the groundwater analyzer. Radon concentration was not measured in superficial water due to the high emanation rate of radon in open air conditions. As far as {sup 210} Po is concerned, the analyses showed concentrations ranging from <22 mBq/L (the lowest limit of detection) to 57.4 mBq/L for superficial water and from <22 to 813 mBq/L for ground water samples. The concentrations of {sup 210} Po did not show and correlation with physico-chemical parameters. The average concentrations of uranium and {sup 210} Po in superficial water were of 44
Energy Technology Data Exchange (ETDEWEB)
Gouvea, Vandir de Azevedo; Cardoso, Domingos d' Oliveira; Pedro, Carlos Roberto [Instituto de Engenharia Nuclear (IEN), Rio de Janeiro, RJ (Brazil). Div. de Seguranca e Radioprotecao]. E-mail: vandir@cnen.gov.br; Castro, Carlos Alberto Carvalho [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Dept. de Engenharia Nuclear
2001-07-01
The radioecological concentrations of Radon-222 indoor and outdoor nuclear facility of IEN, have been determined.The present study has established a radon investigation methodology in occupational areas, besides to suggest solutions for gas concentration minimization, in others work environment like to IEN.
Energy Technology Data Exchange (ETDEWEB)
Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2015-04-15
This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)
Risk of 222 Rn ingestion by water consumption in the phosphate rich of the Northeast of Brazil
International Nuclear Information System (INIS)
Andrade Lima, Ricardo de
1997-01-01
Geological survey performed in the coastal region of the northeast of Brazil revealed the presence of uranium phosphate deposits in a land strip covering the Pernambuco-Bahia sedimentary basin. The water consumed by the local population crosses the phosphate area and presents higher tna normal concentration of uranium and its progeny. This work is aimed to determine the cancer risk, based on the rate ingestion of the 222 'Rn due to water consumption. The results of the analysis showed increments of 1.25% for cancer occurrences due to Rn-222 ingestion for the local population. (author). 11 refs., 1 fig., 1 tab
Radon-222 measurement in a uranium prospecting area in Brazil
International Nuclear Information System (INIS)
Binns, D.A.; Melo, V.P.; Gouvea, V.A.
1996-01-01
Rn-222 concentrations were determined in about 100 measuring points in an uranium prospecting area in the eastern part of Brazil. The single measurement results in open areas, identified as environmental points, present values between 4 ± 2 Bq/m -3 and 404 ± 16 Bq/m -3 with a mean value of 62 ± 10 Bq/m -3 . Comparing the mean values for each measuring point, the values obtained are between 15 ± 2 Bq/m -3 in the deposit for mineral samples and 245 ±7 Bq/m -3 for the central point, AN08, of the prospective mine. Makrofol SSNTD were used for the measurements and exposed for 120 days alternated periods from May 1992 to May 1994. (authors). 8 refs., 1 tab
Energy Technology Data Exchange (ETDEWEB)
Veiga, Lene Holanda Sadler; Amaral, Eliana [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Koifman, Sergio [Fundacao Oswaldo Cruz (FIOCRUZ), Rio de Janeiro, RJ (Brazil). Escola Nacional de Saude Publica
2002-07-01
High levels of radon and his products have been found at a underground coal mine, at the Southern Brazil, in operation since 1945. The {sup 222}Rn concentration levels measured were 7000 Bq/m{sup 3} and 0.7 WL for the radon sons (7.7 WLM/year), which are values considered higher than the limits for intervention in a working environments (500 to 1500 Bq/m3 of {sup 222}Rn) and the occupational exposure limit (4.0 WLM/year). Due to the unique opportunity found in these miner group, it was decided to construct a cohort with miners from that mining (underground and surface) viewing the evaluation of the possible effects to the health decurrens from that exposure.
Algunos complejos de carboxilatos de uranio (IV y 1-pirazolilborato
Directory of Open Access Journals (Sweden)
Omar Velasquez
2009-07-01
Full Text Available En este trabajo se presenta la síntesis y caracterización, mediante espectroscopia de infrarojo y H'—NMR de complejos de acetato de uranio, dietil carbamatos y dietilditiocarbamatos y 1—pirazolil—borato.
Measurements of indoor 222RN activity in dwellings and workplaces of Curitiba (Brazil)
International Nuclear Information System (INIS)
Corrêa, Janine N.; Paschuk, Sergei A.; Del Claro, Flávia; Kappke, Jaqueline; Perna, Allan F.N.; Schelin, Hugo R.; Denyak, Valeriy
2014-01-01
The present work describes the results of systematic measurements of radon ( 222 Rn) in residential environments and workplaces in the Metropolitan Region of Curitiba (Paraná State, Brazil) during the period 2004–2012. For radon in air activity measurements, polycarbonate Track Etch Detectors CR-39, mounted in diffusion chambers protected by borosilicate glass fiber filters, were used. After being exposed in air, the CR-39 detectors were submitted to a chemical etching in a 6.25 M NaOH solution at 70 °C for 14 h. The alpha particle tracks were identified and manually counted with an optical microscope, and with the results of previously performed calibrations, the indoor activity concentration of 222 Rn was calculated. The calibration of CR-39 and the alpha particle tracks chemical development procedures were performed in collaboration the National Institute of Radiological Sciences (NIRS, Japan). The major part of indoor 222 Rn concentration in residences was found to be below 100 Bq/m 3 . In the case of working places, all measurements of 222 Rn concentrations were below 100 Bq/m 3 . These values are considered within the limits set by international regulatory agencies, such as the US EPA and ICRP, which adopt up to 148 and 300 Bq/m 3 as upper values for the reference levels for radon gas activity in dwellings, respectively. The latest value of 300 Bq/m 3 for radon activity in air is proposed by ICRP considering the upper value for the individual dose reference level for radon exposure of 10 mSv/yr. - Highlights: • Radon activity in air of dwellings was measured. • Radon activity in air of workplaces was measured. • Obtained experimental results are compared with International Norms and Regulations
Uranium, radon-222 and polonium-210 in drinking waters from metropolitan area of Recife, PE, Brazil
International Nuclear Information System (INIS)
Silva, Cleomacio Miguel da
2000-04-01
There is only scarce information on the presence of radionuclides in water for public consumption in Brazil. A recently issued federal regulation requires that waters from public supplies be screened to determine their content of alpha and beta emitters. In order to comply with this requirement the present work was carried out with the purpose of determining the concentration of natural uranium, 222 Rn and 210 Po in water supplies in the metropolitan region of Recife, Brazil. The analyses were performed in 17 points of supply of superficial water and 94 points of groundwater supply. The concentrations of uranium were determined by the fluorimetric method, whereas the liquid scintillation method was used to determine the concentration of 222 Rn. Polonium-210, on the other hand, was determined by alpha spectrometry, following its spontaneous deposition on copper disks. The water analyzer presented uranium concentrations varying from 35.3 to 1146.5 mBq/L for superficial resources and from 20.2 to 919.15 mBq/L for underground sources. The concentration of uranium in superficial water showed significant correlation with some parameters such as conductivity, alkalinity and total hardness, as well as, with the concentrations of Ca, Mg, Cl, K, SO 4 and Mn. No correlation, however, was shown with the concentrations of Fe, NO 2 and NO 3 . The concentrations of 222 Rn varied from 5.3 to 83.7 Bq/L in the groundwater analyzer. Radon concentration was not measured in superficial water due to the high emanation rate of radon in open air conditions. As far as 210 Po is concerned, the analyses showed concentrations ranging from 210 Po did not show and correlation with physico-chemical parameters. The average concentrations of uranium and 210 Po in superficial water were of 44.7 mBq/L, respectively. These values correspond to effective doses of 5.8 x 10 -4 mSv/yr and 4.5 x 10 -2 mSv/yr, for uranium and 210 Po, respectively. The average values for the concentrations of uranium, 222
Assessment of 222Rn occupational exposure at IPEN nuclear materials storage site, SP, Brazil
International Nuclear Information System (INIS)
Caccuri, Lilian Saueia
2007-01-01
In this study it was assessed the occupational exposure to 222 Rn at IPEN, SP, Brazil, nuclear materials storage site through the committed effective dose received by workers exposed to this radionuclide. The radiation dose was calculated through the radon concentrations at nuclear materials storage site. Radon concentrations were determined by passive detection method with solid state nuclear detectors (SSNTD). The SSNTD used in this study was the polycarbonate Makrofol E; each detector is a small square plastic of 1 cm 2 , placed into a diffusion chamber type KFK. It was monitored 14 points at nuclear materials storage site and one external point, over a period of 21 months, changing the detectors every three months, from December 2004 to September 2006. The 222 Rn concentrations varied from 196 ± 9 and 2048 ± 81 Bq·m -3 . The committed effective dose due to radon inhalation at IPEN nuclear materials storage site was obtained from radon activity incorporated and dose conversion factor, according to International Commission on Radiological Protection procedures. The effective committed dose received by workers is below 20 mSv·y -1 . This value is suggested as an annual effective dose limit for occupational exposure by ICRP 60. (author)
Static leaching of Spanish uranium ores; Lixiviacion estatica de minerales espanoles de uranio
Energy Technology Data Exchange (ETDEWEB)
Cordero, G; Gasos, P; Merino, J L; Suarez, Y E [Direccion de Plantas Piloto e Industriales, Junta de Energia Nuclear, Madrid (Spain)
1967-06-15
The paper summarizes the experience acquired in Spain during seven years of investigation on the static leaching of uranium ores. The operations covered minerals showing wide variations with regard to both uranium content (250 and 2000 ppm) and the type of rock and gangue (granites, shales, sandstones, sulphides, carbonates, limonites etc.). The studies were carried out on quantities of material varying from a few kilograms to several tons. Leaching agents included water, solid reagents (pyrites), alkaline carbonates and sulphuric acid. The systems used consisted of both simple layouts and other, more elaborate schemes including recycling of the liquors. The uranium was recovered from the liquors first by direct precipitation and later by ion-exchange and extraction with amines. (author) [Spanish] La memoria resume la experiercia espanola de siete anos de estudio sobre lixiviacion estatica de minerales de uranio. Se ha estudiado una gran variedad de minerales tanto en lo que respecta a ley de uranio (250 y 2000 ppm), como a la naturaleza de las rocas y gangas (granitos, pizarras, areniscas, sulfuros, carbonatos, limonitas, etc.). Los estudios se han realizado en diferentes escalas, desde kilogramos a varias toneladas. Los agentes de lixiviacion han sido variables: agua, reactivos solidos (piritas), carbonatos alcalinos y acido sulfurico. Los circuitos empleados se refieren tanto a esquemas sencillos, como a otros mas elaborados con recirculaciones de liquido. La recuperacion del uranio de los liquidos se resolvio inicialmente por precipitacion directa, pero luego se efectuo mediante cambio de ion y extraccion con aminas. (author)
Rovesciamento e alterazione nei racconti Uranio, Vanadio e in Auschwitz, Città Tranquilla
Directory of Open Access Journals (Sweden)
Fausto Maria Greco
2016-11-01
Full Text Available Ne Il sistema periodico accade che i processi dell’alterazione e del rovesciamento investano le funzioni stesse della narrazione e della testimonianza. In Uranio il personaggio di Bonino, narratore inattendibile, è un doppio rovesciato di Primo Levi. Egli realizza uno degli incubi dello scrittore torinese, quello di raccontare l’esperienza vissuta nel lager e di non essere creduto, ma l’effetto di rovesciamento riguarda anche altri versanti della scrittura. Come Elie Wiesel nel racconto intitolato Barbara, incluso nella raccolta de L’ebreo errante del 1966, Levi prende le distanze, in Uranio, da una memoria che falsifica, che oltrepassa la barriera della verità per costruire un’immagine eroica dei sopravvissuti. Nell’opera di Levi le figure di doppi rovesciati segnalano rischi incombenti, ipotesi inquietanti; i processi di alterazione, invece, si adattano meglio allo sforzo di conoscenza che riguarda l’universo concentrazionario. In questo rapporto stanno il Bonino di Uranio e il Cerrato di Argento, il dottor Müller di Vanadio (ancora ne Il sistema periodico e l’ingegner Mertens del racconto di Auschwitz, città tranquilla (pubblicato nell’84 e aggiunto ai Racconti e saggi. Dietro i nomi di Müller e di Mertens si celano, però, figure in carne e ossa con le quali lo scrittore è entrato in contatto. Il capovolgimento rivela un’ipotesi provocatoria, una vertigine del pensiero, nel caso di Mertens; l’alterazione apre alla conoscenza etica nella vicenda di Müller.The study focuses on the methods of alteration and overturning that influence functions of narration and testimony in Primo Levi’s Il sistema periodico (1975. In the short story Uranio, the character of Bonino is an unreliable storyteller as well as an overturned double of the writer. Bonino represents one of Levi’s obsessions, i.e., not being believed when telling the experience of prison and extermination camps. The effect of overturning also regards
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Joselene de; Farias, Luciana A.; Mazzilli, Barbara P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Dept. de Radiometria Ambiental]. E-mail: jolivei@net.ipen.br; Burnett, William C. [Florida State Univ., Tallahassee, FL (United States); Saraiva, Elisabete de S.B. e; Furtado, Valdenir V. [Sao Paulo Univ., SP (Brazil). Inst. Oceanografico. Dept. de Oceanografia Quimica e Geologica
2002-07-01
Submarine groundwater discharge (SGD) and recycled seawater can provide chemical constituents to coastal zone, representing an important material flux pathway from land to sea in some areas. Geochemical tracers, like {sup 222} Rn and {sup 226} Ra, are advantageous for regional-scale assessment of SGD, because their signals represent values integrated through the water column that removes small-scale variations. These radionuclides are usually enriched in groundwater compared to seawater, can be measured at very low concentrations and are conservative. This work reports preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil, covering latitudes between 23 deg 26{sup '}S and 23 deg 46{sup '}S and longitudes between 45 deg02{sup '}W and 45 deg 11{sup '}W. The main aims of this research were to set up an analytical method to assess {sup 222} Rn and {sup 226} Ra activities in seawater samples and to apply the excess {sup 222} Rn inventories obtained to estimate the submarine groundwater discharge. Measurements made during 2001/2002 included {sup 222} Rn and {sup 226} Ra in seawater, {sup 222} Rn in sediment, seawater and sediment physical properties. (author)
Energy Technology Data Exchange (ETDEWEB)
Josa, J M; Merino, J L; Villoria, A [Direccion de Plantas Piloto e Industriales, Junta de Energia Nuclear, Madrid (Spain)
1967-06-15
The authors describe the features of some 70 samples of radioactive lignites from various places in Spain (Huesca, Lerida, Teruel, Galicia and Murcia) with uranium contents varying between 20 and 1200 ppm. They carried out experiments on extraction of the uranium from these ores both by direct treatment and after roasting to eliminate organic matter and bring about concentration. The acid method was considered for leaching of the uranium from the substances in question using agitation and static bed techniques. Investigations were also carried out on the effect of the variables represented by grain size, amount of acid, temperature time and oxidants, in addition to those involved in the roasting process. (author) [Spanish] Los autores presentan las caracteristicas de unas 70 muestras de lignitos radiactivos procedentes de distintos puntos de Espana (Huesca, Lerida, Teruel, Galicia y Murcia) con leyes de uranio comprendidas entre 20 y 1200 ppm. El beneficio del uranio de estos minerales se ha abordado por tratamiento directo y despues de someterlos a tostacion, lo que elimino la materia organica y produjo enriquecimiento. La lixiviacion del uranio de los productos indicados se considero por via acida, utilizando tecnicas de agitacion y de lecho estatico. Se investigo la influencia de las variables tamano de grano, dosis de acido, temperatura, tiempo y oxidante, ademas de las implicadas en los procesos de tostacion. (author)
International Nuclear Information System (INIS)
Lopes, Patricia da Costa
2005-01-01
We describe here an application of excess 222 Rn to estimate SGD in a series of small embayments of Ubatuba, Sao Paulo State, Brazil, covering latitudes between 23 deg 26'S and 23 deg 46'S and longitudes between 45 deg 02'W e 45 deg 11'W. Excess 222 Rn inventories obtained in 24 vertical profiles established from March/03 to July/05 varied from 345 ±±24 to 18,700 ± 4,900 dpm/m 2 . The highest inventories of excess 222 Rn were observed both in Flamengo and Fortaleza embayments, during summer campaigns (rainy season). The estimated total fluxes required to support inventories measured varied from 62 ± 4 to 3,385 +- 880 dpm/m 2 d. Considering these results, the SGD advective rates necessary to balance the fluxes calculated in Ubatuba embayments ranged from 0.1 x 10 -1 to 1.9 cm/d. Taking into account all SGD fluxes obtained, the percentual variability was 89% (seasonal variation in 3 years period, n = 24 measurements). Although, if we consider each year of study separately, the respective percentual variabilities estimated are 72% in 2003 (n = 10 measurements), 127% in 2004 (n = 6 measurements) and 97% in 2005 (n = 8 measurements). (author)
Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil
Energy Technology Data Exchange (ETDEWEB)
Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson, E-mail: flaviadelclaro@gmail.com, E-mail: spaschuk@gmail.com, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy, E-mail: denyak@gmail.com [Instituto de Pesquisa Pele Pequeno Principe (IPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita O., E-mail: rocha@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2013-07-01
The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)
Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil
International Nuclear Information System (INIS)
Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Denyak, Valeriy; Rocha, Zildete; Santos, Talita O.
2013-01-01
The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)
International Nuclear Information System (INIS)
Barbosa, E.Q.; Galhardi, J.A.; Bonotto, D.M.
2014-01-01
This study focuses on the presence of radon ( 222 Rn) and volatile organic compounds (VOCs) in soil gases at a gas station located in the city of Rio Claro, São Paulo, Brazil, where a fossil fuel leak occurred. The spatial distribution results show a correlation between 222 Rn and VOCs, consistent with the fact that radon gas has a greater chemical affinity with organic phases than with water. This finding demonstrates that the presence of a residual hydrocarbon phase in an aquifer can retain radon, leading to a reduced radon content in the soil gas. The data in this study confirm the results of previous investigations, in which the method used in this study provided a preliminary fingerprint of a contaminated area. Furthermore, the data analysis time is brief, and only simple equipment is required. - Highlights: • 222 Rn in soil gases. • Correlation between 222 Rn and VOCs. • Useful method as a preliminary fingerprint of a contaminated area
Radón y sus efectos en la salud en trabajadores de minas de uranio
Directory of Open Access Journals (Sweden)
Gonzalo Aicardi-Carrillo
2015-03-01
Full Text Available Introducción: El radón es un gas presente en subsuelo, especialmente en minas de uranio, que produce consecuencias sobre la salud, entre las que destaca el cáncer de pulmón. En EEUU es la segunda causa de mortalidad por esta enfermedad. Pese a la fuerte relación causal no existe normativa específica europea de regulación en mineros. Objetivos: Identificar el efecto del radón y sus derivados sobre la salud de los trabajadores de minas de uranio; describir la asociación entre exposición a radón y a otros minerales sobre la salud y asociación entre radón y consumo de tabaco. Metodología: Realizamos una revisión bibliográfica de literatura publicada entre 2007 y 2014, en bases de datos biomédicas, utilizando los criterios de inclusión y exclusión previamente establecidos. Resultados: Se revisan 32 artículos, encontrando un aumento significativo de cáncer pulmonar (SMR-2.03, IC95% 1.96-2.10, incluso a dosis bajas (300-WLM así como otros cánceres (laringe, gástrico, hepático y leucemia y enfermedades cerebrovasculares, controlando posibles factores de confusión (tabaco, silicosis, cuarzo y arsénico no encontrando relación significativa ni sinergias. Conclusión: Existe asociación entre la exposición al radón y cáncer pulmonar en minas de uranio, con un periodo medio de latencia de 20 años, determinado por la dosis de radón y el tiempo de exposición. No se ha demostrado riesgo de desarrollar otros tipos de tumores, y los estudios que lo sugieren son poco consistentes.
Energy Technology Data Exchange (ETDEWEB)
Kundt, Miriam S [Comision Nacional de Energia Atomica, General San Martin (Argentina). Dept. de Radiobiologia
2001-07-01
de preimplantacion cultivados in vitro son empleados desde hace algun tiempo para evaluar los efectos de contaminantes ambientales, en especial metales. En este trabajo se ha utilizado este modelo para presentar los efectos citotoxicos, embriotoxicos y genotoxicos del uranio. Los embriones fueron obtenidos mediante superovulacion de hembras hibridas CBA x C57 Bl, apareadas luego con machos NIH y cultivados en medio M16 como medio control. Tres experimentos diferentes se llevaron adelante 'A', 'B' y 'C' utilizando nitrato de uranilo hexahidratado UO{sub 2}(NO{sub 3}){sub 2} 6H{sub 2}O como fuente de uranio. En el experimento 'A' los embriones desde el estadio de una celula se cultivaron durante 120 hs. en la misma placa, conteniendo una concentracion final de uranio de 13, 26, 52, 104 y 208 {mu}gU/ml. En el experimento 'B' los embriones fueron puestos a cultivar desde el estadio de una celula a una concentracion final de uranio de 26, 52 y 104 {mu}gU/ml, a las 24 hs. de cultivo los embriones que pasaron a 2 celulas fueron cambiados a una placa preparada nuevamente, manteniendo las mismas concentraciones de uranio que la anterior, hasta finalizar el periodo de incubacion de 120 hs. En el experimento 'C' los embriones fueron puestos a cultivar desde el estadio de una celula a una concentracion final de uranio de 26, 52 y 104 {mu}gU/ml y fueron cambiados de placa de cultivo cada 24 hs., manteniendo estas placas nuevas las mismas concentraciones de uranio que la primera y el cultivo finalizo a las 72 hs. El clivaje embrionario desde 1 celula a 2 celulas no se ha visto estadisticamente afectado respecto del control, en los 4388 embriones analizados, en los diferentes tratamientos y las diferentes concentraciones de uranio empleadas. Desde el clivaje de 2 celulas en adelante, momento que el embrion comienza a sintetizar su propio ARNm, el retraso en el desarrollo embrionario, el grado de fragmentacion, el porcentaje de embriones atresicos y las malformaciones embrionarias
Energy Technology Data Exchange (ETDEWEB)
Caccuri, Lilian Saueia
2007-07-01
In this study it was assessed the occupational exposure to {sup 222}Rn at IPEN, SP, Brazil, nuclear materials storage site through the committed effective dose received by workers exposed to this radionuclide. The radiation dose was calculated through the radon concentrations at nuclear materials storage site. Radon concentrations were determined by passive detection method with solid state nuclear detectors (SSNTD). The SSNTD used in this study was the polycarbonate Makrofol E; each detector is a small square plastic of 1 cm{sup 2}, placed into a diffusion chamber type KFK. It was monitored 14 points at nuclear materials storage site and one external point, over a period of 21 months, changing the detectors every three months, from December 2004 to September 2006. The {sup 222}Rn concentrations varied from 196 {+-} 9 and 2048 {+-} 81 Bq{center_dot}m{sup -3}. The committed effective dose due to radon inhalation at IPEN nuclear materials storage site was obtained from radon activity incorporated and dose conversion factor, according to International Commission on Radiological Protection procedures. The effective committed dose received by workers is below 20 mSv{center_dot}y{sup -1}. This value is suggested as an annual effective dose limit for occupational exposure by ICRP 60. (author)
Mineral water 222 Rn activity decrease due to consumption habits
International Nuclear Information System (INIS)
Cipriani, Moacir; Taddei, Maria Helena Tirollo; Silva, Nivaldo Carlos da
2001-01-01
Mineral waters from the Pocos de Caldas Plateau springs, an elevated region with high natural radioactivity, in the State of Minas Gerais, Brazil, have significant 222 Rn concentration on site. The highest concentration in the waters are from: Fonte Villela - Aguas da Prata (∼ 1000 Bql -1 ); Fonte Grande Hotel - Pocinhos do Rio Verde (∼ 400 Brq -1 ) and Fonte CNEN Lab - Pocos de Caldas (∼ 290 Bql -1 ). These waters are used by the population as drinking water and due to consumption habits, can lead to internal doses above accepted limits for the public. This work deals with the decrease of 222 Rn activity in mineral waters fro two different popular consumption habits, and with the adult effective dose equivalent reduction due to water consumption habits. It has been found that the estimated dose based on the biokinetic Crawford-Brown model, can be one fourth of dose based on 222 Rn activity on site. (author)
CONTENUTO DI URANIO E TORIO NELLE METEORITI
Directory of Open Access Journals (Sweden)
M. SANTANGELO
1955-06-01
Full Text Available Molti ricercatori in questi ultimi anni si sono interessati al problema
della composizione delle meteoriti; dai risultati sperimentali si
è cercato trarre elementi circa la genesi di questi materiali, questione
ancora aperta, ed avere informazioni sui processi chimici e termodinamici
cui le meteoriti furono soggette prima della loro caduta sulla
terra.
Uno degli aspetti del problema è quello dell'abbondanza percentuale
degli elementi chimici e della loro composizione isotopica nella
materia meteorica dei diversi tipi : ciò perché esso è connesso con
quello piii generale dell'origine e distribuzione degli elementi nel cosmo
e nella terra, nonché con quello dell'età delle meteoriti (l .
In un recente lavoro Urey e collaboratori (-, esaminando un gran
numero di analisi chimiche effettuate su questi materiali, sono pervenuti
alla formulazione di alcuni criteri di classificazione in base alla
percentuale dei componenti più abbondanti ed alla presenza o meno
di disomogeneità strutturali nella massa fondamentale. Fra gli elementi
meno abbondanti presentano particolare interesse quelli delle due famiglie
radioattive naturali Torio e Uranio; le loro concentrazioni sono
state determinate per alcune meteoriti siliciche (stonv ineteorites e
per qualcuna ferrica (iron meteorites
Directory of Open Access Journals (Sweden)
d. Diana
1965-06-01
Full Text Available Si descrive una tecnica elio permette di misurare ilnumero di atomi di Uranio di una soluzione, con un errore non superioreal 10%.Il sistema consiste in un tubo di Geiger (Philips 18503 sistemato inun contenitore di vetro nel quale viene diluita una certa quantità di peso dinitrato di Uranile, misurato con una precisione migliore dell'1%. Al variaredella diluizione si registra il numero di particelle che il Geiger conta, e quindisi riporta in grafico. Da questi per diverse quantità di sale sciolto si determinala retta di taratura.
Energy Technology Data Exchange (ETDEWEB)
Chagas, Eduardo G.L. das; Dias, Danila C.S.; Guerrero, Eder T. Z.; Alberti, Heber L.C.; Couto, Jeferson A.; Silva, Nivaldo C., E-mail: duglchagas@hotmail.com, E-mail: ncsilva@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Braz, Marcelo L. [Universidade Federal de Alfenas (UNIFAL), Pocos de Caldas, MG (Brazil); Abreu, Carolina B. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil); Lopez, Dina [Universidade de Ohio (United States); Branco, Otavio [Universidade Federal de Juiz de Fora (UFJF), MG (Brazil); Fleming, Peter M. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2013-07-01
The objectives of this work are mapping of Rn-222 concentration in the interstitial air of the cell 4 (BF-4) barren of uranium mining in the Industrias Nucleares do Brasil (INB), Pocos de Caldas, MG - Brazil, as well as build an automatic system for collection of interstitial gases.
222Rn studies and mapping in the city of Curitiba - Brazil
International Nuclear Information System (INIS)
Correa, Janine Nicolosi; Fior, Loriane; Paschuk, Sergei A.; Schelin, Hugo R.; Pecequilo, Brigitte R. S.; Paula Melo, Vicente de
2008-01-01
This work describes radon monitoring performed in cooperation between the Laboratory of Ionizing Radiations of the Federal University of Technology - Parana (UTFPR), the Institute of Nuclear and Energetic Researches (IPEN) and the Institute of Radiation Protection and Dosimetry (IRD), from the Brazilian Nuclear Energy Commission (CNEN), during the last two years. For 222 Rn concentration measurements related to different construction materials as well as for the studies of radon emanation and its reduction, the sealed cell chambers, of approximately 60 x 60 cm 2 , was built using ceramic and concrete blocks. This construction was performed within a protected and isolated laboratory environment to maintain the air humidity and temperature stable. These long term measurements have been performed using polycarbonate alpha track passive detectors. The exposure time was set to 15 days considering previous calibration performed at IRD, where a efficiency of 70% was obtained for the density of alpha particle tracks about 13.8 cm -2 per exposure day and per kBq/m 3 of radon activity concentration. The chemical development of the alpha tracks was achieved by electrochemical etching. The track identification and counting were done using a code based on the MATLAB Image Processing Toolbox. The cell chambers were built following four main steps: 1) assembling the walls using the blocks and mortar; 2) plaster installation; 3) wall surface finishing using lime; 4) wall surface insulation by paint. By comparison between three layers installed at the masonry walls from concrete and ceramic blocks, it was concluded that only wall painting with acrylic varnish attended the expectation and reduced the radon emanation flow by a factor of approximately 2.5. The construction materials were submitted to the instant measurements of radon concentration using a ALPHA GUARD Professional detector. The samples of the construction materials were stored inside an acrylic container (sealed up
International Nuclear Information System (INIS)
Negrao, F.I.; Oliveira, G.G. de; Zanetti, J.C.; Cunha, R.P.P. da.
1990-01-01
The Uranium Province of Lagoa Real is situated in the central south of the State of Bahia and constitutes at the moment the second uranium resource of Brazil, containing, in several anomalies, as available resource, 93.850 ton. of U sub(3) O sub(8). The Uranio do Brasil S.A. develops a mine-industrial complex in this Province with the aim to extract and benefit uranium and intending to improve in 1992. The project is considered with high hazard, because involves te management of radioactive material, and becomes necessary an available of environmental impact, in accordance with CONAMA 001/86 and an active participation of the society. This paper aims to indentify the social and environmental impacts of this process, as a contribution of this important discussion. (author)
Seasonal variations of 222Rn and SGD fluxes to Ubatuba embayments, Sao Paulo
International Nuclear Information System (INIS)
Oliveira, J.; Costa, P.; Braga, E.S.
2006-01-01
We describe here an application of excess 222 Rn to estimate submarine groundwater discharge in a series of small embayments of Ubatuba, Sao Paulo State, Brazil. Excess 222 Rn inventories obtained in 11 vertical profiles varied from (3.3±1.1) x 10 3 to (19±5) x 10 3 dpm x m -2 . The estimated total fluxes required to support the inventories varied from (0.6±0.2) x 10 3 to (3.4±0.9) x 10 3 dpm x m -2 x d -1 . Considering these results, the submarine groundwater discharge advective rates necessary to balance the sub-pycnocline fluxes calculated in Ubatuba embayments ranged from 0.06 to 1.9 cm x d -1 . During the period of this investigation (from March/03 to May/2004), the highest 222 Rn in excess inventories were observed late in the summer season (March). Taking into account all vertical profiles established, the relative variability was 67%. Although, if we consider only the fluxes determined in both Flamengo and Fortaleza embayments, the relative variation was 21%. (author)
The Rn-222 with natural tracer in the study of natural gas transport within sterile cells of mining
International Nuclear Information System (INIS)
Chagas, Eduardo G.L. das; Dias, Danila C.S.; Guerrero, Eder T. Z.; Alberti, Heber L.C.; Couto, Jeferson A.; Silva, Nivaldo C.; Abreu, Carolina B.; Lopez, Dina; Branco, Otavio; Fleming, Peter M.
2013-01-01
The objectives of this work are mapping of Rn-222 concentration in the interstitial air of the cell 4 (BF-4) barren of uranium mining in the Industrias Nucleares do Brasil (INB), Pocos de Caldas, MG - Brazil, as well as build an automatic system for collection of interstitial gases
Calibration of a degassing-emanation line for 222Rn determination in seawater samples
International Nuclear Information System (INIS)
Farias, Luciana Aparecida
2002-01-01
The purpose of this study is to calibrate a degassing-emanation line and to determine 222 Rn and 226 Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring 226 Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of 222 Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of 222 Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of 222 Rn in excess increases with depth, as expected. (author)
Energy Technology Data Exchange (ETDEWEB)
Farias, Luciana Aparecida
2002-07-01
The purpose of this study is to calibrate a degassing-emanation line and to determine {sup 222}Rn and {sup 226}Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring {sup 226}Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of {sup 222}Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of {sup 222}Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of {sup 222}Rn in excess increases with depth, as expected. (author)
Seasonal variation of 226Ra and 222Rn in mineral spring waters of Aguas da Prata-Brazil
International Nuclear Information System (INIS)
Oliveira, J. de; Mazzilli, B.; Oliveira S, M.H de; Bernadete, S.
1996-01-01
Concentration levels of 226 Ra and 222 Rn have been analysed in most of the mineral spring waters available in the Aguas da Prata region, which is located in the Pocos de Caldas plateau, one of the biggest weathered alkaline intrusions of the world. In this plateau can be found many health resorts[based on springs of thermal and mineral waters. The Aguas da Prata spring waters show a large variety of composition. It has been observed bicarbonates, carbonates and sulphates salts in these mineral waters. The 226 Ra was determined by gross alpha counting of a Ba(Ra)SO 4 precipitate. The measurement was carried out in a low background gas flow proportional counter. The 222 Rn concentrations were determined by liquid scintillation method. Water samples were randomly collected at 9 spring sites over a period of one year, in order to evaluate the seasonal variation of these radionuclides. Lower concentrations were found mostly in the rainy season (summer), which presents 80% of the annual rainfall of the region (1500 mm/year). Higher concentrations up to 2223 mBq/L for 226 Ra and 131 Bq/L for 222 Rn have been observed in waters with low level of soluble salts. Waters which present high levels of carbonate and sulphate salts showed maximum values of 316 mBq/L for 226 Ra and 30 Bq/L for 222 Rn. This behaviour is mainly due to the physicochemical properties of these radionuclides in water as well as to the lithologic structure of the aquifers. (authors). 6 refs., 2 figs., 1 tab
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Research. 93.222 Section 93.222 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.222 Research. Research means a systematic experiment, study, evaluation...
Distribución de uranio y torio en la apófisis adamellítica de Logrosán (Cáceres, España
Directory of Open Access Journals (Sweden)
Guijarro Galiano, J.
1986-12-01
Full Text Available Logrosan apophyses (Cáceres, España has two differents petrographic types: a porphyritic two mica adamellite and a porphyritiv two mica microadamellite. It's an alkaline with silico-sodic trend and peraluminous granitoid. A greisen alteration has been produced by the tin-veins in the host-rock.
The moderatly high content values of uranium are ranged between 6.9 and 11.9 ppm, with a mean of 9.5 ppm. Thorium has lower concentrations levels. The Th/U ratio has an average value of 0.8.
The fact that thorium ís correlated positivels with ferromagnesian elements indicates that is probably contained within the boitites.
Higher thorium and uranium values are founded in the adamellite type.
Greisen has produced an uranium leaching that would be important as uranium mineralization source outside the apophyses. Although has not been observed uranium mineralizations in the geological area study.
La apófisis de Logrosán (Cáceres, España está constituida por una adamellita y una microdamellita, ambas de dos micas. Geoquímicamente presenta un carácter marcadamente alcalino, con una tendencia silicosódica clara, y peraluminoso. Los filones estanníferos existentes han producido una greisenificación en la roca encajante.
El fondo geoquímico del uranio está comprendido entre 6,9 y 11,9 ppm, con un valor medio de 9,5 ppm, y es ligeramente superior al habitual para estos materiales. El fondo del torio es inferior y el valor medio de la relación Th/U es de 0,8.
Existe una buena correlación positiva entre el torio y los elementos ferromagnesianos. Probablemente se encuentra asociado a las biotitas.
Los fondos geoquímicos más altos, en torio y uranio, corresponden a la facies adamellítica.
La greisenificación ha provocado una lixiviación de uranio que ha podido actuar como fuente para posibles mineralizaciones extraplutónicas, aunque en el estudio geológico de la zona no han sido
Presence of URAMEX (Uranio Mexicano) in Mexico's development
International Nuclear Information System (INIS)
1980-01-01
The purpose of this work is to inform the Government and the Nation about the achievements and experiences of Uranio Mexicano (URAMEX, sole agent of the State in the uranium exploration, exploitation and commercialization), as well as the context in which the uranium production evolves, supporting the growth of the electric power utility through nuclear energy, and making easier the decrease in the use of hydrocarbons as a source of energy. Through this work we know about the main activity of URAMEX, which is the elaboration of uranium concentrate, raw material of the nuclear reactor, based on the technological requirements of the exploration, exploitation, milling of uranium ore and the nuclear fuel cycle in general. To reach these objectives the uranium industry depends on the rhythm of expansion in the electrical sector, the productive sectors in general, and on the resources URAMEX disposes to reach its goals which are strictly related to the establishment of an integrated nuclear power industry that will greatly contribute to the independent development of the country. This work intends to design the development of the uranium processing according to the extractive industry politics of the ''Plan Nacional de Desarrollo Industrial'' (National Plan for Industrial Development) promulgated in 1979. In this Plan the operations of URAMEX are designed in agreement with the projections of the expected development in the electrical sector and specially in the nuclear power electricity. (author)
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 222.1 Section 222.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.1 Introduction. This part sets forth and describes the family relationships that may make a...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH222Q.Seq.d/ Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2
Evaluation of radon-222 concentrations levels at workplaces of Curitiba, PR, Brazil
International Nuclear Information System (INIS)
Del Claro, Flavia; Paschuk, Sergei A.; Correa, Janine N.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Martins Neto, Manoel R.; Denyak, Valeriy
2013-01-01
The radon is noble radioactive gas, which when inhaled and undergoing spontaneous decay emits alpha particles that interacting with the cells of biological tissue stimulates the development of lung cancer. The isotope 222 Rn is responsible for approximately half of the effective dose received by the population from natural radiation sources. Current work is focused at the evaluation of the radon concentration levels in air of different workplaces at Curitiba-PR. For this purpose 126 track-etched detectors CR-39 were mounted inside the diffusion chambers that were distributed at workplaces of three enterprises environments for a period of three months approximately. The diffusion chambers were protected by a borosilicate glass fiber filters. After the exposition in air the detectors were submitted to chemical etching using a solution of 6.25M NaOH at 70°C during 14 hours. Such chemical treatment enables to count alpha particle track using an optical microscope with 100x objective magnification. The density of alpha particle tracks in CR-39 was converted to the radon activity concentration in air using the results of previous calibration performed at the National Institute of Radiological Sciences (NIRS) in Japan. Obtained results show that the concentration of 222 Rn in air at studied workplaces varied from 16±2 Bq/m³ to 78±9 Bq/m³. These values are considered within the limits established by international regulatory agencies such as EPA and ICRP, which consider as normal the radon activity up to 200 Bq/m³ and 148 Bq/m³, respectively. (author)
Evaluation of radon-222 concentrations levels at workplaces of Curitiba, PR, Brazil
Energy Technology Data Exchange (ETDEWEB)
Del Claro, Flavia; Paschuk, Sergei A.; Correa, Janine N.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Martins Neto, Manoel R., E-mail: flavia_delclaro@yahoo.com.br, E-mail: spaschuk@gmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba - PR (Brazil); Denyak, Valeriy, E-mail: denyak@gmail.com [Instituto de Pesquisa Pele Pequeno Principe (FPP), Curitiba - PR (Brazil)
2013-07-01
The radon is noble radioactive gas, which when inhaled and undergoing spontaneous decay emits alpha particles that interacting with the cells of biological tissue stimulates the development of lung cancer. The isotope {sup 222}Rn is responsible for approximately half of the effective dose received by the population from natural radiation sources. Current work is focused at the evaluation of the radon concentration levels in air of different workplaces at Curitiba-PR. For this purpose 126 track-etched detectors CR-39 were mounted inside the diffusion chambers that were distributed at workplaces of three enterprises environments for a period of three months approximately. The diffusion chambers were protected by a borosilicate glass fiber filters. After the exposition in air the detectors were submitted to chemical etching using a solution of 6.25M NaOH at 70°C during 14 hours. Such chemical treatment enables to count alpha particle track using an optical microscope with 100x objective magnification. The density of alpha particle tracks in CR-39 was converted to the radon activity concentration in air using the results of previous calibration performed at the National Institute of Radiological Sciences (NIRS) in Japan. Obtained results show that the concentration of {sup 222}Rn in air at studied workplaces varied from 16±2 Bq/m³ to 78±9 Bq/m³. These values are considered within the limits established by international regulatory agencies such as EPA and ICRP, which consider as normal the radon activity up to 200 Bq/m³ and 148 Bq/m³, respectively. (author)
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Examples. 222.2 Section 222.2 Banks and Banking... (REGULATION V) General Provisions § 222.2 Examples. The examples in this part are not exclusive. Compliance with an example, to the extent applicable, constitutes compliance with this part. Examples in a...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 22.2 Section 22.2 Labor Office of the Secretary of Labor PROGRAM FRAUD CIVIL REMEDIES ACT OF 1986 § 22.2 Definitions. (a) ALJ means an Administrative... accounting or bookkeeping entry made— (1) With respect to a claim or to obtain the approval or payment of a...
39 CFR 222.3 - Other delegation.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Other delegation. 222.3 Section 222.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.3 Other delegation. (a) Documentation. All delegations of authority must be officially documented. (b...
1 CFR 22.2 - Authority citation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Authority citation. 22.2 Section 22.2 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF NOTICES AND PROPOSED RULES Notices § 22.2 Authority citation. The authority under...
Inferring 222Rn soil fluxes from ambient 222Rn activity and eddy covariance measurements of CO2
Directory of Open Access Journals (Sweden)
S. van der Laan
2016-11-01
Full Text Available We present a new methodology, which we call Single Pair of Observations Technique with Eddy Covariance (SPOT-EC, to estimate regional-scale surface fluxes of 222Rn from tower-based observations of 222Rn activity concentration, CO2 mole fractions and direct CO2 flux measurements from eddy covariance. For specific events, the regional (222Rn surface flux is calculated from short-term changes in ambient (222Rn activity concentration scaled by the ratio of the mean CO2 surface flux for the specific event to the change in its observed mole fraction. The resulting 222Rn surface emissions are integrated in time (between the moment of observation and the last prior background levels and space (i.e. over the footprint of the observations. The measurement uncertainty obtained is about ±15 % for diurnal events and about ±10 % for longer-term (e.g. seasonal or annual means. The method does not provide continuous observations, but reliable daily averages can be obtained. We applied our method to in situ observations from two sites in the Netherlands: Cabauw station (CBW and Lutjewad station (LUT. For LUT, which is an intensive agricultural site, we estimated a mean 222Rn surface flux of (0.29 ± 0.02 atoms cm−2 s−1 with values > 0.5 atoms cm−2 s−1 to the south and south-east. For CBW we estimated a mean 222Rn surface flux of (0.63 ± 0.04 atoms cm−2 s−1. The highest values were observed to the south-west, where the soil type is mainly river clay. For both stations good agreement was found between our results and those from measurements with soil chambers and two recently published 222Rn soil flux maps for Europe. At both sites, large spatial and temporal variability of 222Rn surface fluxes were observed which would be impractical to measure with a soil chamber. SPOT-EC, therefore, offers an important new tool for estimating regional-scale 222Rn surface fluxes. Practical applications furthermore include
222Rn determination in mineral waters from the Pocos de Caldas Plateau in Brazil
International Nuclear Information System (INIS)
Taddei, M.H.T.; Silva, N.C.; Cipriani, M.
2002-01-01
It is estimated that 50% of the radioactive effective dose equivalent to man comes from radon and its radioactivity daughters. The main 222 Rn sources are the soils, building materials and potable waters. There is an especial interest in spas waters with high natural radioactivity. It's considered that the use of these waters as drinking waters is a significant radiation exposure factor, and it is worthwhile to assess the consequent dose. Such estimation has been made for the Pocos de Caldas Plateau, which is a region of high natural radioactivity, from volcanic origin, containing several spas (Aguas da Prata, Caldas, Pocos de Caldas and Andradas). The 222 Rn content was determined in 23 spring waters in Pocos de Caldas and neighboring cities. In water sampling, modified Marinelli flasks were used. The determinations were effected with a high resolution gamma ray spectrometer. High concentration variations were observed in the collected mineral waters, the highest values having been found in Fonte Villela's waters, in Aguas da Prata town (926 Bq/l); Grande Hotel's in Caldas Town (420 Bq/l) and COLAB's in Pocos de Caldas region (289 Bq/l). The annual whole body effective dose equivalent estimate for adult due to water ingestion, using the Crowford-Brown's biokinetic model's adult dose conversion factors, was higher than 1 mSv/year in 61% of the analyzed waters. (author)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Sleep time. 553.222 Section 553.222 Labor Regulations... Enforcement Employees of Public Agencies Tour of Duty and Compensable Hours of Work Rules § 553.222 Sleep time... enforcement personnel in accordance with section 7(a)(1) of the Act, the public agency may exclude sleep time...
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Evaldo Paulo de
2017-11-01
The purpose of this work was to perform a study comparing radon concentration measurements between two techniques used to measure radon gas in the air: one using LEXAN polycarbonate plastic detectors and the other the continuous monitor in AlphaGUARD passive mode. The concentrations of radon gas within radon emanation chambers were measured using calibrated / traceable sources generating {sup 222}Rn through {sup 226}Ra. In calibration the 'calibration factor' or 'sensitivity' was determined for the LEXAN plastic detector. The calibration work of the dosimeters was carried out at the Radon Laboratory of the Environmental Analysis Division - DIRAD IRD/CNEN and at the Natural Radioactivity Laboratory (LRN) of the Center for the Development of Nuclear Technology (CDTN/CNEN). The 'calibration factor' or 'sensitivity' was found to be 32.34 (traits.cm{sup -2})/(kBq.d.m{sup -3}). This factor was used to determine the radon concentration measured by the LEXAN plastic detectors. Also in the calibration, the efficiencies for LEXAN (94.1% ± 9.7%) and AlphaGUARD (92.5% ± 7.2%) were determined. The statistical analysis used showed good parity in the results of the measurements. It was concluded that the results were satisfactory and will serve as a good reference for studies related to the radon air meters used in this work. (author)
Energy Technology Data Exchange (ETDEWEB)
Jackson, S. [Authority Health and Safety Branch, Radiological Protection Division, United Kingdom Atomic Energy Authority, Harwell, Berks. (United Kingdom)
1964-11-15
consideration principale dont il faut tenir compte est d'ordre non pas radiologique mais toxicologique, en raison des effets chimiques que produit l'uranium depose dans les reins. Une certaine quantite d'uranium se depose egalement dans le squelette mais, dans le cas de l'uranium naturel, la radioexposition du squelette est moins critique que des effets toxiques sur les reins. Dans le cas de composes solubles de l'uranium fortement enrichi ayant une activite specifique elevee, la consideration principale est d'ordre radiologique; les effets chimiques sur les reins sont moins limitatifs que la radioexposition du squelette, qui devient ainsi l'organe critique. Dans ce cas, il vaut mieux essayer d'evaluer la charge corporelle retenue et non la quantite d'uranium absorbee. On peut y parvenir en analysant des echantillons d'urines prelevees, non pas immediatement apres la contamination, mais apres un certain delaL Les echantillons preleves apres une periode de vacances sont probablement les meilleurs que l'on puisse obtenir en pratique, mais on peut avoir a se contenter d'echantillons preleves apres le repos hebdomadaire qui suit une semaine de travail dans une atmosphere chargee de poussieres d'uranium. (author) [Spanish] La causa mas corriente de contaminacion interna con uranio es la inhalacion de polvo de este elemento. Los compuestos solubles de uranio pasan rapidamente de los pulmones a la sangre y la mayor parte del uranio que penetra en el torrente circulatorio es excretado muy pronto por via urinaria. La cantidad de uranio soluble absorbida en el curso del trabajo se puede calcular a partir del contenido en uranio de muestras de orina tomadas inmediatamente despues del mismo. Los compuestos'solubles de uranio natural se caracterizan por el hecho de que la consideracion primordial no es de orden radiologico sino toxicologico, debido a los efectos quimicos del uranio depositados en los rinones Parte del uranio se deposita tambien en el esqueleto, pero la irradiacion del
Contribution of 222Rn in domestic water supplies to 222Rn in indoor air in Colorado homes
International Nuclear Information System (INIS)
Lawrence, E.P.; Wanty, R.B.; Nyberg, P.
1992-01-01
The contribution of 222Rn from domestic water wells to indoor air was investigated in a study of 28 houses near Conifer, CO. Air concentrations determined by alpha-track detectors (ATDs) and continuous radon monitors were compared with the predictions of a single-cell model. In many of the houses, the water supply was shown to contribute significantly to levels of indoor 222Rn. The data from the ATD study were augmented with a continuous monitoring study of a house near Lyons, CO. The well water in that house has the highest known concentration of 222Rn in water yet reported (93 MBq m-3). The temporal pattern in the indoor 222Rn concentration corresponds to water-use records. In general, it is difficult to quantify the proportion of indoor radon attributable to water use. Several lines of evidence suggest that the single-cell model underestimates this proportion. Continuous-monitoring data, although useful, are impractical due to the cost of the equipment. We propose a protocol for 222Rn measurement based on three simultaneous integrating radon detectors that may help estimate the proportion of indoor 222Rn derived from the water supply
20 CFR 222.12 - Ceremonial marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Ceremonial marriage relationship. 222.12 Section 222.12 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.12 Ceremonial marriage...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.222 Section 284.222 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Blanket Certificates Authorizing Certain Transportation by Interstate Pipelines on Behalf of Others and...
50 CFR 222.404 - Observer program sampling.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Observer program sampling. 222.404 Section 222.404 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Requirement § 222.404 Observer program sampling. (a) During the program design, NMFS would be guided by the...
International Nuclear Information System (INIS)
Silva, Karolayne E.M. da; Santos, Mariana L. de O.; Amaral, Déric S. do; Vilela, Eldice C.; França, Elvis J. de; Hazin, Clovis A.; Farias, Emerson E.G. de
2017-01-01
Radon-222 is a radioactive gas, a product of the decay of uranium-238, which emits alpha particles and represents more than 50% of the dose of natural radiation received by the population. Therefore, monitoring of this gas is essential. For indoor measurement, solid state detectors can be used, the most common of which is CR-39. For monitoring using CR-39, alpha particles, generated by radon-222 and the daughter radionuclides, strike the surface of the detector and generate traces. To relate the trace density per exposure area in environments with unknown activity concentration, it is necessary to determine the calibration factor. The objective of this study was to calibrate CR-39 type detectors for the implementation of the radon determination methodology in Centro Regional de Ciencias Nucleares do Nordeste - CRCN-NE of Brazilian Nuclear Energy Commission - CNEN. In order to determine the CR-39 calibration factor, 19 exposures of the detectors were performed in the CRCN-NE calibration chamber (RN1-CRCN) at an activity of 5.00 kBq m -3 , with the exposure time varying from 24 to 850 hours. For the detection of the detectors, sodium hydroxide was used in a thermostat bath at 90 ° C for 5 hours. The count of number of traits per unit of field was performed with the aid of optical microscopy with an increase of 100 times, being read 30 fields per dosimeters. As a result, the calibration factor was obtained, and the linear response of the trace density as a function of exposure was observed. The results allow the use of CR-39 in the determination of radon-222 by CRCN-NE
Radon-222 and beryllium-7 as natural tracer; Radon-222 und Beryllium-7 als natuerliche Tracer
Energy Technology Data Exchange (ETDEWEB)
Frank, G.; Steinkopff, T. [Deutscher Wetterdienst, Offenbach (Germany). Radioaktivitaetsueberwachung; Salvamoser, J. [Institut fuer Angewandte Isotopen-, Gas- und Umweltuntersuchungen (IGU), Woerthsee (Germany)
2016-07-01
The Global Atmosphere Watch Program (GAW) is intended to analyse worldwide the influence of anthropogenic emissions to the atmosphere. Data are continuously transferred to the ''World Data Centre for Green House Gases'' of the WMO. For the study of atmospheric transports the natural radionuclides Rn-222, Be-7, Pb-210, Pb- 214 and Bi-214 are continuously measured at the Umweltforschungsstation Schneefernerhaus (2650 m) and at the Zugspitze (2962 m) by the Deutscher Wetterdienst (DWD, German Weather Service). The measurements support the classification of atmospheric transport, atmospheric dilution and dispersion models of gaseous and aerosol bond micro pollutants. Results are carried out in combination with meteorological data. It is shown the optimization and effect of a new sampling site for the measurement of Rn-222 activity at the Zugspitze. Results of Rn-222 and Be-7 concentrations are shown in relation to horizontal and vertical dispersion of air masses. The origin of natural Rn-222 and Be-7 are known, therefore both nuclides are well suited for the research of atmospheric transport. Rn-222 is an ideal tracer, because there is no influence by atmospheric processes (chemical processes, wash out effects).
Energy Technology Data Exchange (ETDEWEB)
Ivanov, V. E.; Zelenskij, V. F.; Voloshchuk, A. I.; Grishok, V. N. [Fiziko-Tekhnicheskij Institut an USSR, Khar' kov, SSSR (Russian Federation)
1963-11-15
The paper describes certain features of dispersion-hardened uranium-based cermets. As possible hardening materials, consideration was given to UO{sub 2}, UC, Al{sub 2}O{sub 3}, MgO and UBe{sub 13}. Data were obtained on the behaviour of uranium alloys containing the above-mentioned admixtures during creep tests, short-term strength tests and cyclic thermal treatment. The corrosion resistance o f UBe{sub 13}-based uranium alloys was also studied. )author) [French] Les auteurs decrivent certaines proprietes de cermets a base d'uranium, dont la resistance a ete accrue a l'aide de particules dispersees. Les materiaux utilises a cette fin sont notamment: UO{sub 2}, UC, Al{sub 2}O{sub 3}, MgO et UBe{sub 13}. Les auteurs indiquent les donnees obtenues sur le comportement des cermets a l'uranium; durant les essais de fluage, les essais de resistance a court terme et le traitement thermique cyclique, en mentionnant les substances ajoutees. Ils etudient enfin la resistance a la corrosion des cermets d'uranium et UBe{sub 13}. (author) [Spanish] Los autores describen algunas propiedades de los cermets a base de uranio, reforzados por particulas de diversos compuestos en dispersion. En calidad de posibles materiales de refuerzo, ensayaron el UO{sub 2}, el UC, el Al{sub 2}O{sub 3}, el MgO y el UBe{sub 13}. Obtuvieron datos sobre el comportamiento de esas aleaciones en ensayos de fluencia, ensayoe rapidos de resistencia y tratamiento termico ciclico. Por ultimo, estudiaron la resistencia a la corrosion de las aleaciones de uranio a base de UBe{sub 13}. (author) [Russian] Daetsya opisanie nekotorykh svojstv metallokeramicheskikh splavov urana, uprochnennykh dispersionnymi chastitsami. V kachestve vozmozhnykh uprochnyayushchikh materialov izuchalis' UO{sub 2}, UC, Al{sub 2}O{sub 3} , MgO i UBe{sub 13}. Polucheny dannye o povedenii splavov urana s ukazannymi primesyami pri kripovykh ispytaniyakh, pri kratkovremennykh prochnostnykh ispytaniyakh i pri tsiklicheskoj termoobrabotke
20 CFR 222.4 - Homicide of employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Homicide of employee. 222.4 Section 222.4... RELATIONSHIPS General § 222.4 Homicide of employee. No person convicted of the felonious and intentional homicide of an employee can be entitled to an annuity or lump-sum payment based on the employee's earnings...
International Nuclear Information System (INIS)
Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao
2010-01-01
222 Rn fluxes from the ground surface and 226 Ra contents in soil were measured on Hachijo-jima Island, which is a solitary island in the Pacific Ocean located about 200 km to the south of the main island of Japan, to evaluate fractional contributions of the locally exhaled 222 Rn and the long-range transported one to the surface air concentration measured on this island. Averages of 222 Rn flux and 226 Ra content in dry soil were evaluated to be 0.9±0.4 mBq m -2 s -1 and 6.8±0.2 Bq kg -1 , respectively. These are considerably smaller than the respective values of 9.7±0.8 mBq m -2 s -1 and 23.2±0.4 Bq kg -1 measured at Nagoya as a reference. The lower value of the 226 Ra content and the even lower 222 Rn flux on this island can be attributed to the basaltic geology and the soil's coarse texture moisture, respectively. A simple model calculation assuming a typical nocturnal condition showed that the measured 222 Rn flux would cause only a small increase in the surface air concentration by 0.035 to 0.072 Bq m -3 (relative contribution of 1 to 12%) in addition to the long-range transported 222 Rn under a typical nocturnal condition. The contribution of the local flux would be smaller than that under nocturnal condition. This local 222 Rn component is negligible as compared with the concentration of the long-range transported 222 Rn (0.6 to 3.6 Bq m -3 ). It is, therefore, concluded that Hachijo-jima Island is suitable for measuring the long-range transported atmospheric 222 Rn in East Asia region. (author)
Variations of Rn-222 concentration in the Bratislava air
International Nuclear Information System (INIS)
Holy, K.; Bohm, R.; Polaskova, A.
1996-01-01
222 Rn is produced by alpha decay of 222 Ra in roil. A small fraction of totally produced 222 Rn escapes from coil particles into soil air. Then 222 Rn is transported predominantly by molecular diffusion into outdoor atmosphere. The radon concentration in the outdoor atmosphere is not stable. It varies irregularly depending on meteorological conditions. However there were found out regular daily and remand variations of 222 Rn concentration in outdoor atmosphere. These variations were measured in numerous works and results are summarized f.e. in work of Gesell. A simple model described the annual variations of 222 Rn concentration war published by Minato. A mathematical analysis of daily course of 222 Rn concentration in outdoor atmosphere was realized by Garzon et al. Some results of our study of 222 Rn variations in outdoor atmosphere of Bratislava are shown in this report. (author)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT
RADON 222 AND TROPOSPHERIC VERTICAL TRANSPORT.
Liu, SC; McAfee, JR; Cicerone, RJ
1984-01-01
Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3. 83 days (5. 51-day 'exponential' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Previously published measured **2**2**2Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the **2**2**2Rn is transported above the planetary boundary layer, consi...
Emanation of radon-222 in uraniferous phosphorite from Pernambuco, Brazil
International Nuclear Information System (INIS)
Santos, M.L.O.; França, E.J.; Amaral, D.S.; Silva, K.E.M.; Hazin, C.A.; Farias, E.E.G.
2017-01-01
The concentration of radon-222 activity available for transport to the surface through the pore space can be defined as radon emanation. From the decay of radium-226, whose half-life is 1850 years, it is associated with the development of neoplasia, such as lung cancer. In the Metropolitan Region of Recife, sedimentary rocks known as phosphorites have been known since 1959, so, from the radiometric characterization of the Paulista and Igarassu Municipality, in Pernambuco, emanation tests were carried out, aiming to determine the emanation power of radon in samples of uraniferous phosphorite from the Recife Metropolitan Region. Initially, 6 independent samples of phosphorites with activity concentration of 226 Ra> 400 Bq kg -1 were comminuted. Portions of 5g were conditioned in a radon chamber with 500 mL volume for measurements. The linear fit of the model converged after 200 interactions with selection of the best fit by the Chi-Square test, through the Origin® 8.0 program. After analysis of the samples, radon emanation power was estimated in the range of 7% to 15%, with a mean value of 10.8%. The methodology used to determine the emanation parameters in samples of uraniferous phosphorite was adequate, observing an inversely proportional relation between the concentration of the radium-226 and the emanation power
A long range transport model of Rn-222
International Nuclear Information System (INIS)
Ikebe, Y.; Kojima, S.; Shimo, M.
1993-01-01
In this report, we propose an analytical treatment about temporal variation of 222 Rn concentration in the atmosphere with an aim to clarify origin and transport of 222 Rn. Based on the results of numerical simulation of radon, we separate the 222 Re concentration measured at Nagoya into the following two components : (1) 222 Rn atom originated near from the measuring site, which is denoted by 'diurnal variation component'. From numerical simulation of radon, it has been shown that the measured diurnal variation can be explained by this component. (2) 222 Rn atoms originated far from the measuring site (including Chinese Continent), which is denoted by 'background component'. For this component, we propose here a one layer transport model using air mass trajectory technique. By this model we can explain the temporal variation of background component and seasonal variation of 222 Rn at Nagoya. (3 figs.)
20 CFR 222.13 - Common-law marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Common-law marriage relationship. 222.13 Section 222.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.13 Common-law marriage...
Exposure to radon and mortality standard in a coal miner cohort in Brazil
International Nuclear Information System (INIS)
Veiga, Lene Holanda Sadler; Amaral, Eliana; Koifman, Sergio
2002-01-01
High levels of radon and his products have been found at a underground coal mine, at the Southern Brazil, in operation since 1945. The 222 Rn concentration levels measured were 7000 Bq/m 3 and 0.7 WL for the radon sons (7.7 WLM/year), which are values considered higher than the limits for intervention in a working environments (500 to 1500 Bq/m3 of 222 Rn) and the occupational exposure limit (4.0 WLM/year). Due to the unique opportunity found in these miner group, it was decided to construct a cohort with miners from that mining (underground and surface) viewing the evaluation of the possible effects to the health decurrens from that exposure
21 CFR 1305.17 - Preservation of DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Preservation of DEA Forms 222. 1305.17 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.17 Preservation of DEA Forms 222. (a) The purchaser must retain Copy 3 of each executed DEA Form 222 and all copies of unaccepted or defective forms with each...
222Rn in wine cellars in Hungary
International Nuclear Information System (INIS)
Csige, I.; Hunyadi, I.; Szerbin, P.; Juhasz, L.
2004-01-01
We measured seasonal average 222 Rn activity concentrations in the air of 60 wine cellars in the Tokajhegyalja and Villany wine regions of Hungary using Radamon type etched track radon detectors. The exposure period was 3 months, matching the seasons of 2003-2004. We also used an ionization chamber-type continuous 222 Rn-monitor (AlphaGUARD PQ222, Genitron Instruments, Germany) to study temporal variations of 222 Rn activity concentration in a selected wine cellar in the Tokajhegyalja wine region. This instruments also recorded temperature, atmospheric pressure and relative humidity data. The etched track detector data revealed that the 222 Rn activity concentrations in the air of wine cellars spread over a wide range, from the ambient outdoor concentration of 6 Bq.m -3 up to 6 kBq.m -3 characteristic of natural caves. The temporal variation of 222 Rn activity concentration in the air of the selected cellar varied inversely with the variation of the atmospheric pressure. Earlier we observed similar phenomena in natural karstic caves connected to the surface with vertical shafts only. This suggests that relatively large volume of pore space of the embedding rock communicates with the volume of the cellar induced by the variation of the atmospheric pressure
12 CFR 222.27 - Renewal of opt-out.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Renewal of opt-out. 222.27 Section 222.27 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.27 Renewal of opt-out. (a) Renewal notice and...
Radon and radium measurement in well water at Curitiba (PR), Brazil
International Nuclear Information System (INIS)
Correa, Janine N.; Paschuk, Sergei A.; Perna, Allan F.N.; Kappke, Jaqueline; Claro, Flavio del; Denyak, Valeriy; Schelin, Hugo R.; Rocha, Zildete
2011-01-01
This study presents the results of 226 Ra and 222 Rn activity concentration measurements in well water in the city of Curitiba - Parana State of Brazil. Water samples were collected from 31 wells and submitted to the radioactivity measurements in the Laboratory of Applied Nuclear Physics of the Federal University of Technology (UTFPR) in cooperation with CDTN-CNEN. Each water sample was submitted to 4 measurements of radon concentration with interval of three days. After two months the same samples were submitted once again to 222 Rn concentration measurements with an objective to evaluate indirectly the amount of 226 Ra contained in water samples. The 222 Rn concentration measurements were performed using AlphaGUARD radon monitor (Genitron Instruments) and 226 Ra concentration was evaluated using the decay curves of 222 Rn. Within few hours after extraction about 70% of water samples from monitored wells presented 222 Rn concentration values above the limit of 11.1 Bq/L recommended by the USEPA. Obtained activity values varied between 1.57 Bq/L - 215.16 Bq/L for radon concentration, and radium concentrations deviated within an interval of 0.61 Bq/L - 6.76 Bq/L. Obtained results showed that the biggest part of 222 Rn found in water samples was not originated from the 226 Ra compounds soluble in water but from gas exhalation by the soil adjacent to the well. The results of present research show the requirement of radioactivity monitoring of water extracted from artesian wells at Curitiba region and indicate the necessity of mitigation procedure development for better control of global alpha radioactivity in drinking water. (author)
4 CFR 22.2 - Board Consideration [Rule 2].
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Board Consideration [Rule 2]. 22.2 Section 22.2 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.2 Board Consideration [Rule 2]. (a) Offices. The office of the Board... consideration of a matter by all members of the Contract Appeals Board will not be granted in any appeal filed...
International Nuclear Information System (INIS)
Doerr, H.; Muennich, K.O.
1990-01-01
Measurements of the 222 Rn activity concentration profile in the soil and the 222 Rn flux in West-Germany are presented. The spatial pattern of the 222 Rn flux depends more on soil type than on the 226 Ra activity of the soil material. The average 222 Rn flux from sandy soils is 1000-2000 dpm m -2 h -1 and 4000-6000 dpm m -2 h -1 froam loamy and clayey soils. Weekly 222 Rn flux measurements during a period of 1 year at a sandy site show no significant temporal variations. At a clayey site, the 222 Rn flux tends to be higher in summer than in winter. The permeability coefficient P Rn , obtained from simultaneous 222 Rn flux and concentration profile measurements in various soils, can be expressed as a function of the soil parameters total porosity ε 0 , soil moisture F, tortuosity k and the molecular diffusion coefficient D 0 of 222 Rn in air: P = D 0 ((ε 0 -F)/k-const.). The flux of any other gas into or out of the soil can thus be calculated from its measured concentration profile in the soil and from the 222 Rn permeability coefficient, replacing the molecular diffusion coefficient of 222 Rn by that of the specific gas under consideration. As an example, this method of flux determination is demonstrated for the soil CO 2 flux to the atmosphere and for the flux of atmospheric CH 4 into the soil. (author) 14 refs
222-S laboratory quality assurance plan
International Nuclear Information System (INIS)
Meznarich, H.K.
1995-01-01
This document provides quality assurance guidelines and quality control requirements for analytical services. This document is designed on the basis of Hanford Analytical Services Quality Assurance Plan (HASQAP) technical guidelines and is used for governing 222-S and 222-SA analytical and quality control activities. The 222-S Laboratory provides analytical services to various clients including, but not limited to, waste characterization for the Tank Waste Remediation Systems (TWRS), waste characterization for regulatory waste treatment, storage, and disposal (TSD), regulatory compliance samples, radiation screening, process samples, and TPA samples. A graded approach is applied on the level of sample custody, QC, data verification, and data reporting to meet the specific needs of the client
20 CFR 222.34 - Relationship resulting from equitable adoption.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from equitable adoption. 222.34 Section 222.34 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.34 Relationship resulting from...
Dependence of indoor 222Rn level on building materials
International Nuclear Information System (INIS)
Tso, M.W.; Ng, C.; Leung, J.K.C.
1993-01-01
The radionuclide contents of typical building materials used in Hong Kong were studied by γ spectroscopic analysis. The physical properties of these building materials affecting the production and transportation of 222 Rn to the surrounding air were examined; these include the emanation coefficient of 2 '2 2 Rn of the material, the diffusion coefficient of 222 Rn in the material and the effect of surface coating and temperature on the rate of 222 Rn exhalation. Results obtained in this study explain the indoor 222 Rn concentration observed in our previous surveys and also suggest that the main source of indoor 222 Rn in Hong Kong is building material. (3 figs., 4 tabs.)
21 CFR 1305.12 - Procedure for executing DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for executing DEA Forms 222. 1305.12... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.12 Procedure for executing DEA Forms 222. (a) A purchaser must prepare and execute a DEA Form 222 simultaneously in triplicate by means of interleaved...
Rábago Gómez, Daniel
2013-01-01
Se han analizado los niveles de radón (222Rn) en el agua y en el aire del balneario Las Caldas de Besaya de forma continua a lo largo de un año aproximadamente. El radón es un gas noble de origen natural procedente de la desintegración del radio (226Ra) ambos constituyentes de la serie radiactiva del uranio 238. Dicho gas ha sido reconocido como agente carcinógeno de pulmón por la Organización Mundial de la Salud (WHO) y la Agencia Internacional de Investigación del Cáncer (...
20 CFR 222.33 - Relationship resulting from legal adoption.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from legal adoption. 222.33 Section 222.33 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.33 Relationship resulting from legal adoption...
Use of Tricaine Methanesulfonate (MS222) for Euthanasia of Reptiles
Conroy, CJ; Papenfuss, T; Parker, J; Hahn, NE
2009-01-01
Tricaine methanesulfonate (MS222) injected into the intracoelomic cavity of reptiles was evaluated as a chemical euthanasia method. Three western fence lizards, 2 desert iguanas, 4 garter snakes, and 6 geckos were euthanized by intracoelomic injection of 250 to 500 mg/kg of 0.7% to 1% sodium-bicarbonate–buffered MS222 solution followed by intracoelomic injection of 0.1 to 1.0 ml unbuffered 50% (v/v) MS222 solution. A simple 2-stage protocol for euthanasia of reptiles by using MS222 is outlined. In addition, the conditions for safe use of MS222 are discussed. MS222 offers an alternative to sodium pentobarbital for euthanasia of reptiles. PMID:19245747
International Nuclear Information System (INIS)
Buchli, R.; Burkart, W.
1989-01-01
The external gamma radiation and the indoor air Rn (222Rn) concentration were measured in 55 houses of the South East Grisons, the Urseren valley, and the Upper Rhine valley (crystalline subsoils) and in 39 houses of the Molasse basin and the Helvetic nappes (sedimentary subsoils). In homes located on a crystalline subsoil, a mean cellar gamma level of 1.40 mGy y-1 was measured, which is twice the mean gamma level of 0.70 mGy y-1 found in homes built on a sedimentary subsoil. The cellar 222Rn gas concentration is about six times higher in houses with a crystalline subsoil (1232 Bq m-3) than in houses with a sedimentary subsoil (201 Bq m-3). Although a weak correlation is observed between the mean gamma radiation levels and mean cellar 222Rn gas concentrations for the five subregions investigated, the gamma levels and the 222Rn gas concentrations do not correlate for single homes. For the population living on the ground floor of a house with a crystalline subsoil, the gamma radiation and the indoor air 222Rn lead to estimated mean exposures of 1.16 mSv and 9.44 mSv effective dose equivalent per year, respectively. In houses with a sedimentary subsoil, these mean exposures lead to 0.68 mSv y-1 and 3.22 mSv y-1, respectively. A mean tap water 222Rn content of 38.3 Bq L-1 and 10.4 Bq L-1 was measured in 31 villages with a crystalline subsoil and 73 villages with a sedimentary subsoil, respectively. Radon-222 degasing from the tap water into the indoor air leads to an additional exposure of about 0.11 mSv y-1 and 0.03 mSv y-1 in homes with a crystalline subsoil and homes with a sedimentary subsoil, respectively
21 CFR 1305.18 - Return of unused DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Return of unused DEA Forms 222. 1305.18 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.18 Return of unused DEA Forms 222. If the registration... substances for which the purchaser is registered, the purchaser must return all unused DEA Forms 222 to the...
21 CFR 1305.16 - Lost and stolen DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Lost and stolen DEA Forms 222. 1305.16 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.16 Lost and stolen DEA Forms 222. (a) If a purchaser ascertains that an unfilled DEA Form 222 has been lost, he or she must execute another in triplicate and...
21 CFR 1305.15 - Unaccepted and defective DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Unaccepted and defective DEA Forms 222. 1305.15... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.15 Unaccepted and defective DEA Forms 222. (a) A DEA Form 222 must not be filled if either of the following apply: (1) The order is not complete...
21 CFR 1305.11 - Procedure for obtaining DEA Forms 222.
2010-04-01
... the name, address, and registration number of the registrant and the number of books of DEA Forms 222... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for obtaining DEA Forms 222. 1305.11... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.11 Procedure for obtaining DEA Forms 222. (a) DEA...
Energy Technology Data Exchange (ETDEWEB)
Pereira, Wagner de Souza; Py Junior, Delcy de Azevedo [Industrias Nucleares do Brasil SA, Resende, RJ (Brazil). Gerencia de Licenciamento em Meio Ambiente]. E-mail: glima@inb.gov.br
2002-07-01
The pre operational monitoring program has been executed in order to set a baseline, on which comparisons with the same points and the same radionuclides will be made after beginning of operation, having the objective of environmental impact evaluation, in the vicinity of the installation. The program was held in the period of 1982 to 1999, collecting non biological environmental samples (aerosol, rain water, surface water, underground water soil and sediment) and samples that are related to the human food chain (manioc, manioc flour, milk, browse, fish, been, corn, cactus and silage). The analyzed radionuclides are natural uranium, natural thorium, Ra-226, Ra-228, Rn-222 and Pb-210. This work intends to analyze data from the last ten years, program (1989 - 1999), analyzing approximately 350 biological samples and 3500 non biological samples, in order to establishing the baseline to be used in future studies of environmental impact. (author)
20 CFR 222.55 - When a stepchild is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a stepchild is dependent. 222.55 Section 222.55 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.55 When a stepchild is dependent. An employee's...
21 CFR 1305.13 - Procedure for filling DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for filling DEA Forms 222. 1305.13... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.13 Procedure for filling DEA Forms 222. (a) A purchaser must submit Copy 1 and Copy 2 of the DEA Form 222 to the supplier and retain Copy 3 in the...
21 CFR 1305.14 - Procedure for endorsing DEA Forms 222.
2010-04-01
... on the reverse sides of Copies 1 and 2 of the DEA Form 222) the name and address of the second... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for endorsing DEA Forms 222. 1305.14... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.14 Procedure for endorsing DEA Forms 222. (a) A...
Cerezo Fernández, Agustín
2017-01-01
RESUMEN: Objetivo principal de este trabajo ha sido la datación de un testigo de 50 cm de profundidad de sedimentos extraído en el lago San Vicente (Argentina) en el año 2016 usando el método del 210Pb en exceso. Al analizar las medidas realizadas se detectó la posible contaminación por Uranio natural. En consecuencia se desarrolló un método para analizar cuantitativamente la presencia de dicha contaminación en los sedimentos. La datación de los sedimentos se ha realizado haciendo uso de m...
33 CFR 222.4 - Reporting earthquake effects.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Reporting earthquake effects. 222..., DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.4 Reporting earthquake effects. (a) Purpose. This... significant earthquakes. It primarily concerns damage surveys following the occurrences of earthquakes. (b...
International Nuclear Information System (INIS)
Dantas, Ana Leticia Almeida
2005-01-01
Radon and its decay products are present in the atmosphere and are the most important contributors for the internal exposure of humans to natural radiation. The execution of in vivo measurements of 210 Pb in the population and in individuals occupationally exposed in underground mines has been studied and recommended as one of the procedures for the estimation of the exposure to 222 Rn. The metabolism of 210 Pb and its distribution within the human body, mainly deposited in the bone tissue, suggests the regions of skull and knee as the most suitable for the in vivo monitoring of such radionuclide. A radiological survey in non uranium mines in Brazil indicated that an underground coal mine in the State of Parana, in the south of Brazil, had high radon concentration. The aim of this work were: (1) To investigate whether underground coal miners may also have elevated 210 Pb in the skeleton as a result of occupational exposure to radon in the coal mine; (2) To estimate the committed equivalent dose and the committed effective dose in different incorporation scenarios using a computer code. The calibration and the in vivo measurements of underground coal miners were performed in the IRD-CNEN Whole Body Counter shielded room using an array of four high resolution germanium detectors. The detection system was positioned at the head and knee geometries. The minimum detectable quantity of 210 Pb in the skeleton using this methodology was (50 Bq) and the positive results were verified using a mathematical method that applies a moving median smoothing function to the total spectrum for each measurement. In vivo measurements of 210 Pb in 6 out of the 32 underground coal miners ranged between 83 Bq and 164 Bq suggesting that these workers received significant occupational cumulative exposure to 222 Rn. The simulation of some exposure patterns of 222 Rn progeny and 210 Pb incorporation showed that the most important contribution for 210 Pb skeleton deposition was the intake of
27 CFR 26.222 - Still wines containing carbon dioxide.
2010-04-01
... carbon dioxide. 26.222 Section 26.222 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From the Virgin Islands § 26.222 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine...
7 CFR 1280.222 - Books and Records of Board.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and Records of Board. 1280.222 Section 1280.222... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.222 Books and Records of Board. The Board shall: (a) Maintain such books and records, which shall be made...
Hemoglobinopathies in newborns from Salvador, Bahia, Northeast Brazil
Directory of Open Access Journals (Sweden)
Adorno Elisângela Vitória
2005-01-01
Full Text Available Hemoglobinopathies are hereditary disorders of the hemoglobin molecule with a high prevalence worldwide. Brazil has a prevalence of 0.1 to 0.3% of newborns with sickle cell anemia and 20.0 to 25.0% of heterozygous alpha2 thalassemia among African Brazilians. In the present study, we investigated the presence of variant hemoglobins and alpha2(3.7 Kb and alpha2(4.2 Kb thalassemia in newborns from Salvador, Bahia, Brazil. Samples of umbilical cord blood from a total of 590 newborns were analyzed, of which 57 (9.8% were FAS; 36 (6.5% FAC; one (0.2% SF; and five (0.9% FSC. One hundred fourteen (22.2% newborns had alpha2(3.7 Kb thalassemia, of whom 101 (19.7% were heterozygous and 13 (2.5% homozygous, showing statistical significance for hematological data between newborns with normal alpha genes and alpha2(3.7 Kb thalassemia carriers. The alpha2(4.2 Kb thalassemia was not found. Frequencies found in the present study confirm that hemoglobinopathies are a public health problem in Brazil, emphasizing the need for neonatal screening and genetic counseling programs.
Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation
Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S
2008-01-01
We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.
20 CFR 222.35 - Relationship as stepchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as stepchild. 222.35 Section 222.35 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY... the relationship of stepchild of an employee, and will be considered a child for annuity but not for...
48 CFR 252.222-7002 - Compliance with local labor laws (overseas).
2010-10-01
... labor laws (overseas). 252.222-7002 Section 252.222-7002 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7002 Compliance with local labor laws (overseas). As prescribed in 222.7201(a), use the following clause: Compliance with Local Labor Laws (Overseas) (JUN 1997...
Exposure of burrowing mammals to {sup 222}Rn
Energy Technology Data Exchange (ETDEWEB)
Beresford, N.A., E-mail: nab@ceh.ac.uk [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Barnett, C.L. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Vives i Batlle, J. [Belgian Nuclear Research Centre (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Potter, E.D. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Ibrahimi, Z.-F. [Health Protection Agency, Centre for Radiation, Chemical and Environmental Hazards, Chilton, Didcot OX11 0RQ (United Kingdom); Barlow, T.S.; Schieb, C.; Jones, D.G. [British Geological Survey, Environmental Science Centre, Keyworth, Nottingham NG12 5GG (United Kingdom); Copplestone, D. [School of Natural Sciences, University of Stirling, Stirling FK9 4LA (United Kingdom)
2012-08-01
Estimates of absorbed dose rates to wildlife from exposure to natural background radionuclides are required to put estimates of dose rates arising from regulated releases of radioactivity and proposed benchmarks into context. Recent review papers have estimated dose rates to wildlife from {sup 40}K, and {sup 238}U and {sup 232}Th series radionuclides. However, only one study previous has considered the potential dose rates to burrowing animals from inhaled {sup 222}Rn and its daughter products. In this paper we describe a study conducted at seven sites in northwest England. Passive track etch detectors were used to measure the {sup 222}Rn concentrations in artificial burrows over a period of approximately one year. Results suggest that absorbed dose rates to burrowing mammals as a consequence of exposure to {sup 222}Rn are likely to be at least an order of magnitude higher than those suggested in previous evaluations of natural background exposure rates which had omitted this radionuclide and exposure pathway. Dose rates in some areas of Great Britain will be considerably in excess of incremental no-effects benchmark dose rates suggested for use as screening levels. Such advised benchmark dose rates need to be better put into context with background dose rates, including exposure to {sup 222}Rn, to ensure credibility; although the context will be determined by the purpose of the benchmark and the assessment level. - Highlights: Black-Right-Pointing-Pointer Determined {sup 222}Rn concentrations in artificial burrows. Black-Right-Pointing-Pointer Estimated dose rates to burrowing mammals from inhaled {sup 222}Rn and daughter products. Black-Right-Pointing-Pointer {sup 222}Rn likely to dominate exposure of burrowing mammals due to natural radionuclides.
20 CFR 222.14 - Deemed marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Deemed marriage relationship. 222.14 Section... FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.14 Deemed marriage relationship... may still be found to have the relationship as spouse of an employee based upon a deemed marriage. A...
Radon and progeny (214Pb and 214Bi) in urban water-supply systems of Sao Paulo State, Brazil
International Nuclear Information System (INIS)
Bonotto, Daniel Marcos; Padron-Armada, Priscilla Cardoso
2008-01-01
Many water-supply systems in South America utilize the waters of the Guarani aquifer at least as part of their networks. However, there is little present knowledge in Brazil of the factors affecting Rn presence in the water supplied for end-users, despite the economic importance of Guarani aquifer. 222 Rn analyzes of 162 water samples were performed at 8 municipalities in Sao Paulo State, Brazil, with the aim of investigating the major factors affecting its presence in solution. The 222 Rn activity concentration ranged from 0.04 up to 204.9 Bq/L, with three samples exceeding the World Health Organization maximum limit of 100 Bq/L. Aeration was confirmed as the most important factor for Rn release, as expected due to its gaseous nature. Accumulation in pipes and stratification in the water column were other significant factors explaining the data obtained in some circumstances. The Rn daughters 214 Pb and 214 Bi were also determined in a set of selected samples and their presence was directly related to the occurrence of Rn dissolved in water
36 CFR 222.10 - Range betterment fund.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Range betterment fund. 222.10... MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.10 Range betterment fund. In... also be accomplished through use of the range betterment fund as follows: (a) On National Forest land...
Measurement of 222Rn in soil concentrations in interstitial air
International Nuclear Information System (INIS)
Duenas, C.; Fernandez, M.C.; Carretero, J.; Liger, E.
1996-01-01
Measurements of 222 Rn soil concentrations were made by inserting stainless-steel sampling tubes into the soil. The samples of the soil interstitial air were taken in to pre-evacuated 1 L glass flasks. The glass flasks are cylindrical and coated with a film of ZnS(Ag). 222 Rn was measured by counting the alpha particles emitted by 222 Rn and its daughter products, 218 Po and 214 Bi, when they reached radioactive equilibrium. Measurements of 222 Rn gas concentrations in the soil air interstices by the method at different depths were used to calculate the diffusion coefficient of the 222 Rn in the soil air. This study has been carried out for diverse soils. (Author)
20 CFR 222.42 - When employee is contributing to support.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When employee is contributing to support. 222.42 Section 222.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.42 When...
Method for determination of radon-222 in water by liquid scintillation counting
International Nuclear Information System (INIS)
Suomela, J.
1993-06-01
The procedure for the determination of radon-222 by liquid scintillation counting is quite specific for this radionuclide. Radon-222 is extracted readily from the water sample by an organic scintillant. The decay products of radon-222 will remain in the water phase whilst radon-222 will be extracted into the organic phase. Before measurement the sample is stored for three hours until equilibrium is reached between radon-222 and its alpha emitting decay products. The alpha activity from radon-222 and its decay products is measured in a liquid scintillation counter
21 CFR 1305.19 - Cancellation and voiding of DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Cancellation and voiding of DEA Forms 222. 1305.19... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.19 Cancellation and voiding of DEA Forms 222. (a) A purchaser may cancel part or all of an order on a DEA Form 222 by notifying the supplier in...
48 CFR 52.222-20 - Walsh-Healey Public Contracts Act.
2010-10-01
... Contracts Act. 52.222-20 Section 52.222-20 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.222-20 Walsh-Healey Public Contracts Act. As prescribed in 22.610, insert the following clause in solicitations and contracts covered by the Act: Walsh-Healey Public Contracts Act (OCT 2010) If...
222 S Laboratory complex hazards assessment
International Nuclear Information System (INIS)
Sutton, L.N.
1998-01-01
This report documents the hazards assessment for the 222-S Analytical Laboratory located on the US Department of Energy (DOE) Hanford Site. Operation of the laboratory is the responsibility of Waste Management Federal Services, Inc. (WMFS). This hazards assessment was conducted to provide the emergency planning technical basis for the 222-S Facility. DOE Orders require an emergency planning hazards assessment for each facility that has the potential to reach or exceed the lowest level emergency classification
Excess bottom radon 222 distribution in deep ocean passages
International Nuclear Information System (INIS)
Sarmiento, J.L.; Broecker, W.S.; Biscaye, P.E.
1978-01-01
Radon 222 and STD profiles were obtained as part of the Geosecs program in the Vema Channel in the southwest Atlantic Ocean and in the Samoan, Clarion, and Wake Island passages in the Pacific Ocean. The standing crop of excess radon 222 is higher in the passages than at other nearby locations. The most likely explanation for this is that there is a high flux of radon 222 from the floor of the passages. Since much of the floor is covered with manganese nodules and encrustations, the high flux of radon 222 may be attributable to the high concentrations of radium 226 in the outer few millimeters of such deposits. Laboratory measurements of radon 222 emissivity from maganese encrustations obtained in Vema Channel support this hypothesis. The excess radon 222 in the Vema Channel and Wake Island Passage is found in substantial quantities at heights above bottom greatly exceeding the heights at which excess radon 222 is found in nonpassage areas. The horizontal diffusion of radon emanating from the walls of the passages is unlikely to be the cause of the observed concentrations because the ratio of wall surface area to water volume is very low. The profiles must therefore be a result of exceptionally high apparent vertical mixing in the passages. Further work is needed to determine the nature of this apparent vertical mixing. The excess radon 222 and STD data in all four passages have been fit with an empirical model in which it is assumed that the bouyancy flux is constant with distance above bottom. The fits are very good and yield apparent buoyancy fluxes that are between 1 and 3 orders of magnitude greater than those obtained at nearby stations outside the passages for three of the four passages
Theoretical study of the diffusion 222Rn gas on activated charcoal
International Nuclear Information System (INIS)
Lopez, Fabio O.; Canoba, Analia C.
2001-01-01
The 222 Rn adsorption coefficient is the fundamental parameter characterizing activated carbon's ability to adsorb 222 Rn . In this work, it has been determined the 222 Rn coefficient adsorption for 222 Rn activated carbon detectors. Scintillation vials were used as detectors. The measurement of the 222 Rn activity adsorbed in activated carbon was made by a liquid scintillation measurement of its alpha-beta progeny decay. On the other hand, in this work a diffusion and adsorption model has been developed for the transport of 222 Rn in an activated carbon porous bed. The equation that describes these processes is a partial differential equation, of the second order with respect to axial coordinate, and the first order with respect to time. The equation was numerically solved using a finites differences method. With this model the 222 Rn activity adsorbed in the detector, for several situations, was calculated. The results were tested with the data obtained from series of experiences made in our laboratories. (author)
20 CFR 222.15 - When spouse is living with employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living with employee. 222.15 Section 222.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.15 When spouse is living with...
20 CFR 222.3 - Other regulations related to this part.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 222.3 Section 222.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.3 Other regulations related to this part. This part is related to a...
5 CFR 9901.222 - Review of classification decisions.
2010-01-01
....222 Section 9901.222 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE...., pay system, career group, occupational series, official title, pay schedule, or pay band) of his or...
Energy Technology Data Exchange (ETDEWEB)
Pena, P; Tamez, E; Iturbe, J L; Acosta, A; Segovia, N [Instituto Nacional de Investigaciones Nucleares, Mexico City (Mexico); Carrillo, J; Armienta, M [Universidad Nacional Autonoma de Mexico, Mexico City (Mexico). Inst. de Geofisica
1994-12-31
The presence of radionuclides in underground waters may be an indication of its origin and also the sign of the hydraulic properties of the aquifers layers where circulate. Additionally, the ingestion by human beings of water with radioactive elements (Radon 222, Radium 226, Uranium 238) can give as a result the accumulation of such elements in several organs of the body producing then health damages. In this work, the concentrations of Radon 222, Radium 226 and Uranium 238, in waters coming from deep wells which provide with drinking water the Toluca Valley, were determined. For this purpose, during a year (june 1991 to August 1992) ten wells were sampled with a tracking of the radionuclides concentration as well as the physical-chemical components of water; it was established the relationship presented by the analyzed waters with the local geology and the local and regional systems. (Author).
Ethnicity and Cutaneous Melanoma in the City of Sao Paulo, Brazil: A Case-Control Study
Luiz, Olinda C.; Gianini, Reinaldo José; Gonçalves, Fernanda T.; Francisco, Guilherme; Festa-Neto, Cyro; Sanches, José Antonio; Gattas, Gilka J. F.; Chammas, Roger; Eluf-Neto, José
2012-01-01
Background Over the last century the incidence of cutaneous melanoma has increased worldwide, a trend that has also been observed in Brazil. The identified risk factors for melanoma include the pattern of sun exposure, family history, and certain phenotypic features. In addition, the incidence of melanoma might be influenced by ethnicity. Like many countries, Brazil has high immigration rates and consequently a heterogenous population. However, Brazil is unique among such countries in that the ethnic heterogeneity of its population is primarily attributable to admixture. This study aimed to evaluate the contribution of European ethnicity to the risk of cutaneous melanoma in Brazil. Methodology/Principal Findings We carried out a hospital-based case-control study in the metropolitan area of Sao Paulo, Brazil. We evaluated 424 hospitalized patients (202 melanoma patients and 222 control patients) regarding phenotypic features, sun exposure, and number of grandparents born in Europe. Through multivariate logistic regression analysis, we found the following variables to be independently associated with melanoma: grandparents born in Europe—Spain (OR = 3.01, 95% CI: 1.03–8.77), Italy (OR = 3.47, 95% CI: 1.41–8.57), a Germanic/Slavic country (OR = 3.06, 95% CI: 1.05–8.93), or ≥2 European countries (OR = 2.82, 95% CI: 1.06–7.47); eye color—light brown (OR = 1.99, 95% CI: 1.14–3.84) and green/blue (OR = 4.62; 95% CI 2.22–9.58); pigmented lesion removal (OR = 3.78; 95% CI: 2.21–6.49); no lifetime sunscreen use (OR = 3.08; 95% CI: 1.03–9.22); and lifetime severe sunburn (OR = 1.81; 95% CI: 1.03–3.19). Conclusions Our results indicate that European ancestry is a risk factor for cutaneous melanoma. Such risk appears to be related not only to skin type, eye color, and tanning capacity but also to others specific characteristics of European populations introduced in the New World by European immigrants. PMID:22558444
20 CFR 222.22 - Relationship as divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as divorced spouse. 222.22 Section 222.22 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
48 CFR 252.222-7005 - Prohibition on use of nonimmigrant aliens-Guam.
2010-10-01
... nonimmigrant aliens-Guam. 252.222-7005 Section 252.222-7005 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7005 Prohibition on use of nonimmigrant aliens—Guam. As prescribed in 222.7302, use the following clause: Prohibition on Use of Nonimmigrant Aliens—Guam (SEP 1999...
Energy Technology Data Exchange (ETDEWEB)
Chagas, Claudio Jose
2017-11-01
Within the framework of 'Nuclear Techniques' is the use of natural and artificial isotopes as tracers for the study of the environment. The use of natural tracers in hydrology is a very useful tool that has been used in several scenarios. One such tracer is the isotope of radon, {sup 222}Rn, a noble gas from natural sources as a consequence of alpha decay of {sup 226}Ra. Radon can be found, to a greater or lesser degree, in all groundwater, as well as in soils and rocks from where it exudes into the atmosphere through spaces arising from fissures and or nanopores present. It can emerge into the water bodies by the leaching of water or other liquids through these interstices. In this research, the {sup 222}Rn gas diluted naturally by the leaching of the water that infiltrated the soils and rocks of the aquifers was used as a tracer in order to identify sections of discharge of these aquifers along the Stream of Matinha. The study area is about 70 km from Belo Horizonte and is in the city of Itauna, MG. The Matinha stream is about 2,200 m in length and is part of the network of tributaries of the water reservoir called Serra Azul, in the Juatuba River Basin, MG. The results presented express the studies that occurred between the second half of 2014 and the first half of 2016, in ten campaigns for water sampling, flow and natural gamma radiation measurements. Water samples were collected near the bottom and very close to the thalweg in the watercourse using syringe and or peristaltic suction pump at low flow to avoid gas leakage. The {sup 222}Rn analyzes were performed in the field during the collections and in the laboratory of the CDTN - Centro de Desenvolvimento da Tecnologia Nuclear, all of which were carried out with the radon detector RAD 7. The flow measurements counted on the use of the fluorescent tracer's technique: rhodamine and fluorescein were used for injection at points upstream and downstream of sections with higher {sup 222}Rn
Enatioselective[2+2+2] Cycloaddition as A Synthetic Tool
Institute of Scientific and Technical Information of China (English)
T.Shibata; S.Yoshida; M.Otsuka; Y.Arai; K.Endo
2007-01-01
1 Results Transition metal-catalyzed [2+2+2] cycloaddition is one of the most efficient protocols for the construction of six-membered ring system.Our group has comprehensively studied various types of highly enantioselective [2+2+2] cycloaddition for the synthesis of chiral cycloadducts; we already reported an iridium-catalyzed intermolecular [2+2+2] cycloaddition between α,ω-diynes,having various tethers and substituents on the alkyne termini,and monoalkynes,possessing oxygen or/and nitrogen functiona...
International Nuclear Information System (INIS)
Bonotto, D.M.; Mello, C.B.
2006-01-01
A combined method for evaluating radon ( 222 Rn) and progeny ( 214 Pb and 214 Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Pocos de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for 214 Pb and 214 Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in Sao Paulo State, Brazil, and the results of the measurements indicated that 214 Pb and 214 Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent 222 Rn
Energy Technology Data Exchange (ETDEWEB)
Bonotto, D.M. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), IGCE-Instituto de Geociencias e Ciencias Exatas, Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)]. E-mail: dbonotto@rc.unesp.br; Mello, C.B. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), IGCE-Instituto de Geociencias e Ciencias Exatas, Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)
2006-07-01
A combined method for evaluating radon ({sup 222}Rn) and progeny ({sup 214}Pb and {sup 214}Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Pocos de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for {sup 214}Pb and {sup 214}Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in Sao Paulo State, Brazil, and the results of the measurements indicated that {sup 214}Pb and {sup 214}Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent {sup 222}Rn.
Natural and technologically enhanced sources of radon-222
International Nuclear Information System (INIS)
Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.; Cotter, S.J.; Randolph, M.L.; Fields, D.E.
1979-01-01
An assessment of 222 Rn releases (curies/year) from major natural and technologically enhanced sources in the United States is presented. The resulting inhalation population dose commitments to the bronchial epithelium of the lung (lung-rem) are also estimated. The sources of radon considered are natural soil, evapotranspiration, potable water supplies, building materials, natural gas, uranium mining and milling, coal and phosphate mining, phosphate fertilizer, liquefied petroleum gas, geothermal power facilities, coal-fired power plants, and gas and oil wells. The most important natural source of 222 Rn is decay of 226 Ra in the soil and rocks of the earth's crust. This source results in approximately 40% of the total population dose from all sources of radon. The largest technoligcally enhanced contributor to population dose is airborne 222 Rn in building interiors, which is estimated to contribute 55% to the total population exposure to 222 Rn. Each of the other sources is estimated to contribute less than 3% to the total
Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America
International Nuclear Information System (INIS)
Bonotto, D.M.
2004-01-01
Groundwater samples were analysed for 222 Rn, 226 Ra, and 228 Ra in Guarani aquifer spreading around 1 million km 2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay
Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America.
Bonotto, D M
2004-01-01
Groundwater samples were analysed for 222Rn, 226Ra, and 228Ra in Guarani aquifer spreading around 1 million km2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.
22 CFR 40.68 - Aliens subject to INA 222(g).
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Aliens subject to INA 222(g). 40.68 Section 40... § 40.68 Aliens subject to INA 222(g). An alien who, under the provisions of INA 222(g), has voided a... new nonimmigrant visa unless the alien complies with the requirements in 22 CFR 41.101 (b) or (c...
The sugar cane agro-industry - its contribution to reducing CO2 emissions in Brazil
International Nuclear Information System (INIS)
Macedo, I. de C.
1992-01-01
Production of sugar cane in Brazil is 222 million tonnes (harvested wet weight)/year and is processed to sugar (7.5 million tonnes) and ethanol (11.8 million m 3 ) in 1990. The use of fossil fuels in sugar cane production is 271 MJ/t of cane. Sugar cane bagasse and ethanol substitute for fuel oil in the food and chemical industry (including sugar production) and for gasoline (9.75 million m 3 /year), thus avoiding CO 2 emissions from fossil fuels. Considering the fast carbon cycling in sugar cane production and use, net emissions of 9.45 million tonnes of C/year are avoided; this corresponds roughly to 18% of the total CO 2 emissions from fossil fuels in Brazil. (author)
Vibrations in the urban environment controlling 222Rn migration in soils
International Nuclear Information System (INIS)
Wiegand, J.
1998-01-01
Comparable to investigations looking for a connection of 222 Rn and earthquakes, this study shows the influence of subsurface vibrations on the 222 Rn concentration of the soil-gas in urban environments. Generally, the 222 Rn concentration increases through vibrations induced by trains, street-traffic and activities at project sites. The spatial radius of the 222 Rn increase due to vibrations reach highest values at project sites where piled foundations or metal panels are rammed into the ground (> 60 m). Along railway tracks the radius is wider (> 30 m) than along heavy traffic roads ( 222 Rn concentrations in soil-gas due to vibrations is the highest at project sites (53%). Along heavy traffic roads the increase of 222 Rn concentrations by motor vehicle traffic is higher (37%) than that by railway traffic (11.5%). The maximum increase of 400% was observed in a distance of 1 m from a railway track. In the vicinity of railway tracks a difference of the vibration influence according to unconsolidated rock (11.1%) or solid rock (11.8%) was not noticed. Beside this vibration effect, the overall 222 Rn level decreases with increasing distance to the vibration source, but only at locations laying above solid rocks. The observation of the increase of 222 Rn concentrations can be explained by a 'pump effect': the mechanical vibration of soil and mineral particles leads to an upward motion of the whole volume of soil-gas. Therefore, 222 Rn is pumped out of the soil to the atmosphere and as a result the upward transport is increased. (author)
20 CFR 222.11 - Determination of marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of marriage relationship. 222... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.11 Determination of marriage relationship. A claimant will be considered to be the husband, wife, or widow(er) of an employee...
12 CFR 222.83 - Disposal of consumer information.
2010-01-01
... RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Duties of Users of Consumer Reports Regarding Identity Theft § 222.83 Disposal of consumer information. (a) Definitions as used in this section. (1) You means... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Disposal of consumer information. 222.83...
International Nuclear Information System (INIS)
Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao; Guo Qiuju; Tohjima, Yasunori
2009-01-01
A monitoring network of atmospheric 222 Rn concentration as a tracer for long-range transport in East Asia was established. Atmospheric 222 Rn concentration at Beijing, which is located on China Continent was 10-20 Bq m -3 , at Nagoya, which is located on edge of terrestrial area was 3-10 Bq m -3 and at Hachijo-jima and Hateruma-jima, which are solitary islands in Pacific Ocean was 0.5-3 Bq m -3 , respectively. The atmospheric 222 Rn concentration variations were different from sites. The 222 Rn concentration was the lowest in the summer and the highest in the winter except Nagoya where the highest was observed in the autumn and the lowest in the spring. Diurnal variations were measured at Beijing and Nagoya. In contrast, diurnal variations were not measured but several-day-cycle variations were measured at Hachijo-jima and Hateruma-jima. It was pointed out by this study that the several-day-cycle variations at Hachijo-jima were dependent on synoptic-scale atmospheric disturbance. 222 Rn concentration increased rapidly after a cold front passed through Hachijo-jima. Backward trajectory analysis of the relationship between atmospheric 222 Rn concentrations at Hachijo-jima and transport pathway of air mass indicates that air mass transported from China and Siberia has high concentration 222 Rn and air mass transported from Pacific Ocean has low concentration 222 Rn. In winter, atmospheric 222 Rn concentrations at Hachijo-jima is dependent on vertical transport pathway rather than horizontal transport pathway. (author)
20 CFR 222.41 - Determination of relationship and support for parent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of relationship and support for parent. 222.41 Section 222.41 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.41...
20 CFR 222.56 - When a grandchild or stepgrandchild is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a grandchild or stepgrandchild is dependent. 222.56 Section 222.56 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.56 When a grandchild or...
Bonotto, D M; Mello, C B
2006-01-01
A combined method for evaluating radon (222Rn) and progeny (214Pb and 214Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Poços de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for 214Pb and 214Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in São Paulo State, Brazil, and the results of the measurements indicated that 214Pb and 214Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent 222Rn.
Preliminary experiences with 222Rn gas in Arizona homes
International Nuclear Information System (INIS)
Kearfott, K.J.
1989-01-01
Results of a survey of 222Rn gas using four-day charcoal canister tests in 759 Arizona homes are reported. Although the study was not random with respect to population or land area, it was useful in identifying areas at risk and locating several homes having elevated indoor 222Rn air concentrations. Approximately 18% of the homes tested exceeded 150 Bq m-3 (4 pCi L-1), with 7% exceeding 300 Bq m-3 (8 pCi L-1). Several Arizona cities had larger fractions of homes exceeding 150 Bq m-3 (4 pCi L-1), such as Carefree and Cave Creek (23%), Paradise Valley (30%), Payson (33%), and Prescott (31%). The Granite Dells and Groom Creek areas of Prescott had in excess of 40-60% of the houses tested exceeding 150 Bq m-3 (4 pCi L-1). Elevated 222Rn concentrations were measured for a variety of home types having different construction materials. Private well water was identified as a potentially significant source of 222Rn gas in Prescott homes, with water from one well testing over 3.5 MBq m-3 (94,000 pCi L-1). A 222Rn concentration in air exceeding 410,000 Bq m-3 (11,000 pCi L-1) was measured using a four-day charcoal canister test in a house in Prescott which had a well opening into a living space. Additional measurements in this 150-m3 dwelling revealed a strikingly heterogeneous 222Rn concentration. The excessive 222Rn level in the dwelling was reduced to less than 190 Bq m-3 (5.2 pCi L-1) by sealing the well head with caulking and providing passive ventilation through a pipe
20 CFR 222.57 - When an equitably adopted child is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When an equitably adopted child is dependent. 222.57 Section 222.57 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.57 When an equitably adopted child is...
36 CFR 222.3 - Issuance of grazing and livestock use permits.
2010-07-01
... livestock use permits. 222.3 Section 222.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE RANGE MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.3 Issuance of grazing and livestock use permits. (a) Unless otherwise specified by the Chief, Forest Service, all...
Radon 222 and tropospheric vertical transport
International Nuclear Information System (INIS)
Liu, S.C.; McAfee, J.R.; Cicerone, R.J.
1984-01-01
Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3.83 days (5.51-day ''exponential'' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Thus it is similar in several ways to many air pollutants (e.g., NO/sub x/) (NO+NO 2 ), SO 2 , and certain hydrocarbons. Previously published measured 222 Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the 222 Rn is transported above the planetary boundary layer, considerably more than during the other seasons. Similarly, in summer, about 20% rises to over 5.5 km (500 mbar). The average profiles have been used to derive vertical eddy diffusion coefficients with maximum values of 5-7 x 10 5 cm 2 s -1 in the midtroposphere and 8 x 10 3 to 5 x 10 4 cm 2 s -1 near the surface
20 CFR 222.23 - Relationship as surviving divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as surviving divorced spouse. 222.23 Section 222.23 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried...
Intercomparison of Rn-222 determination from groundwater
DEFF Research Database (Denmark)
Vesterbacka, P.; Pettersson, H.; Hanste, U.-M.
2010-01-01
An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing, transpor......An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing...
Quantification of Groundwater Discharge in a Subalpine Stream Using Radon-222
Directory of Open Access Journals (Sweden)
Elizabeth Avery
2018-01-01
Full Text Available During the dry months of the water year in Mediterranean climates, groundwater influx is essential to perennial streams for sustaining ecosystem health and regulating water temperature. Predicted earlier peak flow due to climate change may result in decreased baseflow and the transformation of perennial streams to intermittent streams. In this study, naturally occurring radon-222 (222Rn was used as a tracer of groundwater influx to Martis Creek, a subalpine stream near Lake Tahoe, CA. Groundwater 222Rn is estimated based on measurements of 222Rn activity in nearby deep wells and springs. To determine the degassing constant (needed for quantification of water and gas flux, an extrinsic tracer, xenon (Xe, was introduced to the stream and monitored at eight downstream locations. The degassing constant for 222Rn is based on the degassing constant for Xe, and was determined to be 1.9–9.0 m/day. Applying a simple model in which stream 222Rn activity is a balance between the main 222Rn source (groundwater and sink (volatilization, the influx in reaches of the upstream portion of Martis Creek was calculated to be <1 to 15 m3/day/m, which cumulatively constitutes a significant portion of the stream discharge. Experiments constraining 222Rn emanation from hyporheic zone sediments suggest that this should be considered a maximum rate of influx. Groundwater influx is typically difficult to identify and quantify, and the method employed here is useful for identifying locations for focused stream flow measurements, for formulating a water budget, and for quantifying streamwater–groundwater interaction.
20 CFR 222.24 - Relationship as remarried widow(er).
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
36 CFR 222.29 - Relocation and disposal of animals.
2010-07-01
... animals. 222.29 Section 222.29 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... disposal of animals. (a) The Chief, Forest Service, shall, when he determines over-population of wild... animals from that particular territory. Such action shall be taken until all excess animals have been...
Relationship between 222Rn concentration in soil water and degree of saturation
International Nuclear Information System (INIS)
Hamada, Hiromasa; Komae, Takami
1996-01-01
The object of the researches an analyzing downward flow to groundwater using 222 Rn concentration in water as an indicator has been saturated flow. However, when groundwater table is low, downward flow from surface is unsaturated flow. In this paper, the authors represented the relationship between 222 Rn concentration in soil water and degree of saturation, and measured the vertical distributions of 222 Rn concentrations in groundwater and 222 Rn concentration in water table in the fields. As the results, it was found that 222 Rn concentrations in the vicinity of groundwater table decreased by unsaturated downward flow. Moreover, from the variation of 222 Rn concentrations in groundwater table, it was possible to show the occurrence of the unsaturated downward flow by paddy fields irrigation, i.e., the downward flow of the soil water pushed out by irrigation water, the unsaturated percolation in the irrigation period, and the redistribution of the soil water after the release of ponding water. The degree of saturation in downward flow was calculated to be about 50% from 222 Rn concentrations in the irrigation period and in the non-irrigation period. It was deduced that the value was within reasonable range considering the difference of the hydraulic conductivities between of the upper layer and of the lower layer. These results proved that the relationship between 222 Rn concentrations in soil water and degree of saturation represented by the authors was reasonable and that the analytical method using 222 Rn concentrations in groundwater table as an indicator was useful 10 analyze the actual stale of unsaturated downward flow. (author)
24 CFR 92.222 - Reduction of matching contribution requirement.
2010-04-01
... major disaster pursuant to the Robert T. Stafford Disaster Relief and Emergency Assistance Act is made... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reduction of matching contribution requirement. 92.222 Section 92.222 Housing and Urban Development Office of the Secretary, Department of...
Use of 222Rn for estimation of greenhouse gases emissions at Russian territory
Berezina, E. V.; Elansky, N. F.
2009-04-01
It is well known that 222Rn is widely used as a tracer for studying different atmospheric processes including estimations of greenhouse gases emissions. Calculation of 222Rn fluxes from the soil into the atmosphere allows quantitative estimation of greenhouse gases emissions having the soil origin or sources of which are located near the surface. For accurate estimation of 222Rn fluxes detailed investigations of spatial and temporal variations of its concentrations are necessary. 222Rn concentrations data in the atmospheric surface layer over continental Russia from Moscow to Vladivostok obtained during the six TROICA (Transcontinental Observations Into the Chemistry of the Atmosphere) expeditions of the mobile laboratory along the Trans-Siberian railroad are analyzed. Spatial distribution, diurnal and seasonal variations of surface 222Rn concentrations along the Trans-Siberian railroad are investigated. According to the obtained data surface 222Rn concentration values above continental Russia vary from 0.5 to 75 Bq/m3 depending on meteorological conditions and geological features of the territory with the average value being 8.42 ± 0.10 Bq/m3. The average 222Rn concentration is maximum in the autumn expedition and minimum in the spring one. The factors mostly influencing 222Rn concentration variations are studied: surface temperature inversions, geological features of the territory, precipitations. 222Rn accumulation features in the atmospheric surface layer during night temperature inversions are analyzed. It was noted that during night temperature inversions the surface 222Rn concentration is 7 - 8 times more than the one during the nights without temperature inversions. Since atmospheric stratification determines accumulation and diurnal variations of many atmospheric pollutants as well as greenhouse gases its features are analyzed in detail. Surface temperature inversions were mainly observed from 18:00-19:00 to 06:00-07:00 in the warm season and from 16
Surface-water radon-222 distribution along the west-central Florida shelf
Smith, C.G.; Robbins, L.L.
2012-01-01
In February 2009 and August 2009, the spatial distribution of radon-222 in surface water was mapped along the west-central Florida shelf as collaboration between the Response of Florida Shelf Ecosystems to Climate Change project and a U.S. Geological Survey Mendenhall Research Fellowship project. This report summarizes the surface distribution of radon-222 from two cruises and evaluates potential physical controls on radon-222 fluxes. Radon-222 is an inert gas produced overwhelmingly in sediment and has a short half-life of 3.8 days; activities in surface water ranged between 30 and 170 becquerels per cubic meter. Overall, radon-222 activities were enriched in nearshore surface waters relative to offshore waters. Dilution in offshore waters is expected to be the cause of the low offshore activities. While thermal stratification of the water column during the August survey may explain higher radon-222 activities relative to the February survey, radon-222 activity and integrated surface-water inventories decreased exponentially from the shoreline during both cruises. By estimating radon-222 evasion by wind from nearby buoy data and accounting for internal production from dissolved radium-226, its radiogenic long-lived parent, a simple one-dimensional model was implemented to determine the role that offshore mixing, benthic influx, and decay have on the distribution of excess radon-222 inventories along the west Florida shelf. For multiple statistically based boundary condition scenarios (first quartile, median, third quartile, and maximum radon-222 inshore of 5 kilometers), the cross-shelf mixing rates and average nearshore submarine groundwater discharge (SGD) rates varied from 100.38 to 10-3.4 square kilometers per day and 0.00 to 1.70 centimeters per day, respectively. This dataset and modeling provide the first attempt to assess cross-shelf mixing and SGD on such a large spatial scale. Such estimates help scale up SGD rates that are often made at 1- to 10-meter
20 CFR 222.43 - How the one-half support determination is made.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How the one-half support determination is made. 222.43 Section 222.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.43...
COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
International Nuclear Information System (INIS)
Skliarov, V.; Rottger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.
2009-01-01
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)
COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
Energy Technology Data Exchange (ETDEWEB)
Skliarov, V. [National Scientific Centre, Institute of Metrology (NSC IM), Kharkiv (Ukraine); Rottger, A.; Honig, A. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Korostin, S.; Kuznetsov, S. [All-Russian Scientific Research Institute of Physical, Technical and Radio Measurements (VNIIFTRI), Moscow Region, Mendeleyevo (Russian Federation); Lapenas, A. [Latvian National Metrology Centre Ltd, Radiation Metrology and Testing Centre (RMTC), Salaspils (Latvia); Milevsky, V.; Ivaniukovich, A. [Belarussian State Institute of Metrology (BelGIM), Minsk (Belarus); Kharitonov, I.; Sepman, S. [D I Mendeleyev Institute of metrology (VNIIM), Saint Petersburg (Russian Federation)
2009-06-15
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)
36 CFR 222.2 - Management of the range environment.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of the range environment. 222.2 Section 222.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... environment. (a) Allotments will be designated on the National Forest System and on other lands under Forest...
20 CFR 222.52 - When a legally adopted child is dependent-general.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-general. 222.52 Section 222.52 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.52 When a legally adopted...
Radon-222 measurements at Chester
International Nuclear Information System (INIS)
Fisenne, I.M.
1982-01-01
The Environmental Measurements Laboratory has compiled a five year record of continuous hourly radon-222 measurements at Chester, New Jersey. The data for the 1977-1978, 1978-1979, 1979-1980, and 1980-1981 have been reported previously
International Nuclear Information System (INIS)
Binns, D.A.C.; Gouvea, V.A.; Melo, V.P.; Tolentino, J.
1996-01-01
Measurements of Rd-222 concentrations were performed at some points into drift of three gold underground mining companies of Nova Lima region - MG/Br. In the two oldest mines, Mina Grande and Mina Cuiaba, were found the highest concentrations, with a mean of 1911 Bq.m -3 , while a mean of concentration into the other mine, Mina Raposo, was 108 Bq.m -3 . The Mina Raposo correspond to a modern facility with efficient exhaust and ventilation system. The results of this study have demonstrated that ventilation is the most important factor to reduce the occupational radiation exposure of workers in mining operations
20 CFR 222.58 - When a child is living with an employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a child is living with an employee. 222.58 Section 222.58 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.58 When a child is living with an...
Rn 222 in the Black Sea waters
International Nuclear Information System (INIS)
Arbuzova, A.P.; Batrakov, G.F.; Eremeev, V.N.; Zemlyanoj, A.D.; Ivanova, T.M.
1988-01-01
Results of Rn 222 concentration measurements in the Black Sea waters obtained in the summer of 1986 during the expedition of the Akademik Vernadskij research ship are presented. It is ascertained that the intensity of vertical turbulent exchange produces the main effect on Rn 222 distribution in the sea surface waters. The vertical distribution in a 200 m layer is characterized by the growth of concentration with depth, which is caused by the presence of Ra 226 increased concentration region, that coincides with the boundary layer between oxygen and hydrogen sulfide
Absolute measurement of the activity of 222Rn using a proportional counter
International Nuclear Information System (INIS)
Busch, Ingo; Greupner, Heinz; Keyser, Uwe
2002-01-01
A measuring set-up comprising a proportional counter of calculable 222 Rn efficiency and quantifiable active volume (δ V 222 Rn efficiency is determined by computer simulation of the measured α-spectra. The procedures necessary for absolute measurements by means of the counter are described, and the suitability of the counter for absolute measurements of the 222 Rn activity is proved by experiments. Thus, a new method for the realization of the unit of activity of 222 Rn is obtained, which is independent of the unit of activity of 226 Ra
Factors affecting radon removal from Rn-222 enriched water
International Nuclear Information System (INIS)
Abulfaraj, W.H.; Mamoon, A.
1994-01-01
Continued use of potable well water that has elevated levels of Rn-222 is harmful to human health. activated carbon, aeration and heating can remove radon from treated water. Water artificially enriched with Rn-222 using a pitchblende source was studied in a laboratory scale model under controlled conditions. (author), 3 figs., 3 refs
Standards, calibration and quality assurance of 222Rn measurements in Sweden
International Nuclear Information System (INIS)
Falk, R.; Hagberg, N.; Mjoenes, L.; Moere, H.; Nyblom, L.; Swedjemark, G.A.
1994-01-01
Inhaled decay products of 222 Rn are the dominant components of the natural radiation exposure to the general population. Limits have been introduced in Sweden, and recommendations were made in 1980 for decreasing indoor 222 Rn concentration. The need for the coordinated calibration of measuring instruments as well as for quality assurance was obvious for both health and economic reasons. 222 Rn measurements in Sweden are based on standards traceable to the National Institute of Standard and Technology (NIST) through the use of standard reference material 226 Ra. Standards for both 222 Rn and short-lived 222 Rn progeny are described together with the reference instrument adopted for these studies. The calibration of field instruments was performed in a ''radon room'', a climate chamber in which it is possible to vary and monitor the concentration of 222 Rn as well as other characteristics of the indoor air such as temperature, humidity, ventilation rate and aerosol concentration. The rules and regulations for field measurements imply a calibration of the instruments yearly, as well as accreditation and training for the companies that carry out the measurements. Examples are given of the official measurement protocols used for the different types of instruments. (orig.)
A micromegas detector for {sup 222}Rn emanations measurements
Energy Technology Data Exchange (ETDEWEB)
García, J. A.; Garza, J. G.; Irastorza, I. G.; Mirallas, H. [Laboratorio de Física Nuclear y Altas Energías, Universidad de Zaragoza, Zaragoza (Spain)
2013-08-08
The {sup 222}Rn emanation has significant contribution in the overall background for rare event searches experiments. In order to measure this emanations a high sensitivity detector has been designed. The detection method is based on the electrostatic collection of the {sup 222}Rn daughters on a Micromegas detector. Using a chamber with a volume of 21.2 l for the collection of {sup 218}Po and {sup 214}Po progeny of {sup 222}Rn and a 12 × 12cm{sup 2} pixelized Micromegas for the α detection. The advantages of the Micromegas detectors are the low intrinsic radioactivity and the track reconstruction of the α’s, having excellent capabilities for event discrimination.
Radon-222 and radium-226 in southeastern Bering Sea shelf waters and sediment
International Nuclear Information System (INIS)
Glover, D.M.; Reeburgh, W.S.
1987-01-01
Radon-222 and 226 Ra activities were measured in the waters and sediment of the southeastern Bering Sea shelf to evaluate the use of radon as a tracer of gas exchange, water column mixing and sediment-water exchange. Cross-shelf distributions of 222 Rn and 226 Ra are presented. Gas transfer coefficients were estimated using near-surface 222 Rn deficiency measurements. A statistically significant linear relationship between averaged wind speed and transfer coefficient was found. Vertical eddy diffusivities were evaluated by applying a one-dimensional model to near-bottom excess 222 Rn distributions; these diffusivities were compared to independently determined values. The one-dimensional model applied to the near-bottom 222 Rn data was found to be inadequate and a two-dimensional model was applied to improve the fit between model and data. Exchange across the sediment-water interface was computed from the deficiency of 222 Rn measured in sediment cores, standing crop estimates of excess 222 Rn in the water column and 222 Rn production rates of sediment surface grab samples. Biological irrigation of the sediments appeared to be the primary exchange mechanism between the sediment and water columns. Distributions in the water column showed finestructure reported previously and suggested biological removal of 226 Ra. (author)
40 CFR 22.2 - Use of number and gender.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Use of number and gender. 22.2 Section... PERMITS General § 22.2 Use of number and gender. As used in these Consolidated Rules of Practice, words in the singular also include the plural and words in the masculine gender also include the feminine, and...
Lifescience Database Archive (English)
Full Text Available 222.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 光学顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2010/02/15 15:28:38 2010/02/16 10:25:09 ...
Primary measuring of equipment factor of 222Rn/220Rn indoor
International Nuclear Information System (INIS)
Liu Yanyang; Liu Fudong; Wang Chunhong; Sheng Mingwei
2010-01-01
The activity concentration of 222 Rn, 220 Rn and their progenies of certain working places and dwellings in Baotou city were measured simultaneously. Based on these results, the equipment factor of 222 Rn is 0.35 for working places and 0.43 for dwellings, while equipment factor of 220 Rn measured at 20 cm distance from wall is 0.030 for both working places and dwellings. Preliminary results show that the temporal change of 220 Rn equilibrium equivalent concentration is same as 222 Rn which is high in midnight and low in afternoon,and significant difference between instant and accumulated measure result of 222 Rn, 220 Rn activity concentration is found, with the factor of 2.1 and 1.7. (authors)
Kotzur, Patrick F; Torres, Cláudio V; Kedzior, Karina K; Boehnke, Klaus
2017-04-01
This study investigates the relationship between political consumerism and core political values (CPVs) among university students in Brazil (N = 414) and Germany (N = 222). Despite the prerequisite to endorse values that are compatible with political consumerism, contextual features of one's immediate environment might affect overall levels of political consumerism. Our results show that political consumerism is significantly associated with higher income in Brazil (but not in Germany). After controlling for income, political consumerism was practised more frequently in Germany than in Brazil, in urban compared with rural areas, and was not dependent on gender. The urban-rural split was stronger in Brazil than in Germany. These results confirm our hypothesis that contextual features are associated with political consumerism. Furthermore, the political value Equality positively predicted political consumerism in both countries. In contrast, Traditional Morality and support of Free Enterprise negatively predicted political consumerism, although the effect sizes of these relationships were only small. These results suggest that political consumerism among university students is widespread in Germany but not in Brazil. Interestingly, regardless of its low prevalence in Brazil, political consumerism is positively associated with the CPV of Equality among university students in both countries. © 2015 International Union of Psychological Science.
Energy Technology Data Exchange (ETDEWEB)
Bonotto, D.M. E-mail: dbonotto@rc.unesp.br
2004-07-01
Groundwater samples were analysed for {sup 222}Rn, {sup 226}Ra, and {sup 228}Ra in Guarani aquifer spreading around 1 million km{sup 2} within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.
2010-07-01
... is obtained for purposes directly related to enforcement of the criminal laws. (d) Research or... Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL INFORMATION § 22.2... capacity. (c) Research or statistical project means any program, project, or component thereof which is...
Rn-222 release to the environment: comparison between different granite sources
International Nuclear Information System (INIS)
Mamoon, M.; Kamal, S.M.
2005-01-01
In this work three different types of granites were studied, namely: pure granite, alkali granite and altered (hydrated) alkali granite. General radioactivity of the granites was studied along with the potential for 222 Rn emanation. The study indicated that altered alkali granite releases, relatively, the highest 222 Rn emanation to the surrounding air while alkali granite emits the more intense gamma radiation of the three granites. Hence, altered alkali granite can be used as a laboratory source for 222 Rn.
MicroRNA-221 and -222 Regulate Radiation Sensitivity by Targeting the PTEN Pathway
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Wang Ping; Cao Yongzhen; Lv Zhonghong; Yu Shizhu; Wang Guangxiu; Zhang Anling; Jia Zhifan; Han Lei; Yang Chunying; Ishiyama, Hiromichi; Teh, Bin S.; Xu Bo; Pu Peiyu
2011-01-01
Purpose: MicroRNAs (miRNAs) are noncoding RNAs inhibiting expression of numerous target genes by posttranscriptional regulation. miRNA-221 and miRNA-222 (miRNA-221/-222) expression is elevated in radioresistant tumor cell lines; however, it is not known whether and how miRNAs control cellular responses to ionizing irradiation. Methods and Materials: We used bioinformatic analyses, luciferase reporter assay, and genetic knockdown and biochemical assays to characterize the regulation pathways of miRNA-221/-222 in response to radiation treatment. Results: We identified the PTEN gene as a target of miRNA-221/-222. Furthermore, we found that knocking down miRNA-221/-222 by antisense oligonucleotides upregulated PTEN expression. Upregulated PTEN expression suppressed AKT activity and increased radiation-induced apoptosis, resulting in enhancement of radiosensitivity in tumor cells. Conclusions: miRNA-221/-222 control radiation sensitivity by regulating the PTEN/AKT pathway and can be explored as novel targets for radiosensitization.
Applications of environmental radon-222 to some cases of water circulation
International Nuclear Information System (INIS)
Kimura, S.; Komae, T.
1980-01-01
We have proposed three methods to analyze water circulation and the changes caused by human activities by studying the changing distribution patterns of 222 Rn concentrations in water. We investigated the results by applying the methods to some water circulation problems of Japan. The first method was a detailed analysis of the hydrogeological structure of an area, using the fact that the 222 Rn concentration of water takes a value characteristic of the aquifer. In the second method we analyzed the state of mixing of surface water and groundwater by taking advantage of the fact that the 222 Rn concentrations of the two are quite different. In the third method, we used the differing 222 Rn concentrations in vadose water and in retention water to analyze the pressure acting on the aquifer or the groundwater
49 CFR Appendix B to Part 222 - Alternative Safety Measures
2010-10-01
.... 222, App. B Appendix B to Part 222—Alternative Safety Measures Introduction A public authority seeking... requirements associated with an SSM as listed in appendix A is revised or deleted, data or analysis supporting...); d. Photographic or video equipment deployed to capture images sufficient to document the violation...
48 CFR 222.7301 - Prohibition on use of nonimmigrant aliens.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibition on use of nonimmigrant aliens. 222.7301 Section 222.7301 Federal Acquisition Regulations System DEFENSE ACQUISITION... aliens. (a) Any alien who is issued a visa or otherwise provided nonimmigrant status under Section 101(a...
49 CFR 222.51 - Under what conditions will quiet zone status be terminated?
2010-10-01
...-Quiet Zones § 222.51 Under what conditions will quiet zone status be terminated? (a) New Quiet Zones... 49 Transportation 4 2010-10-01 2010-10-01 false Under what conditions will quiet zone status be terminated? 222.51 Section 222.51 Transportation Other Regulations Relating to Transportation (Continued...
Zimnoch, M.; Wach, P.; Chmura, L.; Gorczyca, Z.; Rozanski, K.; Godlowska, J.; Mazur, J.; Kozak, K.; Jeričević, A.
2014-09-01
Concentration of radon (222Rn) in the near-ground atmosphere has been measured quasi-continuously from January 2005 to December 2009 at two continental sites in Europe: Heidelberg (south-west Germany) and Krakow (southern Poland). The atmosphere was sampled at ca. 30 and 20 m above the local ground. Both stations were equipped with identical instruments. Regular observations of 222Rn were supplemented by measurements of surface fluxes of this gas in the Krakow urban area, using two different approaches. The measured concentrations of 222Rn varied at both sites in a wide range, from less than 2.0 Bq m-3 to approximately 40 Bq m-3 in Krakow and 35 Bq m-3 in Heidelberg. The mean 222Rn content in Krakow, when averaged over the entire observation period, was 30% higher than in Heidelberg (5.86 ± 0.09 and 4.50 ± 0.07 Bq m-3, respectively). Distinct seasonality of 222Rn signal is visible in the obtained time series of 222Rn concentration, with higher values recorded generally during late summer and autumn. The surface 222Rn fluxes measured in Krakow also revealed a distinct seasonality, with broad maximum observed during summer and early autumn and minimum during the winter. When averaged over a 5-year observation period, the night-time surface 222Rn flux was equal to 46.8 ± 2.4 Bq m-2 h-1. Although the atmospheric 222Rn levels at Heidelberg and Krakow appeared to be controlled primarily by local factors, it was possible to evaluate the "continental effect" in atmospheric 222Rn content between both sites, related to gradual build-up of 222Rn concentration in the air masses travelling between Heidelberg and Krakow. The mean value of this build-up was equal to 0.78 ± 0.12 Bq m-3. The measured minimum 222Rn concentrations at both sites and the difference between them was interpreted in the framework of a simple box model coupled with HYSPLIT (Hybrid Single Particle Lagrangian Integrated Trajectory) analysis of air mass trajectories. The best fit of experimental data was
39 CFR 222.2 - Authority to administer oaths or function as notaries public.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Authority to administer oaths or function as notaries public. 222.2 Section 222.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.2 Authority to administer oaths or function as notaries public. (a...
International Nuclear Information System (INIS)
Dantas, A.L.A.; Dantas, B.M.; Lipsztein, J.L.; Spitz, H.B.
2006-01-01
A survey conducted by the IRD-CNEN determined that some workers from an underground coal mine in the south of Brazil were exposed to elevated airborne concentrations of 222 Rn. Because inhalation of high airborne concentrations of 222 Rn can lead to an increase of 210 Pb in bone, in vivo measurements of 210 Pb in the skeleton were performed in selected underground workers from this mine. Measurements were performed using an array of high-resolution germanium detectors positioned around the head and knee to detect the low abundant 46.5 keV photon emitted by 210 Pb. The gamma-ray spectra were analyzed using a moving median smoothing function to detect the presence of a photopeak at 46.5 keV. The minimum detectable activity of 210 Pb in the skeleton using this methodology was 50 Bq. (author)
12 CFR 222.21 - Affiliate marketing opt-out and exceptions.
2010-01-01
... solicitation for marketing purposes to a consumer with whom you have a pre-existing business relationship; (2... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Affiliate marketing opt-out and exceptions. 222... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.21 Affiliate...
Energy Technology Data Exchange (ETDEWEB)
Del Claro, Flavia
2016-11-01
Naturally occurring radionuclides such as radon ({sup 222}Rn), its decay products and other elements from the radioactive series of uranium ({sup 238}U and {sup 235}U) and thorium ({sup 232}Th) are an important source of human exposure to natural radioactivity. The worldwide evaluation of health radiobiological effects and risks from population exposure to natural radionuclides is a growing concern. Radionuclides such as radon ({sup 222}Rn), the thoron ({sup 220}Rn), radio ({sup 2}'2'6Ra), thorium ({sup 23}'2Th) and potassium ({sup 40}K) may occur in materials commonly used in construction of dwellings and buildings. Thus, the radioactivity from marbles and granites is of importance, so that under certain conditions these materials radioactivity levels can be hazardous requiring the implementation of mitigation measurements. This research presents a technical protocol marble factories for the control human exposure to natural radioactivity exhaled from granitic rocks. The protocol was based on measurements of the {sup 222}Rn and {sup 220}Rn concentration in Brazilian granite rocks commonly nationally and exported. The {sup 222}Rn and {sup 220}Rn measurements were done using the AlphaGUARD (Saphymo GmbH) and RAD7 (Durridge Company) apparatus, respectively. The samples of granite were sealed in glass jars for 40 days in to achieve secular equilibrium between {sup 226}Ra and {sup 222}Rn radionuclides. The measurements were performed on Applied Nuclear Physics Laboratory at the Federal Technological University of Parana. Also, solid-state nuclear track detectors CR-39 were installed in a marble factory environments located in Curitiba - Parana for the evaluation of {sup 222}Rn concentrations in workplaces. The CR-39 detectors were exposed for about 90 days and submitted to etching process. The alpha particle tracks were observed using an optical microscope. Some granite samples analyzed presented {sup 222}Rn concentrations of attention, since the average
20 CFR 222.51 - When a natural child is dependent.
2010-04-01
... FAMILY RELATIONSHIPS Child Support and Dependency § 222.51 When a natural child is dependent. The... employee's earnings record and the relationship of the child to the employee, the child will be considered... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a natural child is dependent. 222.51...
Waste analysis plan for 222-S dangerous and mixed waste storage area
International Nuclear Information System (INIS)
Warwick, G.J.
1994-01-01
The 222-S Laboratory Complex, in the southeast corner of the 200 West Area, consists of the 222-S Laboratory, the 222-SA Standards Laboratory, and several ancillary facilities. Currently, 222-S Laboratory activities are in supporting efforts to characterize the waste stored in the 200 Areas single shell and double shell tanks. Besides this work, the laboratory also provides analytical services for waste-management processing plants, Tank Farms, B Plant, 242-A Evaporator Facility, Plutonium-Uranium Extraction Plant, Plutonium Finishing Plant, Uranium-Oxide Plant, Waste Encapsulation Storage Facility, environmental monitoring and surveillance programs, and activities involving essential materials and research and development. One part of the 222-SA Laboratory prepares nonradioactive standards for the 200 Area laboratories. The other section of the laboratory is used for cold (nonradioactive) process development work and standards preparation. The 219-S Waste Handling Facility has three storage tanks in which liquid acid waste from 222-S can be received, stored temporarily, and neutralized. From this facility, neutralized waste, containing radionuclides, is transferred to the Tank Farms. A 700-gallon sodium-hydroxide supply tank is also located in this facility. This plan provides the methods used to meet the acceptance criteria required by the 204-AR Waste Receiving Facility
36 CFR 222.23 - Removal of other horses and burros.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Removal of other horses and... AGRICULTURE RANGE MANAGEMENT Management of Wild Free-Roaming Horses and Burros § 222.23 Removal of other horses and burros. Horses and burros not within the definition in § 222.20(b)(13) which are introduced...
Lidocaine Hydrochloride Compared with MS222 for the Euthanasia of Zebrafish (Danio rerio)
Collymore, Chereen; Banks, E Kate; Turner, Patricia V
2016-01-01
Despite several shortcomings, MS222 is the most commonly used chemical agent for euthanasia of zebrafish. Although lidocaine hydrochloride has some advantages over MS222, its effectiveness as a euthanasia agent for zebrafish is unknown. Larvae at 9 to 16 d postfertilization were exposed to 250 mg/L MS222 or 400, 500, 600, 700, 800, 900, or 1000 mg/L lidocaine and observed for cessation of heartbeat. Adult zebrafish were exposed to 250 mg/L MS222 or 400, 500, or 600 mg/L lidocaine; times to loss of righting reflex, cessation of opercular movement, and complete recovery; body length; aversive behavior; and gross and microscopic evidence of acute toxicity were evaluated. The heartbeat was not lost from any larvae in any group, regardless of drug or dosage. For adults, time to loss of righting reflex was greatest in the 500-mg/L lidocaine group. Opercular movement ceased earlier in all lidocaine groups compared with the MS222 group. Fish in the 500-mg/L lidocaine group were smaller than those in other groups. Fewer fish in the lidocaine groups displayed aversive behavior (erratic swimming and piping) compared with the MS222 group. No fish in the lidocaine hydrochloride groups (n = 30) recovered from euthanasia, whereas one fish in the MS222 group did (n = 10). Neither the MS222 nor lidocaine groups showed any gross or histologic changes suggestive of acute toxicity. Our results suggest that lidocaine hydrochloride may be an effective alternative chemical euthanasia agent for adult zebrafish but should not be used in larval fish. PMID:27931323
microRNA-222 modulates liver fibrosis in a murine model of biliary atresia
Energy Technology Data Exchange (ETDEWEB)
Shen, Wen-jun; Dong, Rui; Chen, Gong, E-mail: chengongzlp@hotmail.com; Zheng, Shan
2014-03-28
Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis.
microRNA-222 modulates liver fibrosis in a murine model of biliary atresia
International Nuclear Information System (INIS)
Shen, Wen-jun; Dong, Rui; Chen, Gong; Zheng, Shan
2014-01-01
Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis
Observation and modeling of 222Rn daughters in liquid nitrogen
International Nuclear Information System (INIS)
Frodyma, N.; Pelczar, K.; Wójcik, M.
2014-01-01
The results of alpha spectrometric measurements of the activity of 222 Rn daughters dissolved in liquefied nitrogen are presented. A direct detection method of ionized alpha-emitters from the 222 Rn decay chain ( 214 Po and 218 Po) in a cryogenic liquid in the presence of an external electric field is shown. Properties of the radioactive ions are derived from a proposed model of ion production and transport in the cryogenic liquid. Ionic life-time of the ions was found to be on the order of 10 s in liquid nitrogen (4.0 purity class). The presence of positive and negative ions was observed. - Highlights: • A direct detection method of the alpha-emitters in a cryogenic liquid is shown. • We examine electrostatic drifting of the radioactive ions in liquid nitrogen. • The ions belong to the Radon-222 decay chain; Radon-222 is dissolved in the liquid. • The model of the ions production and behaviour in the liquid is proposed. • The ion production significantly depends on the nuclear decay type (alpha or beta)
Maintenance Implementation Plan for the 222-S Laboratory
International Nuclear Information System (INIS)
Stark, T.E.
1992-10-01
This Maintenance Implementation Plan (MIP) has been developed for the 222-S Laboratory at Hanford. It is based on assessments of the existing maintenance program to the requirements specified by US Department of Energy (DOE) Order 4330.4A, Maintenance Management Program (DOE 1990), Chapter II, Change 3. The results of these assessments were evaluated to determine corrective actions required. The 222-S Laboratory is currently supporting the waste management, chemical processing, and environmental monitoring programs presently under Westinghouse Hanford Company (Westinghouse Hanford) responsibility. This is done through quality analytical and process chemistry services
The Ongoing Evolution of the K2-22 System
Colon, Knicole D.; Zhou, George; Shporer, Avi; Collins, Karen A.; Bieryla, Allyson; Latham, David W.; Espinoza, Nestor; Murgas, Felipe; Pattarakijwanich, Petchara; Awiphan, Supachai; TECH Collaboration
2018-06-01
Of the thousands of exoplanets known, only three disintegrating planets have been identified. These disintegrating planets appear to have tails of dusty material that produce asymmetric transit shapes. K2-22b is one of these few disintegrating planets discovered to date, and its light curve not only displays highly variable transit depths but also uniquely displays evidence of a leading dust tail. Here, we present results from a large ground-based photometric observing campaign of the K2-22 system that took place between December 2016 and May 2017, which we use to investigate the evolution of the transit of K2-22b. Last observed in early 2015, in these new observations we recover the transit around the expected time and measure a typical depth of K2-22b, although the overall shallowness of the transit makes a detailed analysis of the transit shape and timing difficult. In addition, we find no strong evidence of wavelength-dependent transit depths for epochs where we have simultaneous coverage at multiple wavelengths. Given the observed decrease in the transit depth between 2015 and 2017, we encourage continued high-precision photometric monitoring of this system in order to further constrain the evolution timescale and to aid comparative studies with the other few disintegrating planets known.
222Rn alpha dose to organs other than lung
International Nuclear Information System (INIS)
Harley, N.H.; Robbins, E.S.
1991-01-01
The alpha dose to cells in tissues or organs other theft the lung has been calculated using the solubility coefficients for 222 Rn measured in human tissue. The annual alpha dose equivalent f rom 222 Rn and decay products in most tissues is a maximum of 30% of the annual average natural background dose equivalent (1 mSv) for external and internally deposited nuclides. The dose to the small population of lymphocytes located in or under the bronchial epithelium is a special case and their annual dose equivalent is essentially the same as that to basal cells in bronchial epithelium (200 mSv) for continuous exposure to 200 Bq M -3 . The significance of this dose is uncertain because the only excess cancer observed in follow up studies of underground miners with high 222 Rn exposure is bronchogenic carcinoma
A study of the physico-chemical characteristics of a solid radon 222 source
International Nuclear Information System (INIS)
Chuiton, G.
1990-01-01
A solid radon 222 source is described; it is made of a manganese oxide impregnated acrylic felt disc on which radium 226 is fixed. The disc is incorporated into a scanning device allowing the passage through the felt of a radon 222 free gas (air or nitrogen) previously led to a relative humidity of air near to saturation. At the device outlet, a stable activity of radon 222 is obtained. The preparation, characteristics and radiochemical stability conditions of the 226 radium source are presented. Following a description of the scanning device, the radon 222 emanation coefficient is studied as a function of the relative humidity of air. The reliability of the device is assessed by an uncertainty calculation for the utilisation conditions recommended. Finally, an approach to the physico-chemical processes governing radon 222 emanation rate in the device is set forth [fr
34 CFR 222.30 - What is “free public education”?
2010-07-01
... Section 8003(b) and (e) of the Act § 222.30 What is “free public education”? In addition to the terms defined in § 222.2, the following definition applies to this part: Free public education. (1) The term... provide a free public education to the children claimed under section 8003. (5) For the purpose of...
Radon 222 levels in deep well waters of Toluca municipality (county)
International Nuclear Information System (INIS)
Olguin Gutierrez, Maria Teresa.
1990-01-01
The levels of Radon 222 were determined in 46 deep (50-180m) wells in the city and county of Toluca, as well as the annual radiation dose that the stomach admits when ingesting such water. The method used for the quantification of Radon 222 was liquid scintillation counting. The result revealed that levels of Radon 222 in the studied area in the range of 0 to 320 pCi l -1 . In the case of the equivalent annual dose that the stomach (empty) admits due to ingestion of water from the wells, values are in an interval between 0 to 95 mrem a -1 . This values are well below the level established by the International Commission of Radiological Protection (ICRP). The wells that had the higher concentration of Radon 222 were found in the regions of Lodo Prieto, Seminario; San Antonio Buenavista and La Trinidad Huichochitlan. (Author)
St 2-22 - Another Symbiotic Star with High-Velocity Bipolar Jets
Tomov, T.; Zamanov, R.; Gałan, C.; Pietrukowicz, P.
2017-09-01
We report the detection of high-velocity components in the wings of Hα emission line in spectra of symbiotic binary star St 2-22 obtained in 2005. This finding encouraged us to start the present investigation in order to show that this poorly-studied object is a jet-producing system. We have used high-resolution optical and low-resolution near-infrared spectra, as well as available optical and infrared photometry, to evaluate some physical parameters of the St 2-22 components and characteristics of the jets. We confirm that St 2-22 is a S-type symbiotic star. Our results demonstrate that an unnoticed outburst, similar to those in classical symbiotic systems, occurred in the first half of 2005. During the outburst, collimated bipolar jets were ejected by the hot component of St 2-22 with an average velocity of about 1700 km/s.
Scintillation detectors for radon-222 in air and water
International Nuclear Information System (INIS)
Mastinu, G.G.
1980-01-01
A scintillation detector and an emanation circuit that enable sensitive measurements of 222 Rn in water, in field practice, and in laboratory routine have been developed. Activities as low as 0.1 pCi per sample can be measured with a very simple procedure. The detector is also well suited to measure 222 Rn in air at concentrations down to 0.001 pCi/liter if a large-size detector is used
Synergy effects between MINUSTAH and public security in Brazil
Directory of Open Access Journals (Sweden)
Christoph Harig
2015-03-01
Full Text Available This article assesses the complex relationship between UN Peace Operations and public security in Brazil. It shows that there are obvious similarities at an operational level between military actions in MINUSTAH and Rio´s Pacification, which arguably result in reciprocal learning processes among troops. With the establishment of dedicated training centres and a considerable amount of practical experience in missions that differ significantly from combat-orientated warfare, soldiers are becoming increasingly familiar with police tasks. Considering the extension of the legal framework for allowing domestic military actions, I argue that this “police-ization of the military” (Dunlap, 1999, p. 222 is probably more significant for internal “Guaranteeing Law and Order” (GLO missions than for further Brazilian participations in Peace Operations.
The natural radioactivity in Guarani aquifer groundwater, Brazil.
Bonotto, D M; Bueno, T O
2008-10-01
The measurements of gross alpha and gross beta radioactivity in groundwater samples from Guarani aquifer in Brazil are reported in this paper together with the activity concentration of the natural dissolved radionuclides (40)K, (238)U, (234)U, (226)Ra, (222)Rn, (210)Po, (210)Pb, (232)Th, (228Th), and (228)Ra. Most of the gross alpha radioactivity values were below the critical level of detection corresponding to 1 mBq/L, however, the whole data set for the gross beta radioactivity and radionuclides (40)K, (238)U, (234)U, (226)Ra, (222)Rn, (210)Po, (210)Pb, and (228)Ra was submitted to a statistical treatment, considering class intervals arranged in geometric progression, because of the great variability of the activity. The analysis indicated lognormal distribution of the data, as usually observed in samples taken from the natural context. An inverse relationship between the gross alpha and gross beta activity has been identified and is related to an increase in the K content in the water. The mobility coefficient has been estimated for (238)U, (226)Ra, (232)Th and (228)Ra in Guarani aquifer and the results indicated that the radioelement solubility in the studied system varies according to the following order: radium>uranium>thorium. The implications of the data obtained in terms of standards established for defining the drinking water quality have also been discussed.
20 CFR 222.16 - When spouse is living in the same household with employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living in the same household with employee. 222.16 Section 222.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.16...
Radon-222 as an indicator of geothermal reservoirs behaviour
International Nuclear Information System (INIS)
Segovia, N.; De La Cruz-Reyna, S.; Mena, M.; Seidel, J.L.; Monnin, M.
1991-01-01
Radon-222 concentration in soils at shallow depth was measured at the ''Los Azufres'' geothermal field, Michoacan State, Mexico, in order to observe possible temporal variations in relation to the peculiar conditions of the area. A four years' survey is reported using the SSNTD technique. The data obtained indicate the feasibility of the technique for this type of investigation and illustrate the role of Radon-222 as a tracer of pore fluids motion in the substratum. (author)
Relation between 222Rn concentration in outdoor air and lower atmosphere
International Nuclear Information System (INIS)
Kataoka, Toshio; Mori, Tadashige; Yunoki, Eiji; Michihiro, Kenshuh; Sugiyama, Hirokazu; Shimizu, Mitsuo; Tsukamoto, Osamu; Sahashi, Ken.
1991-01-01
Using the height of the surface-based inversion layer obtained by the acoustic sounder returns and the variation of the 222 Rn concentration in the outdoor air during the presence of the surface-based inversion layer, the exhalation rate of 222 Rn is estimated to be 0.020 Bq·m -2 ·s -1 , which is observed elsewhere on land. Furthermore, the exposure rate at 1 m above the air-ground interface due to the short-lived 222 Rn daughters in the outdoor air during the presence of the surface-based inversion layer can be estimated using the height of the surface-based inversion layer and the 222 Rn concentrations in the outdoor air at the ground level before and after the onset of the surface-based inversion layer. From these treatment, it is clearly demonstrated that the monostatic acoustic sounder is useful as a supplementary method for a weather survey which forms a part of monitoring around the nuclear facilities. (author)
Investigations into the long-distance atmospheric transport in Central Europe using Rn-222
International Nuclear Information System (INIS)
Volpp, H.J.
1984-01-01
An measuring network was used to determine the atmospheric Rn-222 content in Central Europe (Northern and Southern Germany, Poland). Rn-222 is to serve as tracer for the long-distance atmospheric transport in central Europe. For several areas, an average Rn-222 flux density was found. The radon source 'continent' and the soil as radon source have been taken into account. (DG) [de
222-S Laboratory complex hazards assessment
International Nuclear Information System (INIS)
Sutton, L.N.
1996-01-01
This document establishes the technical basis in support of Emergency Planning activities for the 222-S Laboratory Complex on the Hanford Site. Through this document, the technical basis for the development of facility specific Emergency Action Levels and Emergency Planning Zone is demonstrated
Assessing urban air quality and its relation with radon (222Rn)
International Nuclear Information System (INIS)
Zoran, Maria; Savastru, Dan; Dida, Adrian
2016-01-01
This paper focuses on the assessment of air quality and its relation with radon ( 222 Rn) for Bucharest metropolitan area in Romania. Specifically, daily mean concentrations of particle matter (PM2.5, PM10), ozone (O 3 ), nitrogen dioxide (NO 2 ), sulphur dioxide (SO 2 ) and global air quality indices have been analyzed in relation with radon ( 222 Rn) concentrations measured in the air near the ground with AlphaGUARD Radon Monitoring System and CR-39 SSNTDs during 2012 year. Such new information is required by atmospheric sciences to prove suitability of 222 Rn as a tracer for atmospheric dynamics analysis as well as by epidemiological and radiological protection studies. (author)
Utilization of MS 222 in Transport of Catfish (Pangasius sutchi Seed
Directory of Open Access Journals (Sweden)
Harton Arfah
2007-12-01
Full Text Available ABSTRACTProblems faced in supplying seed out of Java especially Bogor to Sumatera, for instance, are it only contains few seed (100 seeds/l and it has a high mortality rate because of stress during transport. This experiment was conducted to know the effect of MS 222 in keeping fish metabolism activity down while taking note of its survival rate and change of water quality. The experimental design used here was factorial design 3x5 with 3 repetitions. Dosages of MS–222 were 0, 25 and 50 ppm and the fish densities were 100, 300, 400, 500 and 600 per liter. As container was plastic bag (volume 10 l. After putting the fish into the plastic bag, it was filled up with oxygen, which the volume was 3 times than water volume, than the plastic bag was closed by tying it. After 18 hours of treatment the survival rate and water quality were checked. Based on evaluation of survival rate, it was concluded that the combination between 25 ppm of MS 222 and fish density, which was 500 per liter, gave an optimum result.Keywords: Catfish, Pangasius sutchi, live transport, stress, MS–222, survival rate ABSTRAKKendala yang dihadapi dalam pemasokan benih ikan patin dari pulau Jawa terutama Bogor, keluar pulau Jawa terutama Sumatera adalah jumlah ikan yang terangkut masih sedikit (± 100 ekor/l dan tingkat kematian yang cukup tinggi, karena stres selama perjalanan. Penelitian ini dilakukan untuk mengetahui pengaruh penggunaan MS–222 dalam menekan aktivitas metabolisme ikan dengan memperhatikan tingkat kelangsungan ikan dan perubahan kualitas air. Penelitian ini menggunakan rancangan faktorial 3x5 dengan 3 ulangan. Dosis MS–222 yang digunakan: 0,25 dan 50 ppm dan kepadatan ikan: 100, 300, 400, 500 dan 600 ekor/l. Wadah pengangkutan berupa kantong plastik (volume 10 l. Ikan yang diangkut dimasukkan ke dalam kantong plastik, kemudian dipompakan oksigen sebanyak 3 kali volume air, selanjutnya dilakukan pengikatan. Setelah 18 jam perlakuan dilakukan
International Nuclear Information System (INIS)
Oliveira, Joselene de; Jesus, Sueli Carvalho de; Abrahao, Fernanda Franco; Santos, Glorivania Ferreira dos; Braga, Elisabete de Santis; Chiozzini, Vitor
2009-01-01
Radium isotopes and radon are among the most important natural radionuclides in the environment from both radioprotection and geo-hydrological points of view. These radionuclides are a powerful tool for studying coastal processes and have been used intensively as tracers of groundwater sources that discharge into the ocean. In this paper, naturally occurring radium isotopes and 222 Rn were determined to trace water exchange and SGD in Cananeia-Iguape estuarine complex, a shallow coastal plain estuary in southern Sao Paulo area. The research work was carried out during the first semester of 2009 and covered stations located both in Cananeia and Iguape outlets, as well as samples collected in Ribeira of Iguape River and groundwater. Activity concentrations of 226 Ra in estuarine waters from Cananeia outlet varied from 2.9 mBq L -1 to 4.7 mBq L -1 , while 228 Ra concentrations ranged from 22 mBq L -1 to 45 mBq L -1 . In Iguape outlet, activities of 226 Ra ranged from 1.6 mBq L -1 to 6.6 mBq L -1 ; 228 Ra varied from 13 mBq L -1 to 20 mBq L -1 . Activities of Ra were slightly higher in samples collected at 5 m depth than at the surface water level. Groundwater activity concentrations of 226 Ra ranged from 0.63 mBq L -1 to 12 mBq L -1 and for 228 Ra from 18 mBq L -1 to 39 mBq L -1 . In groundwater, the 228 Ra/ 226 Ra activity ratios varied from 3.3 to 31.7. 222 Rn activities in groundwater up to 747 Bq L -1 were observed. Increased nitrate contents were observed in groundwater samples collected in Cananeia and Comprida Island. (author)
Upregulation of miR-222 in both Helicobacter pylori-infected and ...
Indian Academy of Sciences (India)
MINA NOORMOHAMMAD
of this study was to analyse the expression level of miR-222 in gastric cancer tissues, evaluating the relationship between. miR-222 ... using RT-qPCR and compared with 88 healthy samples. ... observed in some diseases; for instance, hepatocellular carci- noma .... cellular matrix proteins in stomach cells (Chun-Zhi et al.
Measurement of Rn-222 concentration in underground water in Osaka stratum group in Sennan area
International Nuclear Information System (INIS)
Fukui, Masami; Katsurayama, Kosuke
1977-01-01
The Rn-222 concentration in underground water is reported as follows, which is the result obtained when the ground inspection was carried out in the Research Reactor Institute of Kyoto University located at Kumatori area in Osaka stratum group. Underground water, at different depth, well water and rain water were taken, and the contained Rn-222 was extracted with toluene to measure by liquid scintillation technique. Rn-222 concentration in rain water was 3.5 - 8.0 pCi/l, while the concentration in well water was 130 - 250 pCi/l, and that in underground water was 240 - 313 pCi/l. The seasonal change, geographical difference and variation according to depth of Rn-222 concentration were examined. Rn-222 behavior in soil should be investigated more in detail in reference to Rn-222 dispersion, transport and equilibrium problems in soil-water system in the future. (Kobatake, H.)
Energy Technology Data Exchange (ETDEWEB)
Pereyra, P.; Lopez, M. E.; Perez, B., E-mail: ppereyr@pucp.edu.pe [Pontificia Universidad Catolica del Peru, Seccion Fisica, Av. Universitaria 1801, Lima (Peru)
2014-08-15
The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)
Identifying Groundwater Discharge in the Merced River Basin, California Using Radon-222
Shaw, G. D.; Hudson, G. B.; Moran, J.; Conklin, M.
2004-12-01
Groundwater flow in fractured granite of the Sierra Nevada is poorly characterized, in particular, contributions of mountain block recharge are not known. Using a combination of water quality and isotopic analyses, groundwater inputs to the Upper Merced River were characterized. Between November 2003 and July 2004, monthly water quality samples were taken from Happy Isles to the inlet of Lake McClure, a 75 km reach. These samples demonstrated the expected dilution due to snowmelt in the spring. In the fall, the spatial profile matched the geology with anion concentrations increasing downstream of the transition from the Sierra Nevada batholith to the country rock, suggesting significant groundwater inputs. From July 19 to 21, 2004, radon-222 and other noble gases (He, Ne, Ar, Kr and Xe abundances and 3He/4He ratio) were measured along a 37 km reach of the Merced River, extending from the top of Yosemite Valley to the confluence of the South Fork of the Merced River. All radon samples were extracted into mineral oil immediately in the field and counted using liquid scintillation; noble gas samples were collected in copper tubes. Radon-222 activity varied from about 1 to 100 pCi/L (at collection time) indicating significant, spatially variable groundwater discharge into the Merced River. Two one-mile reaches of the Merced River were sampled for 222Rn on a fine scale. Large fracture sets in these two locations and previous temperature measurements suggested that groundwater discharge was higher relative to other locations along the river. Radon-222 activity was low upstream and downstream of large fractures observed in the bedrock; whereas, 222Rn activity was high at large fracture zones. Degassing is rapid downstream of fractures where no groundwater discharge is observed. For a representative groundwater end-member, radon-222 activity measured in Fern Spring, Yosemite Valley was about 1200 pCi/L. Excess 4He from U and Th decay is observed in samples with elevated
Results of Long-term Measurement of 222Rn Volume Activity in Soil Air
International Nuclear Information System (INIS)
Holy, K.; Matos, M.; Boem, R.; Stanys, T.; Hola, O.; Polaskova, A.
1999-01-01
Radon in the soil air was continuously monitored for four years. The measured volume activities differ one from another even three times. On the basis of the measured data the annual and average daily courses of the 222 Rn volume activity were studied for individual months. In annual courses the winter and also summer maxima of the 222 Rn volume activity were found out. The study of the average daily courses revealed that the oscillation of the 222 Rn volume activity about its average value during a day is only a few percent. For dry summer months a linear relation was found out between the changes of the 222 Rn volume activity and the changes of the atmospheric pressure in their average daily courses (Authors)
Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Cao Yongzhen; Pu Peiyu; Lu Zhonghong; Du Yue
2009-01-01
Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)
30 CFR 285.222 - What does MMS do with my bid?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What does MMS do with my bid? 285.222 Section... Energy Leases Competitive Lease Award Process § 285.222 What does MMS do with my bid? (a) If sealed... any proposal submitted will be made by a panel composed of members selected by MMS. The details of the...
Dry soil diurnal quasi-periodic oscillations in soil 222Rn concentrations
International Nuclear Information System (INIS)
Tommasone Pascale, F.; De Francesco, S.; Carbone, P.; Cuoco, E.; Tedesco, D.
2014-01-01
222 Rn concentrations have been monitored during the dry season in August 2009 and August 2010, in a reworked alluvial-pyroclastic soil of the Pietramelara Plain, in Southern Italy, with the aim of determining the role of atmospheric factors in producing the quasi-periodic oscillations in soil 222 Rn concentrations reported in the literature. In this study we present the results of a detailed analysis and matching of soil 222 Rn concentrations, meteorological and solar parameters where the observed oscillations feature a characteristic behavior with second order build-up and depletion limbs, separated by a daily maximum and minimum. All these features are clearly shown to be tied to sunrise and sunset timings and environmental radiative flux regimes. Furthermore, a significant, and previously unreported, second order correlation (r 2 = 0.73) between daily maximum hourly global radiation and the daily range of soil 222 Rn concentrations has been detected, allowing estimates of the amplitude of these oscillations to be made from estimated or measured solar radiation data. The correlation has been found to be valid even in the presence of persistent patchy daytime cloudiness. In this case a daytime prolongation of the night-time build up stage and an attenuation or even suppression of daytime depletion is observed (a previously unreported effect). Neither soil cracking, nor precipitation, both suggested in some studies as causative factors for these oscillations, during the dry season appear to be necessary in explaining their occurrence. We also report the results of an artificial shading experiment, conducted in August 2009, that further support this conclusion. As soil 222 Rn concentrations during the dry season show a characteristic daily cycle, radon monitoring in soils under these conditions necessarily has to be gauged to the timings of the daily maximum and minimum, as well as to the eventual occurrence of cloudiness and to its related effects, in order to
Realization of a reference system for the generation radon 222
International Nuclear Information System (INIS)
Guelin, M.
1990-11-01
After some general considerations on radon and its calibration techniques, the methods and technologies developed in order to realize a reference system for the generation of radon 222 are presented. Two original patented techniques have been developed. The former technique deals with the realization of radon 222 solid sources from radium 226 deposit on acrylic fibres. This new technology offers the advantage of very quickly obtaining a constant emission rate near to 100%. The latter technique deals with the standard measurement of radon 222 volumic activity via gamma spectrometry of its short-lived daughters. This new procedure is the only one allowing to relate this measure to gaseous standards. An aeraulic/ventilation circuit makes it possible to calibrate the radon measurement instrumentation within a wide volumic activity range from to 4 to 4 000 Bq/m 3
20 CFR 222.53 - When a legally adopted child is dependent-child adopted after entitlement.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-child adopted after entitlement. 222.53 Section 222.53 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.53 When...
Detection of 222Rn and 226Ra in environmental samples by scintillation method
International Nuclear Information System (INIS)
Zafimanjato, J.L.R.; Raoelina Andriambololona; Mobius, S.
2009-01-01
222 Rn is considered as the major source of radiological exposure of natural radiations to the population. It represents about the half of exposures of natural radiation sources in the world (UNSCEAR, 1993). 222 Rn gets into human body with inhaled air and sometimes with drinking water. Then, the objective of this work is to know the 222 Rn concentrations in water and in indoor atmosphere, and the risk in order to set up a method of monitoring and to identify high radon level areas. A specific method of detection using liquid scintillation with special emphasis on α/β discrimination, the use of solvent extractive and enrichment of radionuclides have been developed for the determination of both 222 Rn and 226 Ra in water. The method is simple, rapid and sensitive. It was shown that the proposed method was suitable for a large scale monitoring and routine analysis. Considerable concentrations of 222 Rn were found in water and air samples from Vinaninkarena - Antsirabe. 222 Rn concentrations obtained by in situ and in laboratory measurements have been compared to the results of an international intercomparison campaigns organised by the German Society for Liquid Scintillation Spectrometry in 2001. An assesment model of the dose due to ingestion and liberation of radon from water is presented and compared with other models especially to the Crawford Brown's model.
Health effects assessment in population exposed to 222Rn in drinking water
International Nuclear Information System (INIS)
Burkhardt, R.; Mocsy, I.; Muntean, N.
1996-01-01
The carcinogenetic effect produce by ionizing radiation upon human health, mainly by drinking water consumption with an elevated 222 Rn content is well documented. The objective of the paper was to demonstrated the possible relationship between the incidence of pulmonary and gastric cancer and 222 Rn presence in water and indoor air. The 222 Rn content was assessed by the standard method in drinking water sampled in two sources in Transylvania area from located in Tirgu Mures and Miercurea Ciuc towns. The 222 Rn concentration in indoor air was indirectly determined. On the basis of the registered values the pulmonary and gastric internal dose received by the residents of the towns was calculated. In parallel was performed a retrospective epidemiological study (1980-1992) regarding the incidence of gastric and pulmonary cancer in two towns in terms of morbidity, mortality and lethality indices. By comparing the estimated carcinogenic risk for this type of cancer with the specific mortality rate registered in our study, we estimate the contribution of 222 R to the cancer mortality percentage in the two towns, as follows: 0.47% for Tirgu Mures and 0.01% for Miercurea Ciuc town for pulmonary cancer and 0.23% and 0.015% for gastric cancer. (author)
Extreme levels of 222Rn and U in a private water supply
International Nuclear Information System (INIS)
Lowry, J.D.; Hoxie, D.C.; Moreau, E.
1987-01-01
In 1985, the Maine Department of Human Services discovered a private water supply in Leeds, ME, that contains over 40,700 BqL -1 (1.1 x 10 +6 pCil -1 ) of 222 Rn on average, and ranges between 13,300 and 59,200 Bql -1 . The well water also contains a gross alpha concentration of approximately 10.0 BqL -1 (270 pCiL -1 ), of which more than 95 percent is U (403 ugL -1 ). The ratio of 234 U to 238 U averages 1.17, which compares closely to the sea water at 1.14. The Ra content comprises less than 2 percent of the gross alpha. The levels of 222 Rn and U are considered to be extremely high, with the 222 Rn being the highest known level the authors are aware of for a drinking water supply. This area of Maine has geologic features characteristic of those shown by others to have a high potential for elevated levels of 222 Rn and other radioisotopes. The purpose of this paper is to update the information presented previously about this site, in particular to the ramifications on treatment alternatives associated with the presence of both 222 Rn and U in a water supply
48 CFR 52.222-44 - Fair Labor Standards Act and Service Contract Act-Price Adjustment.
2010-10-01
... and Service Contract Act-Price Adjustment. 52.222-44 Section 52.222-44 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.222-44 Fair Labor Standards Act and Service Contract Act—Price... Contract Act—Price Adjustment (SEP 2009) (a) This clause applies to both contracts subject to area...
222Rn levels in Kingsville, Texas, and vicinity near an in situ uranium mine
International Nuclear Information System (INIS)
McGehee, T.L.; Martino, M.R.; Harr, T.L.; Samudio, A.
1994-01-01
An investigation of the 222 Rn levels in ground water, soils, and indoor air has disclosed two 222 Rn ground-water anomalies in the Kingsville, Texas, area from uranium-enriched sandstones of the Evangeline aquifer. Indoor air 222 Rn levels were measured in summer 1991 (from undetectable to 3.2 pCi/l) and winter 1991-1992 (0.01 to 3.98 pCi/l) to determine seasonal extremes and risk to the public. Soil 222 Rn concentration maps ranging from undetectable to 75.4 pCi/l correlate to the low levels found in homes. Results of this study are based on analyses of 218 water samples, 52 in situ soil samples, and 104 indoor air samples. Water samples were injected into a scintillation mix (EPA/EERF-Manual-78-1) and analyzed by liquid scintillation techniques. Indoor air and soil samples were collected using passive charcoal canisters and analyzed by gamma-ray detection techniques (EPA 520/5-87-005). One ground-water 222 Rn anomaly lies near the permitted boundary of a large uranium deposit that is being mined. Private wells near the ore body yielded, 1,023 to 23,256 pCi/l at the well head. A second anomaly is located 2.5 mi (4 km) north of the uranium ore body near Naval Air Station, Kingsville. Private water wells in this area yielded 442 to 1,950 pCi/l 222 Rn at the well head. The radon anomalies are related to subsurface mineralization, which is one of the known natural geologic hazards of this area. Indoor air 222 Rn levels are well below the U.S. Environmental Protection Agency (US/EPA) action limit of 4 pCi/l. However, the high levels of 222 RN in ground water should be mitigated before entry into the home environment. High 222 Rn levels in ground water were reduced to background levels in household waters by use of a pre-introduction large-capacity holding tank
36 CFR 222.21 - Administration of wild free-roaming horses and burros and their environment.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Administration of wild free-roaming horses and burros and their environment. 222.21 Section 222.21 Parks, Forests, and Public Property... Burros § 222.21 Administration of wild free-roaming horses and burros and their environment. (a) The...
Characterization of 222Rn entry into a basement structure surrounded by low permeability soil
International Nuclear Information System (INIS)
Ward, D.C.
1992-01-01
An experimental facility has been developed to monitor the entry rate and concentration of 222 Rn in two basement type structures surrounded by soil having a permeability on the order of 1- -12 m 2 . A data acquisition system recorded environmental conditions outside and inside the structures, including basement air exchange rates, every 15 min. Indoor 222 Rn concentrations ranged from 400 to 1400 Bq m -3 . The observed 222 Rn entry rate is highly variable and has two primary components; a constant input rate caused by diffusion of 222 Rn through the concrete walls and floor, and a variable rate that depends upon indoor-soil pressure differentials of only a few pascals. Pressure differentials are dependent upon wind speed and wind direction. Stack effect was not significant. During a two week period, with relatively calm winds, diffusion through the concrete walls and floor plus the floor-wall joint accounted for more than 80% of the total 222 Rn entry
34 CFR 222.192 - What local funds may be considered as available for this project?
2010-07-01
... § 222.192 What local funds may be considered as available for this project? To determine the amount of... 34 Education 1 2010-07-01 2010-07-01 false What local funds may be considered as available for this project? 222.192 Section 222.192 Education Regulations of the Offices of the Department of...
222Rn Determination In Drinking Waters - RAD7 And LSC Technique Comparison
International Nuclear Information System (INIS)
Todorovic, N.; Stojkovic, I.; Nikolov, J.; Tenjovic, B.
2015-01-01
A procedure for the determination of 222Rn in environmental water samples using liquid scintillation counting (LSC) was applied and optimized. For radon determination in drinking water from groundwater and surface water sources by LSC, the EPA Method 913.0 was used. A minimum detectable activity of 0.029 Bq L-1 in a 20 mL glass vial (10 mL water sample mixed with 10 mL of liquid scintillation cocktail) has been achieved during 300 minutes of measurement time. The procedure was compared with RAD7 radon detector measurements. Factors that affect the measurement accuracy and precision of RAD7 radon detector are the sampling technique, sample concentration, sample size, counting time, temperature, relative humidity and background effects. The minimal detectable activity (MDA) for RAD7 technique was found to be 0.1 Bq/L. From obtained results of 222Rn measurements in 15 water samples with different 222Rn activities, correlation between the two techniques applied for measurements of 222Rn in water samples (A less than 400 Bq/L) was determined. There is reasonable agreement (within statistical uncertainties) between the various techniques in most cases, while disagreements most likely come from systematic uncertainties associated with sampling procedures. Discrepancy in determined activities between the two techniques becomes more evident with increased 222Rn activities in water. LSC technique gives in general higher activity concentrations for about 30 percent than RAD7 spectrometer. The interpretation of shown results could be that RAD7 is not properly calibrated for higher activities, since USA reference level of 222Rn concentrations in water is only 11.1 Bq/L (US EPA, Proposed Radon in Drinking Water Regulation). (author).
A process-based 222radon flux map for Europe and its comparison to long-term observations
Karstens, U.; Schwingshackl, C.; Schmithüsen, D.; Levin, I.
2015-11-01
Detailed 222radon (222Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222Rn flux map for Europe, based on a parameterization of 222Rn production and transport in the soil. The 222Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222Rn soil profile measurements. Monthly 222Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083° × 0.083° and compared to long-term direct measurements of 222Rn exhalation rates in different areas of Europe. The two realizations of the 222Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222Rn flux from soils in Europe is estimated to be 10 mBq m-2 s-1 (ERA-Interim/Land soil moisture) or 15 mBq m-2 s-1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m-2 s-1 and from ca. 11 to ca. 20 mBq m-2 s-1, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on average better
A process-based 222radon flux map for Europe and its comparison to long-term observations
International Nuclear Information System (INIS)
Karstens, U.; Schwingshackl, C.; Schmithuesen, D.; Levin, I.
2015-01-01
Detailed 222 radon ( 222 Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222 Rn flux map for Europe, based on a parameterization of 222 Rn production and transport in the soil. The 222 Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222 Rn soil profile measurements. Monthly 222 Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of 222 Rn exhalation rates in different areas of Europe. The two realizations of the 222 Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222 Rn flux from soils in Europe is estimated to be 10 mBq m -2 s -1 (ERA-Interim/Land soil moisture) or 15 mBq m -2 s -1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m -2 s -1 and from ca. 11 to ca. 20 mBq m -2 s -1 , respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222 Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on
A novel albumin gene mutation (R222I) in familial dysalbuminemic hyperthyroxinemia.
Schoenmakers, Nadia; Moran, Carla; Campi, Irene; Agostini, Maura; Bacon, Olivia; Rajanayagam, Odelia; Schwabe, John; Bradbury, Sonia; Barrett, Timothy; Geoghegan, Frank; Druce, Maralyn; Beck-Peccoz, Paolo; O'Toole, Angela; Clark, Penelope; Bignell, Michelle; Lyons, Greta; Halsall, David; Gurnell, Mark; Chatterjee, Krishna
2014-07-01
Familial dysalbuminemic hyperthyroxinemia, characterized by abnormal circulating albumin with increased T4 affinity, causes artefactual elevation of free T4 concentrations in euthyroid individuals. Four unrelated index cases with discordant thyroid function tests in different assay platforms were investigated. Laboratory biochemical assessment, radiolabeled T4 binding studies, and ALB sequencing were undertaken. (125)I-T4 binding to both serum and albumin in affected individuals was markedly increased, comparable with known familial dysalbuminemic hyperthyroxinemia cases. Sequencing showed heterozygosity for a novel ALB mutation (arginine to isoleucine at codon 222, R222I) in all four cases and segregation of the genetic defect with abnormal biochemical phenotype in one family. Molecular modeling indicates that arginine 222 is located within a high-affinity T4 binding site in albumin, with substitution by isoleucine, which has a smaller side chain predicted to reduce steric hindrance, thereby facilitating T4 and rT3 binding. When tested in current immunoassays, serum free T4 values from R222I heterozygotes were more measurably abnormal in one-step vs two-step assay architectures. Total rT3 measurements were also abnormally elevated. A novel mutation (R222I) in the ALB gene mediates dominantly inherited dysalbuminemic hyperthyroxinemia. Susceptibility of current free T4 immunoassays to interference by this mutant albumin suggests likely future identification of individuals with this variant binding protein.
International Nuclear Information System (INIS)
Dantas, A.L.A.; Veiga, L.H.S.; Dantas, B.M.; Melo, V.P.
2005-01-01
A radiological survey performed in an underground coal mining in the State of Parana, southern Brazil, has indicated the occurrence of high levels of concentration of radon and its decay products. The levels of 222 Rn concentration measured in the basement of this mine, in the period from 1999 to 2003 ranged from 2000 to 7000 Bq m -3 . It is estimated, for these workers, an average annual exposure of 2.1 WLM ranging from 0.2 to 7.2 WLM. A retrospective mortality study conducted with 2856 miners of this mining indicated a risk of lung cancer mortality greater than the one expected for the male population of the State. In this study the cumulative exposure to radon cannot be estimated since there was no radon measures in other periods. In this way, the cumulative exposure can be evaluated by through 210 Pb activities monitored in the skeleton. The measures of 210 Pb in skeleton ranged from 83 to 164 Bq, indicating that these workers were significantly exposed to 222 Rn. These results show that cumulative exposure to radon has been higher than estimated based on recent measures of the activity concentration of radon in the workplace and is compatible with the risk determined in the epidemiological study
Energy Technology Data Exchange (ETDEWEB)
Costa, Lucas Jose Pereira da
2011-07-01
Phosphogypsum is a waste of the fertilizer industry that concentrates radionuclides. In this work, the {sup 222}Rn exhalation rate from phosphogypsum plates and blocks from different origins used at dwellings construction was studied. The {sup 222}Rn exhalation rate was determined through the accumulation chamber technique with solid state nuclear track detectors (SSNTD). The effective dose for an individual living in a residence built with phosphogypsum based materials was evaluated. It also was calculated the {sup 222}Rn exhalation rate through the UNSCEAR model, from the {sup 226}Ra concentration in the materials, in order to compare the experimental results. It was evaluated the contribution of building component (paint) to the reduction of {sup 222}Rn exhalation rate. The plates and blocks were manufactured with phosphogypsum from Bunge Fertilizantes, Ultrafertil and Fosfertil. Blocks manufactured with ordinary gypsum was also evaluated. The average results obtained were 0.19 {+-} 0.06 Bq m-2 h-1, 1.3 {+-} 0.3 Bq m{sup -2} h{sup -1} and 0.41 {+-} 0.07 Bq m{sup -2} h{sup -1} for plates manufactured with phosphogypsum from Bunge Fertilizer, Ultrafertil and Fosfertil, respectively. For the phosphogypsum blocks the values were 0.11 {+-} 0.01 Bq m{sup -2} h-1, 1.2 {+-} 0.6 Bq m{sup -2} h{sup -1}, 0.47 {+-} 0.15 Bq m{sup -2} h{sup -1}, for Bunge, Ultrafertil and Fosfertil. The blocks manufactured with ordinary gypsum presented average value of 0.18 {+-} 0.08 Bq m{sup -2} h'-{sup 1}. All phosphogypsum plates and blocks evaluated in this study presented effective dose for radon inhalation lower than the recommended value of 1mSv y{sup -1}, the annual effective dose limit for public exposure by International Commission on Radiological Protection. (author)
International Nuclear Information System (INIS)
Melo, Vicente de Paula
1999-01-01
The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas 222 Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 W , used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of 222 Rn in the residences of Monte Alegre and CANP. Determinations of the 238 U and 226 Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m 3 (action level) and 600 Bq. m 3 (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)
Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma.
Felicetti, Federica; De Feo, Alessandra; Coscia, Carolina; Puglisi, Rossella; Pedini, Francesca; Pasquini, Luca; Bellenghi, Maria; Errico, Maria Cristina; Pagani, Elena; Carè, Alessandra
2016-02-24
Growing evidence is showing that metastatic cell populations are able to transfer their characteristics to less malignant cells. Exosomes (EXOs) are membrane vesicles of endocytic origin able to convey their cargo of mRNAs, microRNAs (miRs), proteins and lipids from donors to proximal as well as distant acceptor cells. Our previous results indicated that miR-221&222 are key factors for melanoma development and dissemination. The aim of this study was to verify whether the tumorigenic properties associated with miR-222 overexpression can be also propagated by miR-222-containing EXOs. EXOs were isolated by UltraCentrifugation or Exoquick-TC(®) methods. Preparations of melanoma-derived vesicles were characterized by using the Nanosight™ technology and the expression of exosome markers analyzed by western blot. The expression levels of endogenous and exosomal miRNAs were examined by real time PCR. Confocal microscopy was used to evaluate transfer and uptake of microvesicles from donor to recipient cells. The functional significance of exosomal miR-222 was estimated by analyzing the vessel-like process formation, as well as cell cycle rates, invasive and chemotactic capabilities. Besides microvesicle marker characterization, we evidenced that miR-222 exosomal expression mostly reflected its abundance in the cells of origin, correctly paralleled by repression of its target genes, such as p27Kip1, and induction of the PI3K/AKT pathway, thus confirming its functional implication in cancer. The possible differential significance of PI3K/AKT blockade was assessed by using the BKM120 inhibitor in miR-222-transduced cell lines. In addition, in vitro cultures showed that vesicles released by miR-222-overexpressing cells were able to transfer miR-222-dependent malignancy when taken-up by recipient primary melanomas. Results were confirmed by antagomiR-221&222 treatments and by functional observations after internalization of EXOs devoid of these miRs. All together these data
Indoor 222Rn measurements in the region of Beijing, People's Republic of China
International Nuclear Information System (INIS)
Ren, T.S.; Lin, L.Q.; Chen, Z.P.; Li, G.Y.; Chen, A.M.
1987-01-01
Passive integrating activated C detectors were used to study the regional distribution and temporal variation of 222 Rn in indoor air in dwellings in the Beijing region. Measurements were made in 537 dwellings, which were either detached houses or multi-family apartments. The city-wide study was completed in 1985. The distributions are approximately log-normal with 90% of the dwellings having 222 Rn levels less than 60 Bq m-3. The weighted average 222 Rn concentration has been found to be 22.4 Bq m-3. Averages for detached houses and multi-family dwellings are 25.9 and 15.2 Bq m-3, respectively. Assuming an equilibrium factor of 0.5 and an occupancy factor of 0.8, the average equilibrium equivalent concentration of 222 Rn progeny is 11.2 Bq m-3 and the annual average effective dose equivalent is 1.1 mSv
Ra-226 and Rn-222 in saline water compartments of the Aral Sea region
International Nuclear Information System (INIS)
Schettler, Georg; Oberhänsli, Hedi; Hahne, Knut
2015-01-01
Highlights: • 222 Rn and 226 Ra concentrations in different water compartments of the Aral Sea region. • 226 Ra-analysis based on 222 Rn-ingrowth versus MS-analysis after solid-phase extraction. • 226 Ra in different groundwater types of the Aral Sea Basin. • 222 Rn distribution in the Aral Sea, western basin. - Abstract: The Aral Sea has been shrinking since 1963 due to extensive irrigation and the corresponding decline in the river water inflow. Understanding of the current hydrological situation demands an improved understanding of the surface water/groundwater dynamics in the region. 222 Rn and 226 Ra measurements can be used to trace groundwater discharge into surface waters. Data of these radiometric parameters were not previously available for the study region. We determined 222 Rn activities after liquid phase extraction using Liquid Scintillation Counting (LSC) with peak-length discrimination and analyzed 226 Ra concentrations in different water compartments of the Amu Darya Delta (surface waters, unconfined groundwater, artesian water, and water profiles from the closed Large Aral Sea (western basin). The water samples comprise a salinity range between 1 and 263 g/l. The seasonal dynamics of solid/water interaction under an arid climate regime force the hydrochemical evolution of the unconfined groundwater in the Amu Darya Delta to high-salinity Na(Mg)Cl(SO 4 ) water types. The dissolved radium concentrations in the waters were mostly very low due to mineral over-saturation, extensive co-precipitation of radium and adsorption of radium on coexisting solid substrates. The analysis of very low 226 Ra concentrations (<10 ppq) at remote study sites is a challenge. We used the water samples to test and improve different analytical methods. In particular, we modified a procedure developed for the α-spectrometric determination of 226 Ra after solid phase extraction of radium using 3M Empore™ High Performance Extraction Disks (Purkl, 2002) for the
Toprak Radon (222Rn Gazı Anomalilerinin ARIMA Analizi
Directory of Open Access Journals (Sweden)
Miraç KAMIŞLIOĞLU
2014-12-01
Full Text Available Özet: Zaman serileri analizi, istatistik, ekonomi, fizik ve mühendislik gibi bilim dallarında geniş uygulama alanına sahiptir. Zaman serisi analizi, değişkenlerin gelecekteki değerlerinin doğru bir şekilde tahmin edilmesi için kullanılan bir yöntemdir. Bu çalışmada, bir deprem öncüsü olarak bilinen toprak radon gazı (222Rn ölçümleri ile bir zaman serisi oluşturulmuştur. Bu veriler kullanılarak, otoregresif süreçler (ARIMA yardımıyla dinamik sistem modellemesi yapılmıştır. ARIMA; zaman serileri analizinde, zaman içerisinde rastgele gerçekleşen bir stokastik (olasılıksal sürecin veya hatalarının modellenmesidir. ARIMA modeli, temelde Box-Jenkins modeline dayanmaktadır. Box-Jenkins modeli, tek değişkenli zaman serilerinin ileriye dönük tahmin ve kontrolünde kullanılan istatistiksel tabanlı bir yöntemdir. Elde edilen sonuçlar, ARIMA modellerinin tahmin konusundaki başarısını göstermektedir. Anahtar kelimeler: Zaman Serileri Analizi, Radon Gazı (222Rn, ARIMA ARIMA Analysis of Soil Radon (222Rn Gas Anomalies Abstract: Time series analysis, has wide applications in statistics, economics, physics and engineering such disciplines. This method used for estimate correctly future values of the variables. In this study, is formed a time series with soil radon gas (222Rn measurements known as a pioneer of an earthquake. Dynamic system modelling was performed with autoregressive (ARIMA modelling process by used these measurements. ARIMA; time series analysis is modelled of the recoverable over time a random stochastic (probabilistic process or its errors. ARIMA model is based on Box-Jenkins model. Box-Jenkins model is a statistically based method which is used forward-looking forecasting and control of univariate time series. The obtained results, ARIMA model is indicating success in predict subject. Key words: Time Series Analysis, Radon Gas (222Rn, ARIMA
Online {sup 222}Rn removal by cryogenic distillation in the XENON100 experiment
Energy Technology Data Exchange (ETDEWEB)
Aprile, E.; Anthony, M.; De Perio, P.; Gao, F.; Goetzke, L.W.; Greene, Z.; Lin, Q.; Messina, M.; Plante, G.; Rizzo, A.; Zhang, Y. [Columbia University, Physics Department, New York, NY (United States); Aalbers, J.; Breur, P.A.; Brown, A.; Colijn, A.P.; Decowski, M.P.; Hogenbirk, E.; Tiseni, A. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); Agostini, F. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN-Bologna (Italy); Alfonsi, M.; Geis, C.; Grignon, C.; Oberlack, U.; Scheibelhut, M.; Schindler, S. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Amaro, F.D.; Cardoso, J.M.R.; Lopes, J.A.M.; Orrigo, S.E.A.; Santos, J.M.F. dos; Silva, M. [University of Coimbra, Department of Physics, Coimbra (Portugal); Arneodo, F.; Benabderrahmane, M.L.; Di Giovanni, A.; Maris, I. [New York University Abu Dhabi, Abu Dhabi (United Arab Emirates); Barrow, P.; Baudis, L.; Franco, D.; Galloway, M.; Kessler, G.; Kish, A.; Mayani, D.; Pakarha, P.; Piastra, F.; Wei, Y.; Wulf, J. [University of Zurich, Physik-Institut, Zurich (Switzerland); Bauermeister, B. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Berger, T.; Brown, E.; Piro, M.C. [Rensselaer Polytechnic Institute, Department of Physics, Applied Physics and Astronomy, Troy, NY (United States); Bruenner, S.; Cichon, D.; Eurin, G.; Hasterok, C.; Lindner, M.; Undagoitia, T.M.; Pizzella, V.; Rauch, L.; Rupp, N.; Schreiner, J.; Simgen, H. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Bruno, G.; Gallo Rosso, A.; Molinario, A. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); Budnik, R.; Duchovni, E.; Itay, R.; Landsman, H.; Lellouch, D.; Levinson, L.; Manfredini, A.; Priel, N. [Weizmann Institute of Science, Department of Particle Physics and Astrophysics, Rehovot (Israel); Buetikofer, L.; Coderre, D.; Kaminsky, B.; Schumann, M.; Sivers, M. v. [Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Calven, J.; Conrad, J.; Ferella, A.D.; Pelssers, B. [Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Cervantes, M.; Lang, R.F.; Masson, D.; Pienaar, J.; Reichard, S.; Reuter, C. [Purdue University, Department of Physics and Astronomy, West Lafayette, IN (United States); Cussonneau, J.P.; Diglio, S.; Le Calloch, M.; Masbou, J.; Micheneau, K.; Persiani, R.; Thers, D. [Universite de Nantes, SUBATECH, Ecole des Mines de Nantes, CNRS/In2p3, Nantes (France); Di Gangi, P.; Garbini, M.; Massoli, F.V.; Sartorelli, G.; Selvi, M. [University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN, Bologna (Italy); Fei, J.; Ni, K.; Ye, J. [University of California, Department of Physics, San Diego, CA (United States); Fieguth, A.; Murra, M.; Rosendahl, S.; Weinheimer, C. [Westfaelische Wilhelms-Universitaet Muenster, Institut fuer Kernphysik, Muenster (Germany); Fulgione, W. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Grandi, L.; Saldanha, R.; Shockley, E.; Upole, N. [University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Lindemann, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Meng, Y.; Stein, A.; Wang, H. [University of California, Physics and Astronomy Department, Los Angeles, CA (United States); Miguez, B.; Trinchero, G. [INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Naganoma, J.; Shagin, P. [Rice University, Department of Physics and Astronomy, Houston, TX (United States); Lavina, L.S. [LPNHE, Universite Pierre et Marie Curie, Universite Paris Diderot, CNRS/IN2P3, Paris (France); Tunnell, C. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Cristescu, I. [Karlsruhe Institute of Technology, Tritium Laboratory Karlsruhe, Eggenstein-Leopoldshafen (Germany); Collaboration: XENON Collaboration
2017-06-15
We describe the purification of xenon from traces of the radioactive noble gas radon using a cryogenic distillation column. The distillation column was integrated into the gas purification loop of the XENON100 detector for online radon removal. This enabled us to significantly reduce the constant {sup 222}Rn background originating from radon emanation. After inserting an auxiliary {sup 222}Rn emanation source in the gas loop, we determined a radon reduction factor of R > 27 (95% C.L.) for the distillation column by monitoring the {sup 222}Rn activity concentration inside the XENON100 detector. (orig.)
Exposure to radon Rn-222 of inhabitants of buildings in Olsztyn
International Nuclear Information System (INIS)
Gorzkowski, B.; Pachocki, K.; Rozycki, Z.; Majle, T.; Pensko, J.; Krzeslak, A.
1998-01-01
The concentrations of radon-222 in the air of some buildings in Olsztyn were measured. The main source of radon in buildings is in general the ground under building and the materials used for building structure. In this work the results of radon-222 concentration measurements in the air of some buildings constructed before the 1939 year, in the buildings constructed after 1945 year with the traditional use of the bricks and in the buildings constructed with the use of great prefabricated plates are presented. The relations between radon-222 concentrations in the basements and in the first floor flats situated above the basement were evaluated. Based on the mean radon concentrations in the air of the various types of buildings investigated the effective doses for the inhabitants of each type of buildings were estimated. (author)
Directory of Open Access Journals (Sweden)
Jansen Fernandes Medeiros
2014-01-01
Full Text Available Introduction: This study assessed the prevalence of Mansonella ozzardi in riverine communities of the Tefé River, Amazonas, Brazil. Methods: The prevalence of M. ozzardi was estimated by microscopic examination of thick blood smears. Results: The M. ozzardi prevalence rate was 6.3% (19/300. Filarial infection was found in 8 of the 11 communities surveyed, with prevalence rates varying from 2.5% to 22.2%. Conclusions: Tefé is a region of oil and natural gas exploration, in which there is a high turnover of workers. Migration patterns may facilitate the dissemination of mansonelliasis to other regions.
Directory of Open Access Journals (Sweden)
Ying Xu
2017-08-01
Full Text Available Background/Aims: Aberrant vascular smooth muscle cell (VSMC proliferation plays an important role in the development of pulmonary artery hypertension (PAH. Dysregulated microRNAs (miRNAs, miRs have been implicated in the progression of PAH. miR-222 has a pro-proliferation effect on VSMCs while it has an anti-proliferation effect on vascular endothelial cells (ECs. As the biological function of a single miRNA could be cell-type specific, the role of miR-222 in pulmonary artery smooth muscle cell (PASMC proliferation is not clear and deserves to be explored. Methods: PASMCs were transfected with miR-222 mimic or inhibitor and PASMC proliferation was determined by Western blot for PCNA, Ki-67 and EdU staining, and cell number counting. The target genes of miR-222 including P27 and TIMP3 were determined by luciferase assay and Western blot. In addition, the functional rescue experiments were performed based on miR-222 inhibitor and siRNAs to target genes. Results: miR-222 mimic promoted PASMC proliferation while miR-222 inhibitor decreased that. TIMP3 was identified to be a direct target gene of miR-222 based on luciferase assay. Meanwhile, P27 and TIMP3 were up-regulated by miR-222 inhibitor and down-regulated by miR-222 mimic. Moreover, P27 siRNA and TIMP3 siRNA could both attenuate the anti-proliferation effect of miR-222 inhibitor in PASMCs, supporting that P27 and TIMP3 are at least partially responsible for the regulatory effect of miR-222 in PASMCs. Conclusion: miR-222 promotes PASMC proliferation at least partially through targeting P27 and TIMP3.
222Rn in private well water in the vicinity of uranium mines over ten years
International Nuclear Information System (INIS)
Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige
1994-01-01
There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)
International Nuclear Information System (INIS)
O'Connor, P.J.; Gallagher, V.; Van den Boom, G.
1992-01-01
Recent indoor radon reconnaissance surveys in Ireland have identified buildings with high radon concentrations (up to 1700 Bq.m -3 ) overlying Carboniferous karstic limestone sequences in the western part of the country. A detailed investigation of indoor 222 Rn and soil gas 222 Rn and 4 He concentrations has been carried out over a karstic limestone-uraniferous granite boundary in County Galway. High indoor 222 Rn concentrations occur in dwellings over both lithologies. Radon migratory routes in bedrock and overburden appear to be controlled by zones of enhanced permeability, e.g. fractures, faults, etc. which are defined by linear arrays of elevated 4 He soil gas values. While the ultimate source of radon remains conjectural, the greatly enhanced permeability of karstified limestone is thought to be of fundamental importance in providing a means of rapid radon transport into overlying soils and buildings. (author)
Determinants of tuberculosis in Brazil: from conceptual framework to practical application
Directory of Open Access Journals (Sweden)
Ethel Leonor Maciel
2015-07-01
Full Text Available OBJECTIVE: To leverage a conceptual analytical model for TB determination to identify factors that influence emergence of new cases of tuberculosis (TB and poor TB treatment outcomes in Brazil. METHODS: This was a cross-sectional study based on data from Brazil's Notifiable Disease Surveillance System database (SINAN. It included all confirmed, incident TB cases reported in Brazil in 2007 - 2011: a total of 432 958 TB cases, of which 318 465 cases with complete data on treatment outcomes were included. Analysis to explain the causal network that influences TB treatment outcomes was based on a theoretical model for determining TB. Adjusted analyses were used to assess the model fit. Hierarchical logistic regression was used to model the dichotomous TB outcome; hierarchical polytomous regression was used for multinomial TB outcome. RESULTS: Of the 318 465 TB cases included, 222 186 (69.8% were classified as "cured" and 96 279 (30.2% as "treatment failure." Among the latter, 37 604 (11.8% abandoned treatment; 13 193 (4.1% died due to TB; 15 440 (4.8% died due to causes other than TB; 28 848 (9.1% were transferred to another municipality; and 1 194 (0.4% developed multidrug-resistant TB. The dichotomous models were more likely to show spurious associations when compared with the polytomous model. In the polytomous model, individuals assigned to Directly Observed Treatment Short-course were more likely to be cured than others. CONCLUSIONS: Theoretical models are dynamic structures that need ongoing re-evaluation according to new findings; therefore, this is not a definitive proposal for a TB determination model or analysis plan, but rather a proposal that, at present, is adequate in Brazil and has the potential to be extrapolated or adapted to other areas.
12 CFR 222.20 - Coverage and definitions.
2010-01-01
... FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.20 Coverage and definitions. (a...-existing business relationship—(i) In general. The term “pre-existing business relationship” means a relationship between a person, or a person's licensed agent, and a consumer based on— (A) A financial contract...
Zhang, B.; Liu, H.; Crawford, J. H.; Fairlie, T. D.; Chen, G.; Chambers, S. D.; Kang, C. H.; Williams, A. G.; Zhang, K.; Considine, D. B.; Payer Sulprizio, M.; Yantosca, R.
2015-12-01
Convective and synoptic processes play a major role in determining the transport and distribution of trace gases and aerosols in the troposphere. The representation of these processes in global models (at ~100-1000 km horizontal resolution) is challenging, because convection is a sub-grid process and needs to be parameterized, while synoptic processes are close to the grid scale. Depending on the parameterization schemes used in climate models, the role of convection in transporting trace gases and aerosols may vary from model to model. 222Rn is a chemically inert and radioactive gas constantly emitted from soil and has a half-life (3.8 days) comparable to synoptic timescale, which makes it an effective tracer for convective and synoptic transport. In this study, we evaluate the convective and synoptic transport in two chemical transport models (GMI and GEOS-Chem), both driven by the NASA's MERRA reanalysis. Considering the uncertainties in 222Rn emissions, we incorporate two more recent scenarios with regionally varying 222Rn emissions into GEOS-Chem/MERRA and compare the simulation results with those using the relatively uniform 222Rn emissions in the standard model. We evaluate the global distribution and seasonality of 222Rn concentrations simulated by the two models against an extended collection of 222Rn observations from 1970s to 2010s. The intercomparison will improve our understanding of the spatial variability in global 222Rn emissions, including the suspected excessive 222Rn emissions in East Asia, and provide useful feedbacks on 222Rn emission models. We will assess 222Rn vertical distributions at different latitudes in the models using observations at surface sites and in the upper troposphere and lower stratosphere. Results will be compared with previous models driven by other meteorological fields (e.g., fvGCM and GEOS4). Since the decay of 222Rn is the source of 210Pb, a useful radionuclide tracer attached to submicron aerosols, improved
Distribution Log Normal of 222 Rn in the state of Zacatecas, Mexico
International Nuclear Information System (INIS)
Garcia, M.L.; Mireles, F.; Quirino, L.; Davila, I.; Rios, C.; Pinedo, J.L.
2006-01-01
In this work the evaluation of the concentration of 222 Rn in air for Zacatecas is shown. The Solid State Nuclear Track Detectors were used as the technique for the realization of the measurements in large scale with cellulose nitrate LR-115, type 2, in open chambers of 222 Rn. The measurements were carried out during three months in different times of the year. In the results it is presented the log normal distribution, arithmetic mean and geometric media for the concentration at indoor and outdoor of residence constructions, the concentration at indoor of occupational constructions and in the 57 municipal heads of the state of Zacatecas. The statistics of the values in the concentration showed variation according to the time of the year, obtaining high quantities in winter seasons for both cases. The distribution of the concentration of 222 Rn is presented in the state map for each one of the municipalities, representing the measurement places in the entire state of Zacatecas. Finally the places where the values in the concentration of 222 Rn in air are near to the one limit settled down by the EPA of 148 Bq/m 3 are presented. (Author)
Energy Technology Data Exchange (ETDEWEB)
Santos, M.L.O.; França, E.J.; Amaral, D.S.; Silva, K.E.M.; Hazin, C.A.; Farias, E.E.G., E-mail: emersonemiliano@yahoo.com.br [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)
2017-07-01
The concentration of radon-222 activity available for transport to the surface through the pore space can be defined as radon emanation. From the decay of radium-226, whose half-life is 1850 years, it is associated with the development of neoplasia, such as lung cancer. In the Metropolitan Region of Recife, sedimentary rocks known as phosphorites have been known since 1959, so, from the radiometric characterization of the Paulista and Igarassu Municipality, in Pernambuco, emanation tests were carried out, aiming to determine the emanation power of radon in samples of uraniferous phosphorite from the Recife Metropolitan Region. Initially, 6 independent samples of phosphorites with activity concentration of {sup 226}Ra> 400 Bq kg{sup -1} were comminuted. Portions of 5g were conditioned in a radon chamber with 500 mL volume for measurements. The linear fit of the model converged after 200 interactions with selection of the best fit by the Chi-Square test, through the Origin® 8.0 program. After analysis of the samples, radon emanation power was estimated in the range of 7% to 15%, with a mean value of 10.8%. The methodology used to determine the emanation parameters in samples of uraniferous phosphorite was adequate, observing an inversely proportional relation between the concentration of the radium-226 and the emanation power.
International Nuclear Information System (INIS)
Cao Jianping; Lu Zhizhao; Li Yuanshan
1993-03-01
The results of concentration measuring of 222 Ru and its daughters and estimation of internal doses to workers in the underground buildings at Nanjing city are presented. The double filtering membrane method and Thomas method were used in the monitoring of 222 Rn and its daughters, and the dose conversion factor was taken from the latest UNSCEAR report. Concentration distributions of 222 Rn and its daughters were approximately log-normal. The geometric means for 222 Rn was 40.5 Bq · m -3 and for its daughters was 1.4 x 10 -7 J · m -3 . The equilibrium factor was 0.63. The radioactive equilibrium ratio between short-lived 222 Rn daughters was 1:0.57:0.49. The estimation value of annual effective dose equivalent from 222 Rn daughters to workers working at underground sites was 1.3 mSv, which was 86% higher than that of those working on ground sites
Goldmann, W; Marier, E; Stewart, P; Konold, T; Street, S; Langeveld, J; Windl, O; Ortiz-Pelaez, A
2016-02-13
Scrapie in goats is a transmissible, fatal prion disease, which is endemic in the British goat population. The recent success in defining caprine PRNP gene variants that provide resistance to experimental and natural classical scrapie has prompted the authors to conduct a survey of PRNP genotypes in 10 goat breeds and 52 herds to find goats with the resistant K222 allele. They report here the frequencies in 1236 tested animals of the resistance-associated K222 and several other alleles by breed and herd. Eight animals were found to be heterozygous QK222 goats (0.64 per cent genotype frequency, 95 per cent CI 0.28 to 1.27 per cent) but no homozygous KK222 goats were detected. The K222 allele was found in Saanen, Toggenburg and Anglo-Nubian goats. The fact that only a few goats with the K222 allele have been identified does not preclude the possibility to design and implement successful breeding programmes at national level. British Veterinary Association.
The natural radioactivity in Guarani aquifer groundwater, Brazil
Energy Technology Data Exchange (ETDEWEB)
Bonotto, D.M. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)], E-mail: danielbonotto@yahoo.com.br; Bueno, T.O. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), Av. 24-A No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)
2008-10-15
The measurements of gross alpha and gross beta radioactivity in groundwater samples from Guarani aquifer in Brazil are reported in this paper together with the activity concentration of the natural dissolved radionuclides {sup 40}K, {sup 238}U, {sup 234}U, {sup 226}Ra, {sup 222}Rn, {sup 210}Po, {sup 210}Pb, {sup 232}Th, {sup 228Th}, and {sup 228}Ra. Most of the gross alpha radioactivity values were below the critical level of detection corresponding to 1 mBq/L, however, the whole data set for the gross beta radioactivity and radionuclides {sup 40}K, {sup 238}U, {sup 234}U, {sup 226}Ra, {sup 222}Rn, {sup 210}Po, {sup 210}Pb, and {sup 228}Ra was submitted to a statistical treatment, considering class intervals arranged in geometric progression, because of the great variability of the activity. The analysis indicated lognormal distribution of the data, as usually observed in samples taken from the natural context. An inverse relationship between the gross alpha and gross beta activity has been identified and is related to an increase in the K content in the water. The mobility coefficient has been estimated for {sup 238}U, {sup 226}Ra, {sup 232}Th and {sup 228}Ra in Guarani aquifer and the results indicated that the radioelement solubility in the studied system varies according to the following order: radium>uranium>thorium. The implications of the data obtained in terms of standards established for defining the drinking water quality have also been discussed.
48 CFR 52.222-3 - Convict Labor.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Convict Labor. 52.222-3... Labor. As prescribed in 22.202, insert the following clause: Convict Labor (JUN 2003) (a) Except as... union central bodies or similar labor union organizations have been consulted; (iii) Such paid...
A process-based {sup 222}radon flux map for Europe and its comparison to long-term observations
Energy Technology Data Exchange (ETDEWEB)
Karstens, U. [Max-Planck-Instistut fuer Biogeochemie, Jena (Germany); Schwingshackl, C.; Schmithuesen, D.; Levin, I. [Heidelberg Univ. (Germany). Inst. fuer Umweltphysik
2015-07-01
Detailed {sup 222}radon ({sup 222}Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution {sup 222}Rn flux map for Europe, based on a parameterization of {sup 222}Rn production and transport in the soil. The {sup 222}Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based {sup 222}Rn soil profile measurements. Monthly {sup 222}Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of {sup 222}Rn exhalation rates in different areas of Europe. The two realizations of the {sup 222}Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean {sup 222}Rn flux from soils in Europe is estimated to be 10 mBq m{sup -2} s{sup -1} (ERA-Interim/Land soil moisture) or 15 mBq m{sup -2} s{sup -1} (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m{sup -2} s{sup -1} and from ca. 11 to ca. 20 mBq m{sup -2} s{sup -1}, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of {sup 222}Rn exhalation rates. Comparison with
SUPPLEMENTARY COMPARISON: COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
Skliarov, V.; Röttger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.
2009-01-01
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5th meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by COOMET, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).
An application of 222Rn alpha particle's tracks to uranium exploration
International Nuclear Information System (INIS)
Aguilar H, F.
1981-01-01
The uranium exploration method is based on the register of 222 Rn alpha particles; 222 Rn gas is generated in the chain 238 U desintegration. The detection of alpha particles was performed with cellulose nitrate films (NTC), located in a grid at the region in study. The alpha particles produce latent tracks in the NTC films; these tracks may be enlarged by chemical etching and are observed with an ordinary optic microscope, ninety seven NTC films were used, these were distributed in an area of approximately seventeen square kilometers, located in the municipalities of Granados and Huasabas in Sonora Mexico, the detectors remain in the ground for a thirty days mean period. The results obtained show an area with high 222 Rn concentration, this can be related with an underground uranium ore deposit. The more important conclusion is that the results obtained in this work can be used as preliminary results for other prospection methods in this particular area. (author)
Measurements of the radon-222 concentration in residences of Lima - Peru
International Nuclear Information System (INIS)
Pereyra, P.; Lopez, M. E.; Perez, B.
2014-08-01
The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)
Some remarks on exact methods for WL and 222Rn-daughter determination
International Nuclear Information System (INIS)
Groer, P.G.
1977-01-01
For an exact determination of the three 222 Rn-daughter concentrations (RaA, B and C) which properly weighted yield the Working Level, three equations relating observed counts (α or β) to these unknown concentrations have to be solved. The half-lives in the 222 Rn decay series, the type of decay and the counting errors, limit the suitable set of equations. Some aspects of two such exact methods are discussed
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)
2012-02-15
In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)
Directory of Open Access Journals (Sweden)
Matteo Brioschi
2010-11-01
Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.
78 FR 31627 - Thirteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S.
2013-05-24
... Committee 222, Inmarsat AMS(R)S. AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held June 10-11 from 9:00 a.m.-5:00 p.m. ADDRESSES: The meeting...
78 FR 8684 - Twelfth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S
2013-02-06
... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S. DATES: The meeting will be held February 20, 2013, from 1:00 p.m.--4:00 p.m. ADDRESSES...
78 FR 61446 - Fourteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S
2013-10-03
... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held November 19, 2013 from 9:00 a.m.-5:00 p.m. ADDRESSES: The...
Growth inhibitory effects of miR-221 and miR-222 in non-small cell lung cancer cells
International Nuclear Information System (INIS)
Yamashita, Ryo; Sato, Mitsuo; Kakumu, Tomohiko; Hase, Tetsunari; Yogo, Naoyuki; Maruyama, Eiichi; Sekido, Yoshitaka; Kondo, Masashi; Hasegawa, Yoshinori
2015-01-01
Both pro- and anti-oncogenic roles of miR-221 and miR-222 microRNAs are reported in several types of human cancers. A previous study suggested their oncogenic role in invasiveness in lung cancer, albeit only one cell line (H460) was used. To further evaluate involvement of miR-221 and miR-222 in lung cancer, we investigated the effects of miR-221 and miR-222 overexpression on six lung cancer cell lines, including H460, as well as one immortalized normal human bronchial epithelial cell line, HBEC4. miR-221 and miR-222 induced epithelial-to-mesenchymal transition (EMT)-like changes in a minority of HBEC4 cells but, unexpectedly, both the microRNAs rather suppressed their invasiveness. Consistent with the prior report, miR-221 and miR-222 promoted growth in H460; however, miR-221 suppressed growth in four other cell lines with no effects in one, and miR-222 suppressed growth in three cell lines but promoted growth in two. These are the first results to show tumor-suppressive effects of miR-221 and miR-222 in lung cancer cells, and we focused on clarifying the mechanisms. Cell cycle and apoptosis analyses revealed that growth suppression by miR-221 and miR-222 occurred through intra-S-phase arrest and/or apoptosis. Finally, lung cancer cell lines transfected with miR-221 or miR-222 became more sensitive to the S-phase targeting drugs, possibly due to an increased S-phase population. In conclusion, our data are the first to show tumor-suppressive effects of miR-221 and miR-222 on lung cancer, warranting testing their potential as therapeutics for the disease
Yu, Dan-Dan; Wu, Ying; Zhang, Xiao-Hui; Lv, Meng-Meng; Chen, Wei-Xian; Chen, Xiu; Yang, Su-Jin; Shen, Hongyu; Zhong, Shan-Liang; Tang, Jin-Hai; Zhao, Jian-Hua
2016-03-01
Breast cancer (BCa) is one of the major deadly cancers in women. However, treatment of BCa is still hindered by the acquired-drug resistance. It is increasingly reported that exosomes take part in the development, metastasis, and drug resistance of BCa. However, the specific role of exosomes in drug resistance of BCa is poorly understood. In this study, we investigate whether exosomes transmit drug resistance through delivering miR-222. We established an adriamycin-resistant variant of Michigan Cancer Foundation-7 (MCF-7) breast cancer cell line (MCF-7/Adr) from a drug-sensitive variant (MCF-7/S). Exosomes were isolated from cell supernatant by ultracentrifugation. Cell viability was assessed by MTT assay and apoptosis assay. Individual miR-222 molecules in BCa cells were detected by fluorescence in situ hybridization (FISH). Then, FISH was combined with locked nucleic acid probes and enzyme-labeled fluorescence (LNA-ELF-FISH). Individual miR-222 could be detected as bright photostable fluorescent spots and then the quantity of miR-222 per cell could be counted. Stained exosomes were taken in by the receipt cells. MCF-7/S acquired drug resistance after co-culture with exosomes from MCF-7/Adr (A/exo) but did not after co-culture with exosomes from MCF-7/S (S/exo). The quantity of miR-222 in A/exo-treated MCF-7/S was significantly greater than in S/exo-treated MCF-7/S. MCF-7/S transfected with miR-222 mimics acquired adriamycin resistance while MCF-7/S transfected with miR-222 inhibitors lost resistance. In conclusion, exosomes are effective in transmitting drug resistance and the delivery of miR-222 via exosomes may be a mechanism.
A sub-nationwide survey of outdoor and indoor 222Rn concentrations in China by passive method
International Nuclear Information System (INIS)
Jin Yihe; Ikebe, Y.; Iida, T.
1996-01-01
From Nov. 1988 to Mar. 1993, cooperated by China and Japan, a survey of outdoor and indoor 222 Rn concentrations in 10 cities which were highly populated in China was carried out by means of passive method. the annual mean of outdoor 222 Rn concentration in 10 cities was 8.8 Bq·m -3 . The highest of 13.5 Bq·m -3 was in Wuhan, the lowest of 3.3 Bq·m -3 was in Chongming Island of Shanghai; and there were no significant differences among the different years in the same areas. During the northwest wind seasons, about 50% of outdoor 222 Rn concentration in Taiwan was contributed by the airflow from the mainland. Typical apartment houses and offices built of brick and concrete were also surveyed for indoor 222 Rn concentration. The annual mean of indoor 222 Rn concentration in the 10 cities was 19.5 Bq·m - 3. The highest of 33.9 Bq·m -3 was observed in Guiyang, the lowest of 9.0 Bq·m -3 was observed in Chongming Island of Shanghai. The outdoor and indoor 222 Rn concentrations showed a clear seasonal pattern with the minimum in summer and the maximum in winter. And they also showed a clear geographic distribution tendency; they were higher in inland than in seashores, and higher in the south than in the north. The ratios of indoor to outdoor 222 Rn concentrations were from 1.1 to 4.6. The annual effective dose equivalents resulting from outdoor and indoor 222 Rn concentrations amounted to about 0.64 mSv·a -1 . The highest was in Guiyang, and the lowest was in Nantong, being 1.12 and 0.39 mSv·a -1 , respectively
A representação social do risco “urânio empobrecido”
Directory of Open Access Journals (Sweden)
Bruna ZANI
2012-08-01
Full Text Available Negli ultimi decenni, ambientalisti, giornalisti, politici e parte dell?opinione pubblica si sono schierati contro l?uso dell?uranio impoverito nelle munizioni e nelle corazzature difensive, chiamando in causa gli effetti potenziali nocivi sulla salute. Ma quali informazioni e conoscenze hanno le persone comuni? Per ovviare ai limiti del paradigma psicometrico, che si è focalizzato prevalentemente sui processi cognitivi trascurando il contesto sociale nel quale la persona è inserita, il presente studio si è proposto di esplorare il contenuto e il campo delle rappresentazioni sociali del rischio ?uranio impoverito?. Si è fatto ricorso alla tecnica delle associazioni libere, chiedendo ai partecipanti (N= 1158, età media 26.7 anni, DS = 11.04, 42% uomini, con diverso orientamento politico di esprimere fino a 3 parole pensando a ?uranio impoverito? e di valutarne la positività/negatività su scala a cinque punti da 1 (molto positiva a 5 (molto negativa. Le analisi condotte sia mediante l?analisi del contenuto tematica che l?analisi delle corrispondenze lessicali hanno evidenziato l?organizzazione delle rappresentazioni intorno a differenti nuclei tematici, a carattere prevalentemente negativo: malattia/mortalità,, armi e guerra, catastrofe e esplosione atomica. Sono emerse inoltre differenze interessanti nelle rappresentazioni in base al genere, all?età e all?orientamento politico dei partecipanti: le persone più anziane sono più informate e consapevoli, associano termini carichi emotivamente, evocatori anche di un alone di colpevolezza intorno alla ?faccenda? dell?uranio impoverito. I giovanissimi invece, poco più che bambini quando il caso uranio impoverito è esploso all?attenzione delle cronache, sono meno esposti alle informazioni e fanno riferimenti a immagini quali bomba atomica e disastro nucleare. Coerentemente con l?effetto dell?uomo bianco, le donne tendono a riportare una maggiore percezione dei rischi associati all?uranio
Directory of Open Access Journals (Sweden)
Acutis Pier Luigi
2012-02-01
Full Text Available Abstract Susceptibility of sheep to scrapie, a transmissible spongiform encephalopathy of small ruminants, is strongly influenced by polymorphisms of the prion protein gene (PRNP. Breeding programs have been implemented to increase scrapie resistance in sheep populations; though desirable, a similar approach has not yet been applied in goats. European studies have now suggested that several polymorphisms can modulate scrapie susceptibility in goats: in particular, PRNP variant K222 has been associated with resistance in case-control studies in Italy, France and Greece. In this study we investigated the resistance conferred by this variant using a natural Italian goat scrapie isolate to intracerebrally challenge five goats carrying genotype Q/Q 222 (wild type and five goats carrying genotype Q/K 222. By the end of the study, all five Q/Q 222 goats had died of scrapie after a mean incubation period of 19 months; one of the five Q/K 222 goats died after 24 months, while the other four were alive and apparently healthy up to the end of the study at 4.5 years post-challenge. All five of these animals were found to be scrapie negative. Statistical analysis showed that the probability of survival of the Q/K 222 goats versus the Q/Q 222 goats was significantly higher (p = 0.002. Our study shows that PRNP gene mutation K222 is strongly associated with resistance to classical scrapie also in experimental conditions, making it a potentially positive target for selection in the frame of breeding programs for resistance to classical scrapie in goats.
International Nuclear Information System (INIS)
Moustafa, A.S.
2004-01-01
The advantageous of liquid scintillation counting technique for 6 Ra determination compared with other methods are the high counting efficiency and the easier sample preparation, with no need for sample pre-concentration. In this work, liquid scintillation counting system was used to measure 222 Rn and 226 Ra levels in environmental samples. The liquid scintillation cocktail was prepared in the laboratory and was found efficient for measuring 222 Rn. Soil, sediment and TENORM samples were dried, grind, sieved and added to hydrochloric acid, in a standard scintillation vial, preloaded with the liquid scintillation cocktail. By measuring 222 Rn levels in the prepared vials, at different intervals of time after preparation, 222 Rn and 226 Ra levels were determined
HH 222: A GIANT HERBIG-HARO FLOW FROM THE QUADRUPLE SYSTEM V380 ORI
Energy Technology Data Exchange (ETDEWEB)
Reipurth, Bo; Aspin, Colin; Connelley, M. S. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States); Bally, John [Center for Astrophysics and Space Astronomy, University of Colorado, Boulder, CO 80309 (United States); Geballe, T. R. [Gemini Observatory, 670 North Aohoku Place, Hilo, HI 96720 (United States); Kraus, Stefan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-78, Cambridge, MA 02138 (United States); Appenzeller, Immo [Landessternwarte Heidelberg, Königstuhl 12, D-69117 Heidelberg (Germany); Burgasser, Adam, E-mail: reipurth@ifa.hawaii.edu, E-mail: caa@ifa.hawaii.edu, E-mail: msc@ifa.hawaii.edu, E-mail: John.Bally@colorado.edu, E-mail: tgeballe@gemini.edu, E-mail: stefan.kraus@cfa.harvard.edu, E-mail: iappenze@lsw.uni-heidelberg.de, E-mail: aburgasser@ucsd.edu [Center for Astrophysics and Space Science, University of California San Diego, La Jolla, CA 92093 (United States)
2013-11-01
HH 222 is a giant shocked region in the L1641 cloud, and is popularly known as the Orion Streamers or ''the waterfall'' on account of its unusual structure. At the center of these streamers are two infrared sources coincident with a nonthermal radio jet aligned along the principal streamer. The unique morphology of HH 222 has long been associated with this radio jet. However, new infrared images show that the two sources are distant elliptical galaxies, indicating that the radio jet is merely an improbable line-of-sight coincidence. Accurate proper motion measurements of HH 222 reveal that the shock structure is a giant bow shock moving directly away from the well-known, very young, Herbig Be star V380 Ori. The already known Herbig-Haro object HH 35 forms part of this flow. A new Herbig-Haro object, HH 1041, is found precisely in the opposite direction of HH 222 and is likely to form part of a counterflow. The total projected extent of this HH complex is 5.3 pc, making it among the largest HH flows known. A second outflow episode from V380 Ori is identified as a pair of HH objects, HH 1031 to the northwest and the already known HH 130 to the southeast, along an axis that deviates from that of HH 222/HH 1041 by only 3.°7. V380 Ori is a hierarchical quadruple system, including a faint companion of spectral type M5 or M6, which at an age of ∼1 Myr corresponds to an object straddling the stellar-to-brown dwarf boundary. We suggest that the HH 222 giant bow shock is a direct result of the dynamical interactions that led to the conversion from an initial non-hierarchical multiple system into a hierarchical configuration. This event occurred no more than 28,000 yr ago, as derived from the proper motions of the HH 222 giant bow shock.
Directory of Open Access Journals (Sweden)
Abolfazl Semnani
2006-12-01
Full Text Available Spectrophotometric and electrochemical studies concerning the interaction of cryptand 222 with DDQ and I2 have been performed in ethanol solution. In the case of DDQ, the results are indicative of the formation of C222¬+ and DDQ- through an equilibrium reaction. The results of I2 indicate the formation of I2-ethanol complex and I3- in the absence of C222. In the presence of C222, the formation of C222I¬+ and I3- through a non-equilibrium reaction is confirmed. The equilibrium constant of the redox reaction between DDQ and C222 has been calculated from the absorbance mole ratio data, using the nonlinear least square program “KINFIT”. The electrochemical reversibility of I-/I2 couple and irreversibility of DDQ/DDQ- is indicated by amperometry. The behavior of DDQ and I2 has been compared. A comparison with aprotic solvents has also been made.
Design and construction of a system for determination of Radon-222 by a surface-barrier detector
International Nuclear Information System (INIS)
Bonifacio M, J.; Iturbe, J.L.
1993-01-01
In the present work the design and construction of a system for the determination of 222 Rn is described, which utilizes silicon surface-barrier detectors. The 222 Rn gas was obtained a source of 226 Ra electrodeposited on stainless-steel discs. The well separated energies with this system makes possible the measurement and identification of alpha particles of 222 Rn, and its daughters 210 Po, 218 Po and 214 Po. (Author) 3 figs, 19 refs
Average daily and annual courses of 222Rn concentration in some natural medium
International Nuclear Information System (INIS)
Holy, K.; Bohm, R.; Polaskova, A.; Stelina, J.; Sykora, I.; Hola, O.
1996-01-01
Simultaneous measurements of the 222 Rn concentration in the outdoor atmosphere of Bratislava and in the soil air over one year period have been made. Daily and seasonal variations of the 222 Rn concentration in both media were found. Some attributes of these variations as well as methods of measurements are presented in this work. (author). 17 refs., 6 figs
Transfer of radon-222 from rocks of the Pocos de Caldas plateau to the waters
International Nuclear Information System (INIS)
Bonotto, Daniel Marcos; Lima, Jorge Luis Nepomuceno de
1997-01-01
The analytical procedures developed at the Sector of Unstable Isotopes of the Laboratory of Geochemistry, which belongs to the Department of Petrology and Metallogeny located at the Institute of Geosciences and Exact Sciences - Universidade Estadual Paulista Julio de Mesquita Filho (UNESP) to measure the release of 222 Rn from rocks to the waters is described. The methodology established was used to evaluate the emanation coefficient of 222 Rn from experiments of water-rock interaction under controlled conditions in the laboratory, which is an important parameter necessary to interpret the radioactivity related to dissolved 222 Rn content in waters. Four typical rocks from Pocos de Caldas Plateau were sampled for the experiments: phonolite, nepheline syenite, pseudoleucite tinguaite and silicified sandstone. The 226 Ra content of these rocks was evaluated by gamma-ray spectrometry using a Nal(TI) scintillation detector, a method that has been currently utilized in nuclear geophysics or isotope geochemistry to measure the equivalent uranium (e U). The 226 Ra content in the studied rocks and the 222 Rn transferred to the waters due to its generation by its 226 Ra progenitor allowed an estimation of the emanation coefficient of 222 Rn. A preliminary investigation on the influence of the mass of the rock in contact with water, of the surface area of the rock in contact with water and of the 226 Ra content in rocks on the amount of 222 Rn released to the water was also performed. (Author)
Anesthesia of juvenile Pacific Lampreys with MS-222, BENZOAK, AQUI-S 20E, and Aquacalm
Christiansen, Helena E.; Gee, Lisa P.; Mesa, Matthew G.
2013-01-01
Effective anesthetics are a critical component of safe and humane fish handling procedures. We tested three concentrations each of four anesthetics—Finquel (tricaine methanesulfonate, herein referred to as MS-222), BENZOAK (20% benzocaine), AQUI-S 20E (10% eugenol), and Aquacalm (metomidate hydrochloride)—for efficacy and safety in metamorphosed, outmigrating juvenile Pacific Lampreys Entosphenus tridentatus. The anesthetics MS-222 (100 mg/L) and BENZOAK (60 mg/L) were the most effective for anesthetizing juvenile Pacific Lampreys to a handleable state with minimal irritation to the fish. Fish anesthetized with BENZOAK also had lower rates of fungal infection than those exposed to MS-222, AQUI-S 20E, or no anesthetic. Exposure to AQUI-S 20E irritated juvenile Pacific Lampreys, causing them to leap or climb out of the anesthetic solution, and Aquacalm anesthetized fish to a handleable state too slowly and incompletely for effective use with routine handling procedures. Our results indicate that MS-222 and BENZOAK are effective anesthetics for juvenile Pacific Lampreys, but field studies are needed to determine whether exposure to MS-222 increases risk of fungal infection in juvenile Pacific Lampreys released to the wild.
Gas exchange in the Pee Dee River based on 222Rn evasion
International Nuclear Information System (INIS)
Moore, W.S.; Elsinger, R.J.
1983-01-01
Excess 222 Rn concentrations decrease downstream in the fresh water section of the Pee Dee River. Ground water is the primary source of the excess 222 Rn to the River. Using the radon concentration gradients determined during four sampling periods, gas exchange rates based on the stagnant film model are calculated. Stagnant film thicknesses range from 19 μm to 48 μm and mass transfer coefficients range from 2.1 m/d to 4.1 m/d
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What action must an applicant take upon a change in its boundary, classification, control, governing authority, or identity? 222.8 Section 222.8 Education..., DEPARTMENT OF EDUCATION IMPACT AID PROGRAMS General § 222.8 What action must an applicant take upon a change...
20 CFR 222.17 - “Child in care” when child of the employee is living with the claimant.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in careâ when child of the employee is living with the claimant. 222.17 Section 222.17 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222...
International Nuclear Information System (INIS)
Melo, N.P.; Amaral, R.S.; Silva, C.M.; Hazin, C.A.; Lima, R.A.; Valentim, E.
2000-01-01
There has been an increasing concern with the assessment of human exposure to naturally occurring radionuclides as they account for around 70% of the total dose received by the population. Most of the exposure derived from natural terrestrial sources comes from the radionuclides in the uranium series, which is headed by the long-lived isotope 238 U. Radionuclides pertaining to this decay chain, such as, 226 Ra, 222 Ra, 210 Pb and 210 Po are the most important to be studied, as far as the dose to the population is concerned. In order to verify if the levels of radioactive contaminants in the water from public supplies are in compliance with the limits set by the Ministry of Health, a survey has been carried out in the metropolitan area of Recife, Brazil. This paper reports the results of this survey for both, superficial and groundwater supplies. Water samples collected from 107 sampling points were analyzed to determine their content of natural uranium, 226 Ra, 222 Ra, 210 Pb and 210 Po. Uranium concentrations were determined by fluorimetry after extraction with an organic solvent and deposition in LiF/NaF pellets, which were fused at 1000degC. Radium-226 was determined by the emanation technique, whereas 222 Rn was determined by liquid scintillation counting. Polonium-210, on the other hand, was determined by alpha spectrometry, following its spontaneous plating in copper disks immersed in the water samples. Measured concentrations ranged from 43 to 1330 mBq/L for natural uranium, 5.3 to 83.7 Bq/L for 222 Rn and from below the MDL (22 mBq/L) to 337 mBq/L for 210 Po. The annual intake of each radionuclide was calculated by considering an ingestion of 2L of water per day. The dose to each organ considered important to the ingestion pathway was calculated by using the masses given in the ICRP 23 for the standard man and by applying the appropriate dose conversion factors. (author)
50 CFR 222.103 - Federal/state cooperation in the conservation of endangered and threatened species.
2010-10-01
... Federal regulations for grant administration and cost accounting principles. (3)(i) The payment of the... conservation of endangered and threatened species. 222.103 Section 222.103 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE...
Energy Technology Data Exchange (ETDEWEB)
Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A., E-mail: cesar_arevalob@outlook.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)
2017-09-15
A study was carried out to determine the concentration of {sup 222}Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The {sup 222}Rn radioactive gas is a product of the decay series of {sup 238}U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The {sup 222}Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that {sup 222}Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing {sup 222}Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of {sup 222}Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of {sup 222}Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of {sup 222}Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of {sup 222}Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m{sup 3} and 1,463 μ Sv a, respectively. (Author)
222Rn concentration in the outdoor atmosphere and its relation to the atmospheric stability
International Nuclear Information System (INIS)
Holy, K.; Boehm, R.; Bosa, I.; Polaskova, A.; Hola, O.
1998-01-01
The radon in the outdoor atmosphere has been monitored continuously since 1991. On the basis of the measured data mainly the average daily and the average annual courses of the 222 Rn concentrations have been studied. The annual courses of 222 Rn concentration are similar for all years. They present the annual variations. The average course of the 222 Rn concentration calculated on the basis of all continual measurements in the years 1991-1997 reaches the maximum value in October and the minimum value in April. The average daily courses of the 222 Rn concentration for the individual months of the year. The average daily courses have a form of waves with a maximum in the morning hours and with a minimum in the afternoon. The maximal amplitudes of daily waves have been reached in the summer months, from June till August. The amplitudes of daily waves are very small at the end of an autumn and during the winter months. The analysis of the daily waves and annual courses of 222 Rn showed that the amplitudes of the daily waves are in proportion to the global solar radiation irradiating the Earth's surface. The day duration influence on the phase of the daily wave and the wind velocity influence mainly on the level of the radon concentration. For the study of the relation of the radon concentration in the outdoor atmosphere to the stability the data of the atmosphere were obtained and they were correlated with the radon concentration. The results indicate that the 222 Rn concentrations int he outdoor atmosphere could be used for determination of the vertical atmospheric stability and these ones could reflect the atmospheric stability more completely than the different classifications based on the knowledge pertinent to the meteorological parameters. (authors)
Direct determination of 222Rn gas using the electret to remove daughters at formation
International Nuclear Information System (INIS)
Harley, N.H.
1981-01-01
Five compact, portable, continuous 222 Rn monitors have been constructed inhouse. Printed data can be obtained from intervals ranging from 10 minutes to 990 minutes. One hour count interval provides a lower limit of detection of 0.03 pCi 222 Rn/l -1 which is sufficient for measurement of any environmental level encountered. Calibration of the units was accomplished in the EML radon calibration room and the typical calibration factor is 165 counts per hour per pCi 222 Rn/l. The units are now being field tested. Two indoor/outdoor pairs are located in a single family dwelling and in a high rise apartment. One unit is being used for special studies
Energy Technology Data Exchange (ETDEWEB)
Silva, Karolayne E.M. da; Santos, Mariana L. de O.; Amaral, Déric S. do; Vilela, Eldice C.; França, Elvis J. de; Hazin, Clovis A.; Farias, Emerson E.G. de, E-mail: keesthefany@gmail.com, E-mail: marianasantos_ufpe@hotmail.com, E-mail: dericsoares@gmail.com, E-mail: ecvilela@cnen.gov.br, E-mail: ejfrana@cnen.gov.br, E-mail: chazin@cnen.gov.br, E-mail: emersonemiliamo@yahoo.com.br [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)
2017-07-01
Radon-222 is a radioactive gas, a product of the decay of uranium-238, which emits alpha particles and represents more than 50% of the dose of natural radiation received by the population. Therefore, monitoring of this gas is essential. For indoor measurement, solid state detectors can be used, the most common of which is CR-39. For monitoring using CR-39, alpha particles, generated by radon-222 and the daughter radionuclides, strike the surface of the detector and generate traces. To relate the trace density per exposure area in environments with unknown activity concentration, it is necessary to determine the calibration factor. The objective of this study was to calibrate CR-39 type detectors for the implementation of the radon determination methodology in Centro Regional de Ciencias Nucleares do Nordeste - CRCN-NE of Brazilian Nuclear Energy Commission - CNEN. In order to determine the CR-39 calibration factor, 19 exposures of the detectors were performed in the CRCN-NE calibration chamber (RN1-CRCN) at an activity of 5.00 kBq m{sup -3}, with the exposure time varying from 24 to 850 hours. For the detection of the detectors, sodium hydroxide was used in a thermostat bath at 90 ° C for 5 hours. The count of number of traits per unit of field was performed with the aid of optical microscopy with an increase of 100 times, being read 30 fields per dosimeters. As a result, the calibration factor was obtained, and the linear response of the trace density as a function of exposure was observed. The results allow the use of CR-39 in the determination of radon-222 by CRCN-NE.
48 CFR 52.222-18 - Certification Regarding Knowledge of Child Labor for Listed End Products.
2010-10-01
... for Listed End Products. As prescribed in 22.1505(a), insert the following provision: Certification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Certification Regarding Knowledge of Child Labor for Listed End Products. 52.222-18 Section 52.222-18 Federal Acquisition...
Specificity of the Spectrophotometry for Detecting Aminopolyether K2.2.2 in 18F-FDG
Directory of Open Access Journals (Sweden)
ZHANG Jin-ming
2015-11-01
Full Text Available 氨基聚醚(K2.2.2含量是18F-FDG质控中的关键指标,比较了两种常用测量K2.2.2方法的专属性。分别采用分光光度计和半定量TLC 碘显色法测量了14个样品,其中9个阴性样品、2个阳性样品和3个供试品,并与LC-MS/MS测量对比。结果显示:9个阴性样品经分光光度计法测量均为阳性,K2.2.2的测量结果在6.7~470.0 μg/mL;2个阳性样品结果偏高(53,73 μg/mL),3个供试品的K2.2.2含量在14.3~19.2 μg/mL;半定量TLC 碘显色法测量9个阴性样品结果为阴性,2个阳性样品半定量结果与实际一致,3个供试品的K2.2.2含量低于10 μg/mL;LC-MS/MS法测量的14个样品的结果与半定量TLC 碘显色法的结果一致。以上结果表明,半定量TLC 碘显色法测量K2.2.2的专属性较好,适用于测量18F-FDG溶液中K2.2.2含量。
Evaluation of the anesthetic effects of MS222 in the adult Mexican axolotl (Ambystoma mexicanum
Directory of Open Access Journals (Sweden)
Zullian C
2016-01-01
Full Text Available Chiara Zullian,1 Aurore Dodelet-Devillers,1 Stéphane Roy,2 Pascal Vachon1 1Département de Biomédecine Vétérinaire, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, 2Département de Stomatologie, Faculté de Médecine Dentaire, Montréal, Québec, Canada Abstract: The Mexican axolotl (Ambystoma mexicanum is a unique research model in several fields of medicine, where surgical and invasive procedures may be required. As yet, little is known about the efficacy of MS222 (tricaine methanesulfonate, which is the most commonly used anesthetic agent in amphibians. The main objectives of this study were to evaluate the anesthetic effects and physiological changes in adult axolotls following a 20-minute immersion bath, containing progressive MS222 concentrations starting at 0.1%. Depth of anesthesia and physiological changes were evaluated every 15 minutes post-MS222 exposure with the following parameters: righting behavior, withdrawal reflex, acetic acid test response, heart rate, and blood oxygen saturation, as well as cloacal and body surface temperatures. A 20-minute exposure in a 0.1% MS222 immersion bath (n=6 animals had no anesthetic effects on adult axolotls after 20 minutes of exposure. With a 0.2% MS222 solution, all axolotls (n=9 were deeply anesthetized at 15 minutes, and 80% were still unresponsive at 30 minutes postexposure. Blood oxygen saturation and heart rate were slightly, but significantly, increased when compared with the baseline value and remained stable up to recovery. There was no significant increase in surface and cloaca temperatures, compared with baseline. With the 0.4% MS222 solution, the duration of anesthesia lasted for 90 minutes to at least 120 minutes (n=3 animals and this concentration was deemed too high. In conclusion, a 20-minute immersion bath with 0.2% MS222 may be used for short procedures (15–30 minutes requiring anesthesia of adult axolotls. Keywords: Ambystoma mexicanum
Padilla, G.; Hernández, P. A.; Padrón, E.; Barrancos, J.; Melián, G.; Dionis, S.; Rodríguez, F.; Nolasco, D.; Calvo, D.; Hernández, I.; Pereza, M. D.; Pérez, N. M.
2012-04-01
El Hierro (278 km2) is the southwesternmost island of the Canarian archipelago. From June 19, 2011 to January 2012, more than 11,950 seismic events have been detected by the seismic network of IGN. On 10 October 2011 the earthquake swarm changed its behaviour and produced a harmonic tremor due to magma movement, indicating that a submarine eruption located at 2 km south of La Restinga had started which is still in progress. Since 2003, the ITER Environmental Research Division now integrated in the Instituto Volcanológico de Canarias, INVOLCAN, has regularly performed soil gas surveys at El Hierro as a geochemical tool for volcanic surveillance. Among the investigated gases, soil gas radon (222Rn) and thoron (220Rn) have played a special attention. Both gases are characterized to ascend towards the surface mainly through cracks or faults via diffusion or advection, mechanisms dependent of both soil porosity and permeability, which in turn vary as a function of the stress/strain changes at depth. Years before the starts of the volcanic-seismic crisis on July 17, 2011, a volcanic multidisciplinary surveillance program was implemented at El Hierro including discrete and continuous measurements of 222Rn and 220Rn. Two soil gas 222Rn surveys had been carried out at El Hierro in 2003 and 2011, and four continuous geochemical monitoring stations for 222Rn and 220Rn measurements had been installed (HIE02, HIE03, HIE04 and HIE08). Soil gas 222Rn surveys were carried out at the surface environment of El Hierro after selecting 600 sampling observation sites (about 40 cm depth). Geochemical stations measure 222Rn and 220Rn activities by pumping the gas from a PVC pipe inserted 1m in the ground and thermally isolated. The results of the 2003 and 2011 soil gas 222Rn surveys show clearly a relatively higher observed 222Rn activities in the surface environment on 2011 than those observed on 2003 when no anomalous seismicity were taking place beneath El Hierro. The observed
Potable water as a source of airborne 222Rn in US dwellings: a review and assessment
International Nuclear Information System (INIS)
Nazaroff, W.W.; Doyle, S.M.; Nero, A.V.; Sextro, R.G.
1987-01-01
Using a long-term-average, single-cell model and available data for U.S. housing, the concentration of 222 Rn in indoor air due to the use of potable water is assessed. The ratio of the airborne 222 Rn concentration to the concentration in water is represented by a lognormal distribution with geometric mean and geometric standard deviation of 0.65 X 10(-4) and 2.88, respectively, in fair agreement with the previously reported results of direct measurements of the ratio in 13 houses. By combining this result with data on 222 Rn concentrations in U.S. water supplies, potable water is estimated to contribute an average of 24, 1.3, and 0.1 Bq m-3 to the airborne 222 Rn concentration in residences served by private wells, public ground water, and surface water supplies, respectively
International Nuclear Information System (INIS)
Gouvea, Vandir de Azevedo; Cardoso, Domingos d'Oliveira; Castro, Carlos Alberto Carvalho
2000-01-01
The gotten concentrations of radon-222 in the installations of the IEN had been determined using the active and passive methods. The active method consisted on the use of the alpha spectrometry with a portable equipment Tracerlab Instruments WLM- Plus. In the determination for the passive method, one used detectors of nuclear strokes of type LEXAN. The raised values had been gotten in the wastes deposit and its annexes, room of the press and laboratory of wastes handling. It was observed, in this sector, an instantaneous measure of alpha spectrometry, concentrations around 1000 Bq.m-3, which had over all to the function of storage, the sector, a great volume of natural radioactive materials, especially of radium-226. This determination was carried through in an extreme situation of ventilation zero, where the gates had been kept closed during the execution of the same one. It was observed, however, a considerable fall, with values ten times inferior, after to submit the environment to a ventilation forced by means of fans and exhaust fans. The results gotten in the alpha spectrometry had been confirmed by the detectors of strokes, over all in that it says respect ace trends of storage of the gas in environments little ventilated. Some suggestions had been made on procedures to be adopted, aiming at the security of the people in these environments. The other places studied in the IEN had been, the room of the Argonauta reactor, laboratories and caves of the Cyclotron, diverse laboratories of the sector of chemistry and rooms of staff. The present study it objectified the establishment of a methodology of inquiry of the radon in occupational areas, besides considering solutions for the minimization of the concentrations of the gas, in similar environments of work to the ones of the IEN
International Nuclear Information System (INIS)
Labidi, S; Essafi, F; Mahjoubi, H
2006-01-01
The 222 Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of 222 Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the 222 Rn concentration varies in the range 33-589 Bq m -3 . The 222 Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The 222 Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the 222 Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10 -4 to 1.1 x 10 -4 mSv. These values are within the ICRP recommended values. (note)
Energy Technology Data Exchange (ETDEWEB)
Labidi, S [Institut Superieur des Technologies Medicales de Tunis (Tunisia); Essafi, F [Faculte de Medecine de Tunis, Section de Biophysique, Tunis (Tunisia); Mahjoubi, H [Institut Superieur des Technologies Medicales de Tunis (Tunisia)
2006-09-15
The {sup 222}Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of {sup 222}Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the {sup 222}Rn concentration varies in the range 33-589 Bq m{sup -3}. The {sup 222}Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The {sup 222}Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the {sup 222}Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10{sup -4} to 1.1 x 10{sup -4} mSv. These values are within the ICRP recommended values. (note)
International Nuclear Information System (INIS)
Lee, Thomas K.C.; Yu, K.N.
2000-01-01
A bedroom was selected for detailed measurements on 220 Rn and 222 Rn concentrations and environmental parameters including CO 2 concentration, temperature and relative humidity. To simulate different sealing conditions, five conditions were artificially created in the sampling period of 25 consecutive days. It was concluded that natural ventilation is the most efficient way to lower the 222 Rn levels, while air conditioning is the next. Dehumidification provides only a marginal reduction of 222 Rn levels. The 220 Rn concentrations are not affected by natural ventilation, air conditioner or dehumidification, and were all around 10 Bq m -3 . There are no significant correlations between the 220 Rn and 222 Rn concentrations and environmental conditions such as CO 2 concentrations, temperature, relative humidity and pressure
Radon-222 signatures of natural ventilation regimes in an underground quarry.
Perrier, Frédéric; Richon, Patrick; Crouzeix, Catherine; Morat, Pierre; Le Mouël, Jean Louis
2004-01-01
Radon-222 activity concentration has been monitored since 1999 in an underground limestone quarry located in Vincennes, near Paris, France. It is homogeneous in summer, with an average value of 1700 Bq m(-3), and varies from 730 to 1450 Bq m(-3) in winter, indicating natural ventilation with a rate ranging from 0.5 to 2.4 x 10(-6) s(-1) (0.04-0.22 day(-1)). This hypothesis is supported by measurements in the vertical access pit where, in winter, a turbulent air current produces a stable radon profile, smoothly decreasing from 700 Bq m(-3) at 20 m depth to 300 Bq m(-3) at surface. In summer, a thermal stratification is maintained in the pit, but the radon-222 concentration jumps repeatedly between 100 and 2000 Bq m(-3). These jumps are due to atmospheric pressure pumping, which induces ventilation in the quarry at a rate of about 0.1 x 10(-6) s(-1) (0.009 day(-1)). Radon-222 monitoring thus provides a dynamical characterisation of ventilation regimes, which is important for the assessment of the long-term evolution of underground systems.
International Nuclear Information System (INIS)
Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A.
2017-09-01
A study was carried out to determine the concentration of 222 Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The 222 Rn radioactive gas is a product of the decay series of 238 U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The 222 Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that 222 Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing 222 Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of 222 Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of 222 Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of 222 Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of 222 Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m 3 and 1,463 μ Sv a, respectively. (Author)
Evaluation of groundwater discharge into small lakes based on the temporal distribution of radon-222
Dimova, N.T.; Burnett, W.C.
2011-01-01
In order to evaluate groundwater discharge into small lakes we constructed a model that is based on the budget of 222Rn (radon t1/2 5 3.8 d) as a tracer. The main assumptions in our model are that the lake's waters are wellmixed horizontally and vertically; the only significant 222Rn source is via groundwater discharge; and the only losses are due to decay and atmospheric evasion. In order to evaluate the groundwater-derived 222Rn flux, we monitored the 222Rn concentration in lake water over periods long enough (usually 1-3 d) to observe changes likely caused by variations in atmospheric exchange (primarily a function of wind speed and temperature). We then attempt to reproduce the observed record by accounting for decay and atmospheric losses and by estimating the total 222Rn input flux using an iterative approach. Our methodology was tested in two lakes in central Florida: one of which is thought to have significant groundwater inputs (Lake Haines) and another that is known not to have any groundwater inflows but requires daily groundwater augmentation from a deep aquifer (Round Lake). Model results were consistent with independent seepage meter data at both Lake Haines (positive seepage of ??? 1.6 ?? 104 m3 d-1 in Mar 2008) and at Round Lake (no net groundwater seepage). ?? 2011, by the American Society of Limnology and Oceanography, Inc.
Calibration factor determination for solid nuclear track detectors CR-39 type exposed to Rn-222
International Nuclear Information System (INIS)
Cazula, Camila Dias; Campos, Marcia Pires de; Mazzilli, Barbara Paci
2014-01-01
In the detection method with solid nuclear track detector, when a heavy particle rests on the detector surface, causes a breakdown in their molecular structure forming a trace. One of the typical applications of these detectors is the measurement of the concentration of Rn -222 in air, a noble radioactive gas, part of the U-238 series, emitting alpha particles and important in epidemiological studies to protect individuals from natural radiation. To determine the concentration of Rn -222 in the air in a room is necessary to know the density of lines (traces / cm 2 ) on the detector surface, the exposure time and the calibration factor. The determination of the calibration factor for CR-39 detectors was taken from the exposure of these to a known concentration of Rn-222. Therefore, the detectors were placed inside a cell of Lucas adapted and subsequently exposed to a concentration of Rn-222 15 kBq / m 3 , by means of the apparatus RN-150 Pylon Electronics Incorporation, which has a source of Ra-226 and releases known concentrations of Rn-222. Six calibration factor determinations were performed, the average value obtained was 0.0534 ±0.0021 (traces / cm 2 per Bq / m 3 day). The results are consistent with literature values for the same type of detector and showed good reproducibility
Measurement of Rn-222 concentrations in building materials used in jordan
Energy Technology Data Exchange (ETDEWEB)
Ismail, A M; Abumyrad, K M; Kullab, M K; Albataina, B A [Physics Dept., Yarmouk University, 219-10 Irbid, (Jordan)
1995-10-01
In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m{sup 3} to 267 Bq/m{sup 3} with an average of 189 Bq/m{sup 3}. These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs.
Measurement of Rn-222 concentrations in building materials used in jordan
International Nuclear Information System (INIS)
Ismail, A.M.; Abumyrad, K.M.; Kullab, M.K.; Albataina, B.A.
1995-01-01
In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m 3 to 267 Bq/m 3 with an average of 189 Bq/m 3 . These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs
Reis, Rodrigo S; Hino, Adriano Akira F; Cruz, Danielle K; da Silva Filho, Lourival Espiridião; Malta, Deborah C; Domingues, Marlos R; Hallal, Pedro C
2014-01-01
The purpose of this study was to evaluate associations between exposure to the Exercise Orientation Service (EOS) program and physical activity (PA) and quality of life (QoL) in adults from Vitoria, Brazil. A phone survey was conducted with 2023 randomly selected participants (≥ 18 years) to measure awareness about the program, participation in the program, PA levels, and QoL. The associations were tested using Poisson and Linear regression models. 31.5% reported awareness about the program, 1.5% reported current participation, and 5.8% reported previous participation. Participation was higher among women (2.1%), older subjects (2.8%), and those reporting morbidities (2.4%). Awareness was higher among middle-aged persons (36.0%) and highly educated participants (37.1%). Current participation (PR = 2.22; 95% CI = 1.65-2.99) and awareness (PR = 1.15; 95% CI = 1.02-1.30) were associated with leisure-time PA (LTPA). Exposure to the program was not associated with QoL but was consistently associated with sufficient levels of LTPA among adults from Vitoria, Brazil.
A preliminary investigation of 222Rn and 220Rn levels in non-uranium mines in China
International Nuclear Information System (INIS)
Shang Bing; Cui Hongxing; Wu Yunyun; Zhang Qingzhao; Su Xu
2008-01-01
Objective: To measure levels of 222 Rn and 220 Rn in typical non-uranium mines, China, and to estimate dose from the occupational radon exposure in the miners. Methods: Using typical sampling scheme, 44 mines were selected in 12 provinces, which can be classified into 4 categories and 17 types of mines. The radon-thoron discriminative detectors were used to measure 222 Rn and 220 Rn concentrations in mines. Result: The concentration of 222 Rn or 220 Rn was log-normally distributed. The arithmetic mean (AM) concentration and geometric mean (GM) concentration of 222 Rn and 220 Rn in 25 metal mines (n=147) were estimated to be (1211 ±2359) Bq/m 3 (AM) and (311 ± 5.5) Bq/m 3 (GM), and (269 ±700) Bq/m 3 (AM) and (71 ± 4.4)Bq/m 3 (GM), respectively. The mean concentrations of 222 Rn and 220 Rn in 18 non-metal mines (n=118) were (98 ± 207) Bq/m 3 (AM) and(55 ± 2.5) Bq/m 3 (GM), and (60 ± 76) Bq/m 3 (AM) and (38 ± 2.4) Bq/m 3 (GM) respectively. In total, we measured 222 Rn concentration in 44 underground mines, 6 of them, accounted for 15%, with the mean radon concentration exceeding 1000 Bqm -3 (limit of workplace in China). Approximately 7% of radon concentration in mines measured were higher than 3700 Bq/m 3 (current limit in uranium mine in China), some points even exceeded 10 000 Bq/m 3 . Based on this typical measurements, the equilibrium factor for 222 Rn was estimated to be 0.33 ± 0.15 in underground mines and 0.47 ±0.18 in nearby houses. Equilibrium factor for 220 Rn ranged from 0.001 to 0.032. Using the data obtained in this typical survey, the average annual effective dose of underground miners exposed to radon and thoron was estimated to be 8.15 mSv/a. Conclusions: High levels of 222 Rn exists in metal mines, such as copper, tin, lead and zinc, gold, and aluminum mines among others. More study and administrative measures are needed to address the radiation protection of workers occupationally exposed to high radon in mines. (authors)
Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P M; Ekateriniadou, Loukia V; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi
2017-07-01
The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres seems to be formed nearly totally by the 222Q variant provides evidence that the 222K PrP variant confers resistance to conversion to PrPres formation and reinforces the view that this mutation has a protective role against classical scrapie in goats.
Sugar cane manufacturing is associated with tuberculosis in an indigenous population in Brazil.
Sacchi, Flávia Patussi Correia; Croda, Mariana Garcia; Estevan, Anderson Oliveira; Ko, Albert I; Croda, Julio
2013-03-01
Tuberculosis (TB) remains one of the leading causes of morbidity and mortality among indigenous peoples in Brazil, and identifying the risk factors for TB in this population secondary to specific epidemiological conditions is essential for recommending interventions aimed at disease control. This case-control study was conducted with an indigenous population between June 2009 and August 2011 in Dourados, Brazil. Tuberculosis cases reported to the national disease surveillance programme were paired with two control cases matched by age and geographic location. There were 63 cases included in this study, and the annual incidence of TB in the indigenous communities examined was 222 (95% CI, 148-321) per 100 000 inhabitants. The multivariate analysis demonstrated that the variables associated with TB infection included male gender (OR 2.6; 95% CI 1.3-5.3), not owning a home (OR 3.4; 95% CI 1.2-10.1), illiteracy (OR 2.4; 95% CI 1.1-5.0), TB contact (OR 2.4; 95% CI 1.2-4.8) and work performed in a sugar cane factory (OR 6.8; 95% CI 1.2-36.9). There is a potential relationship between exposure to sugar cane manufacturing processes and tuberculosis infection among indigenous populations.
Role of miR-222-3p in c-Src-Mediated Regulation of Osteoclastogenesis
Directory of Open Access Journals (Sweden)
Shinya Takigawa
2016-02-01
Full Text Available MicroRNAs (miRNAs are small non-coding RNAs that play a mostly post-transcriptional regulatory role in gene expression. Using RAW264.7 pre-osteoclast cells and genome-wide expression analysis, we identified a set of miRNAs that are involved in osteoclastogenesis. Based on in silico analysis, we specifically focused on miR-222-3p and evaluated its role in osteoclastogenesis. The results show that the inhibitor of miR-222-3p upregulated the mRNA levels of nuclear factor of activated T-cells, cytoplasmic 1 (NFATc1 and tartrate-resistant acid phosphatase (TRAP, while its mimicking agent downregulated their mRNA levels. Western blot analysis showed that its inhibitor increased the protein levels of TRAP and cathepsin K, while its mimicking agent decreased their levels. Genome-wide mRNA expression analysis in the presence and absence of receptor activator of nuclear factor κ-B ligand (RANKL predicted c-Src as a potential regulatory target of miR-222-3p. Live cell imaging using a fluorescence resonance energy transfer (FRET technique revealed that miR-222-3p acted as an inhibitor of c-Src activity, and a partial silencing of c-Src suppressed RANKL-induced expression of TRAP and cathepsin K, as well as the number of multi-nucleated osteoclasts and their pit formation. Collectively, the study herein demonstrates that miR-222-3p serves as an inhibitor of osteoclastogenesis and c-Src mediates its inhibition of cathepsin K and TRAP.
222Rn and 14CO2 concentrations in the surface layer of the atmosphere
International Nuclear Information System (INIS)
Holy, K.; Chudy, M.; Sivo, A.; Richtarikova, M.; Boehm, R.; Polaskova, A.; Vojtyla, P.; Bosa, I.; Hola, O.
2002-01-01
Long-term monitoring of the Δ 14 C in the atmospheric near-ground CO 2 has been realized in Bratislava and Zlkovce, situated near the nuclear power plant Jaslovske Bohunice. Until 1993, the monthly mean Δ 14 C values showed a high variability. The annual means of Δ 14 C were about 30 per mille higher at Zlkovce than in highly industrialised Bratislava. An important change in the behaviour of the 14 C data has occurred since 1993. The records from both stations show the similar course, mainly due to the fact that there do not occur deep winter minima in Bratislava. This behaviour corresponds to the lower values of the total fossil fuel CO 2 emissions in the years after 1993 when compared to the previous years. At present, both sets of data show that the 14 C concentration is about 10% above the natural level. Since 1987 also the 222 Rn concentration in the surface layer of the atmosphere has been measured in Bratislava. These measurements provided an extensive set of the 222 Rn data characteristic for the inland environment with high level of atmospheric pollution. The seasonal and daily variations of the 222 Rn concentration were observed. The investigation of the relation between the monthly mean diurnal courses of the 222 Rn concentration and the atmospheric stability proved a high correlation between them. The 222 Rn data were used to interpret the anomalous Δ 14 C values in the surface layer of the atmosphere. (author)
Use of 222Rn-resistant techniques in new home construction
International Nuclear Information System (INIS)
Watson, J.E. Jr.; Cote, R.A.
1999-01-01
The objective of this project was to assess the status of the use of 222 Rn-resistant construction techniques in new home construction in the eight Zone 1 counties of North Carolina. Zone 1 counties have an average predicted indoor 222 Rn screening potential greater than 148 Bq m -3 (4 pCi L -1 ). To facilitate a response from builders, a brief survey form was designed and printed on the back of a self-addressed, postage-paid postcard. This survey form was mailed to 460 home builders in the Zone 1 counties. The response rate was 17%, which can be compared to the 4.9% response rate obtained in a national survey conducted by the National Association of Home Builders Research Center. In their survey, 62% of the responding builders reported that they had built some or many homes in 1996 using construction techniques to reduce the entry of radon into homes, but only 10% of the builders reported using these techniques for many homes. The National Association of Home Builders survey determined that, nationally, 30% of homes built in Zone 1 counties had 222 Rn venting features. There is the potential for bias in the results of their survey (as well as in the results of the National Association of Home Builders survey) since the response rates were low
Dynamics of radon-222 near below ground surface
International Nuclear Information System (INIS)
Fukui, Masami; Katsurayama, Kousuke; Nishimura, Susumu.
1986-01-01
The concentrations and variation of 222 Rn were investigated both in unconfined groundwater and in the aerated zone to obtain information as to the behavior of Rn close to ground surface. The Rn concentrations in unconfined groundwater near the surface were depletive by the extent of about 50 % compared with that of lower part in a borehole, then the continuous extraction of groundwater causes pronounced increase of the concentration. The method, which monitors continuously the Rn concentration in such surroundings, was developed, where the unconfined groundwater extracted was injected into another borehole and sprayed gas was measured using an ionization chamber. The read-out values of this system well followed the variation of concentrations caused by the meteorological parameter, especially infiltrating water. The increase of 222 Rn concentration in the aerated zone above the water level was clearly observed following the ascendant of groundwater level caused by the infiltrating water, whereas the change of concentration in soil air just below the ground surface obeyed mainly to the wetness of soil and unconfined groundwater level rather than atmospheric pressure. (author)
Practical difficulties in determining 222Rn flux density in underground uranium mines
International Nuclear Information System (INIS)
Bigu, J.
1991-01-01
Radon-222 flux density, J, has been determined in a number of locations in an underground U mine. Measurements were conducted using the Two-Point Measurement (2PM) method, consisting of measuring the 222Rn concentration at two different points a distance apart within a given section of the mine. Several mine models were used for determining J by the above method. The 2PM method is sensitive to sources and sinks of 222Rn other than mine walls, as well as mining operations and mining activities of a diverse nature, and to local variations in airflow conditions. Because of this, J obtained by the 2PM method represents an 'apparent' flux density. Significant differences were found in the flux density calculated according to different mine models. In addition, J measurements using the flux 'can' method were also carried out in mine walls and compared with the values obtained by the 2PM method. Wide discrepancies between the two methods were found. The practical and theoretical difficulties in determining J are discussed
Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P. M.; Ekateriniadou, Loukia V.; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi
2017-01-01
The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres s...
48 CFR 52.222-50 - Combating Trafficking in Persons.
2010-10-01
....222-50 Combating Trafficking in Persons. As prescribed in 22.1705(a), insert the following clause...: ________ ________ ________ ________ ________ ________ [Contracting Officer shall insert title of directive/notice; indicate the document is attached or provide source (such as website link) for obtaining document; and, indicate the contract performance location...
Pinti, Daniele L; Retailleau, Sophie; Barnetche, Diogo; Moreira, Floriane; Moritz, Anja M; Larocque, Marie; Gélinas, Yves; Lefebvre, René; Hélie, Jean-François; Valadez, Arisai
2014-10-01
One hundred ninety-eight groundwater wells were sampled to measure the (222)Rn activity in the region between Montreal and Quebec City, eastern Canada. The aim of this study was to relate the spatial distribution of (222)Rn activity to the geology and the hydrogeology of the study area and to estimate the potential health risks associated with (222)Rn in the most populated area of the Province of Quebec. Most of the groundwater samples show low (222)Rn activities with a median value of 8.6 Bq/L. Ninety percent of samples show (222)Rn activity lower than 100 Bq/L, the exposure limit in groundwater recommended by the World Health Organization. A few higher (222)Rn activities (up to 310 Bq/L) have been measured in wells from the Appalachian Mountains and from the magmatic intrusion of Mont-Saint-Hilaire, known for its high level of indoor radon. The spatial distribution of (222)Rn activity seems to be related mainly to lithology differences between U-richer metasediments of the Appalachian Mountains and magmatic intrusions and the carbonaceous silty shales of the St. Lawrence Platform. Radon is slightly enriched in sodium-chlorine waters that evolved at contact with clay-rich formations. (226)Ra, the parent element of (222)Rn could be easily adsorbed on clays, creating a favorable environment for the production and release of (222)Rn into groundwater. The contribution of groundwater radon to indoor radon or by ingestion is minimal except for specific areas near Mont-Saint-Hilaire or in the Appalachian Mountains where this contribution could reach 45% of the total radioactive annual dose. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Homma, Y.; Murase, Y.; Handa, K.; Murakami, I.
1997-01-01
222 Rn in 2L-water samples was extracted with 30 mL toluene, and 21 mL of the toluene solution was transferred into a liquid scintillation vial, in which PPO - 2,5-diphenyloxazole was placed in advance. The total activity of 222 Rn in the water sample was calculated based on the Ostwald's coefficient of solubilities of 222 Rn in toluene and water at the temperature of the sample water and the volume of water and toluene. About 40% of 222 Rn dissolved in 2L-water sample can be collected. After allowing to stand for 3.5 h, the equilibrium mixture of 222 Rn and its daughters was measured with an Aloka liquid scintillation spectrometer using a modified integral counting method which extrapolates the integral counting curve not to the zero pulse-height, but to the zero detection threshold, an average energy required to produce a measurable pulse, of the liquid scintillation spectrometer. The general method which agitates water sample (usually about 10 mL) with a liquid scintillation cocktail is practical when the activity of 222 Rn is high. By adding 10 mL of water sample, however, it is possible also to add variable amounts of quencher. In some cases water sample is preserved with nitric acid. The slope of the integral counting rate curve increases as quench level of the sample increases. Therefore, it is clear that the modified integral counting method gives more accurate 222 Rn concentrations for water samples of strong quench than the conventional integral counting method. 222 Rn sample of 0.2 Bq/L can be determined within an overall uncertainty of 3.1%
Measurement of 222Rn, 220Rn and their decay products in high background radiation area in Yangjiang
International Nuclear Information System (INIS)
Yuan Yongling
2000-01-01
The investigators have measured concentrations of Rn-222, rn-220 and their decay products in high background radiation area (HBRA) and the neighboring control area (CA), as well as the equilibrium factor F for Rn-222. The average concentrations of Rn-222 in the air indoors and outdoors in the HBRA are 42.6 and 17.3 Bq/m 3 respectively, and CA, 13.2 and 11.7 Bq/m 3 , respectively. The average α-potential energy concentrations for daughters of Rn-222 indoors and outdoors in HBRA are 0.109 and 0.051 μJ/m 3 , CA, 0.045 and 0.041 μJ/m 3 , respectively. The average α-potential energy values for daughters of Rn-220 indoor and outdoor in HBRA are 0.249 and 0.053 μJ/m 3 , CA, 0.051 and 0.025 μJ/m 3 , respectively. With regard to equilibrium factor F for Rn-222, the authors have also measured 52 points of 10 hamlets in HBRA (indoor 31, outdoor 21), 9 points of 2 hamlets in CA (indoor 5, outdoor 4), respectively. These figures are 0.46, 0.53, 0.62 and 0.64, respectively
A 'delayed' counting method to determine indoor Rn-222 levels indirectly
Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G
2001-01-01
A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.
International Nuclear Information System (INIS)
Hess, C.T.; Casparius, R.E.; Norton, S.A.; Brutsaert, W.F.
1980-01-01
We have used an inexpensive radon ( 222 Rn) measurement method using liquid scintillation counting to remeasure potable water from 10 sites near Raymond, Maine, to determine the accuracy and reproducibility of earlier measurements. Duplication or triplication of samples shows a high degree of reproducibility for the liquid scintillation method. A hypothesis emerged from analysis of the measured values of 222 Rn near Raymond, Maine, that high values (50,000 to 200,000 pCi/liter) are associated with granite. This was shown to be correct for several large areas of granite such as the Sebago, Lucern, Waldo, and Waldoboro granites. The presence of high 222 Rn concentrations in granite areas hundreds of kilometers from the Raymond area shows that the high 222 Rn levels in water are a statewide and perhaps a regional problem rather than a western Maine problem
20 CFR 222.36 - Relationship as grandchild or stepgrandchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as grandchild or stepgrandchild... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.36 Relationship as grandchild or stepgrandchild. A claimant will have the relationship of grandchild or stepgrandchild of an employee, or the...
Directory of Open Access Journals (Sweden)
Nora Seidel
Full Text Available The amino acid substitution of aspartic acid to glycine in hemagglutinin (HA in position 222 (HA-D222G as well as HA-222D/G polymorphism of pandemic (H1N1 2009 influenza viruses (A(H1N1pdm09 were frequently reported in severe influenza in humans and mice. Their impact on viral pathogenicity and the course of influenza has been discussed controversially and the underlying mechanism remained unclarified. In the present study, BALB/c mice, infected with the once mouse lung- and cell-passaged A(H1N1pdm09 isolate A/Jena/5258/09 (mpJena/5258, developed severe pneumonia. From day 2 to 3 or 4 post infection (p.i. symptoms (body weight loss and clinical score continuously worsened. After a short disease stagnation or even recovery phase in most mice, severity of disease further increased on days 6 and 7 p.i. Thereafter, surviving mice recovered. A 45 times higher virus titer maximum in the lung than in the trachea on day 2 p.i. and significantly higher tracheal virus titers compared to lung on day 6 p.i. indicated changes in the organ tropism during infection. Sequence analysis revealed an HA-222D/G polymorphism. HA-D222 and HA-G222 variants co-circulated in lung and trachea. Whereas, HA-D222 variant predominated in the lung, HA-G222 became the major variant in the trachea after day 4 p.i. This was accompanied by lower neutralizing antibody titers and broader receptor recognition including terminal sialic acid α-2,3-linked galactose, which is abundant on mouse trachea epithelial cells. Plaque-purified HA-G222-mpJena/5258 virus induced severe influenza with maximum symptom on day 6 p.i. These results demonstrated for the first time that HA-222D/G quasispecies of A(H1N1pdm09 caused severe biphasic influenza because of fast viral intra-host evolution, which enabled partial antibody escape and minor changes in receptor binding.
Keramati, Hassan; Ghorbani, Raheb; Fakhri, Yadolah; Mousavi Khaneghah, Amin; Conti, Gea Oliveri; Ferrante, Margherita; Ghaderpoori, Mansour; Taghavi, Mahmoud; Baninameh, Zahra; Bay, Abotaleb; Golaki, Mohammad; Moradi, Bigard
2018-03-30
The current study was performed to review the conducted studies regarding the concentration of radon 222 in the tap drinking water; furthermore, by estimation of ingestion and inhalation effective dose, the health risk assessment in the adults and children using MCS technique was assessed. All related studies published among January 1990 to October 2016; were screened in the available databases such as Web of Science, PubMed, Science Direct, Scopus, SID, and Irandoc. The total effective dose was estimated by calculating E ing (Effective dose of ingestion) and E inh (Effective dose of inhalation) by Monte Carlo simulation (MCS) method. The range of ND ─ 40.9 Bq/L for radon 222 in water resources was proposed after evaluation of data collected from 13 studies with 1079 samples. The overall concentration of radon 222 in drinking water in Iran was 3.98: 95%CI (3.79 ─ 4.17 Bq/L). Also, the effective ingestion dose of radon 222 in adults age groups was 1.35 times higher than children. The rank order of drinking water resources based on the concentration of radon 222 was Spring > Spring and Well > Well > Spring and Qanat > Tap water. The overall concentration of radon 222 in drinking water in Iran was lower than WHO and EPA standard limits. Also, the rank order regarding area studied based on the concentration of radon 222 was Gillan > Mashhad > Mazandaran > Kerman > Yazd > Tehran > Kermanshah > Golestan > Hormozgan. The effective ingestion dose of radon 222 to consumers in the Gillan, Mashhad, Mazandaran, and Kerman were higher than WHO guidance (0.1 mSv/y). Also except consumers in the Hormozgan, inhalation effective dose radon 222, in the other investigated areas were higher than WHO guidance (0.1 mSv/y). Therefore, it is recommended to conduct the required programs regarding control and elimination of radon 222 concentration in Iranian drinking water supply. Copyright © 2018 Elsevier Ltd. All rights reserved.
Ethnicity and cutaneous melanoma in the city of Sao Paulo, Brazil: a case-control study.
Directory of Open Access Journals (Sweden)
Olinda C Luiz
Full Text Available BACKGROUND: Over the last century the incidence of cutaneous melanoma has increased worldwide, a trend that has also been observed in Brazil. The identified risk factors for melanoma include the pattern of sun exposure, family history, and certain phenotypic features. In addition, the incidence of melanoma might be influenced by ethnicity. Like many countries, Brazil has high immigration rates and consequently a heterogeneous population. However, Brazil is unique among such countries in that the ethnic heterogeneity of its population is primarily attributable to admixture. This study aimed to evaluate the contribution of European ethnicity to the risk of cutaneous melanoma in Brazil. METHODOLOGY/PRINCIPAL FINDINGS: We carried out a hospital-based case-control study in the metropolitan area of Sao Paulo, Brazil. We evaluated 424 hospitalized patients (202 melanoma patients and 222 control patients regarding phenotypic features, sun exposure, and number of grandparents born in Europe. Through multivariate logistic regression analysis, we found the following variables to be independently associated with melanoma: grandparents born in Europe-Spain (OR = 3.01, 95% CI: 1.03-8.77, Italy (OR = 3.47, 95% CI: 1.41-8.57, a Germanic/Slavic country (OR = 3.06, 95% CI: 1.05-8.93, or ≥ 2 European countries (OR = 2.82, 95% CI: 1.06-7.47; eye color-light brown (OR = 1.99, 95% CI: 1.14-3.84 and green/blue (OR = 4.62; 95% CI 2.22-9.58; pigmented lesion removal (OR = 3.78; 95% CI: 2.21-6.49; no lifetime sunscreen use (OR = 3.08; 95% CI: 1.03-9.22; and lifetime severe sunburn (OR = 1.81; 95% CI: 1.03-3.19. CONCLUSIONS: Our results indicate that European ancestry is a risk factor for cutaneous melanoma. Such risk appears to be related not only to skin type, eye color, and tanning capacity but also to others specific characteristics of European populations introduced in the New World by European immigrants.
Variations in radon-222 in soil and ground water at the Nevada Test Site
International Nuclear Information System (INIS)
Wollenberg, H.; Straume, T.; Smith, A.; King, C.Y.
1977-01-01
To help evaluate the applicability of variations of radon-222 in ground water and soil gas as a possible earthquake predictor, measurements were conducted in conjunction with underground explosions at the Nevada Test Site (NTS). Radon fluctuations in ground water have been observed during a sequence of aftershocks following the Oroville, California earthquake of 1 August 1975. The NTS measurements were designed to show if these fluctuations were in response to ground shaking; if not, they could be attributed to changes in earth strain prior to the aftershocks. Well waters were periodically sampled and soil-gas 222 Rn monitored prior to and following seven underground explosions of varying strength and distance from sampling and detector locations. Soil-gas 222 Rn contents were measured by the alpha-track method; well water 222 Rn by gamma-ray spectrometry. There was no clearly identifiable correlation between well-water radon fluctuations and individual underground tests. One prominent variation in soil-gas radon corresponded to ground shaking from a pair of underground tests in alluvium; otherwise, there was no apparent correlation between radon emanation and other explosions. Markedly lower soil-gas radon contents following the tests were probably caused by consolidation of alluvium in response to ground shaking
Li, Yanhua; Gu, Junjiao; Lu, Hong
2017-12-01
Several lines of evidence have indicated that growth arrest-specific transcript 5 (GAS5) functions as a tumor suppressor and is aberrantly expressed in multiple cancers. GAS5 was found to be downregulated in gastric cancer (GC) tissues, and ectopic expression of GAS5 inhibited GC cell proliferation. The present study aimed to explore the underlying mechanisms of GAS5 involved in GC cell proliferation. GAS5 and miR-222 expressions in GC cell lines were estimated by quantitative real-time polymerase chain reaction. The effects of GAS5 and miR-222 on GC cell proliferation were assessed by MTT assay and 5-bromo-2-deoxyuridine (BrdU) incorporation assays. The interaction between GAS5 and miR-222 was confirmed by luciferase reporter assay and RNA immunoprecipitation assay. The protein levels of the phosphatase and tensin homolog (PTEN), phosphorylated protein kinase B (Akt) (p-Akt), Akt, phosphorylated mammalian target of rapamycin (mTOR) (p-mTOR), and mTOR were determined by western blot. GAS5 was downregulated and miR-222 was upregulated in GC cells. GAS5 directly targeted and suppressed miR-222 expression. GAS5 overexpression and miR-222 inhibition suppressed cell proliferation, increased PTEN protein level and decreased p-Akt and p-mTOR protein levels in GC cells while GAS5 knockdown and miR-222 overexpression exhibited the opposite effects. Moreover, mechanistic analyses revealed that GAS5 regulated GC cell proliferation through the PTEN/Akt/mTOR pathway by negatively regulating miR-222. GAS5/miR-222 axis regulated proliferation of GC cells through the PTEN/Akt/mTOR pathway, which facilitated the development of lncRNA-directed therapy against this deadly disease.
Kinetics of ingested 222Rn in humans determined from measurements with 133Xe. Project summary report
International Nuclear Information System (INIS)
Correia, J.A.; Weise, S.B.; Callahan, R.J.; Strauss, H.W.
1987-12-01
The problem of naturally occurring 222-radon contamination has received a great deal of public and scientific attention over the past several years, and has become a major public health issue worldwide. The purpose of the work reported in this document was to provide information about the behavior of ingested 222-radon in the digestive system and other organs of the human body. 133-Xenon, an element which behaves in the same manner as 222-radon in tissue and differs only in tissue solubility, was used in studies on human subjects. The tissue solubility differences were accounted for by using the tissue/blood partition coefficients of the two gases
Hanford Facility Dangerous Waste Permit Application, 222-S Laboratory Complex
International Nuclear Information System (INIS)
WILLIAMS, J.F.
2000-01-01
The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating treatment, storage, and/or disposal units, such as the 222-S Laboratory Complex (this document, DOE/RL-91-27). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needs defined by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the 222-S Laboratory Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this 222-S Laboratory Complex permit application documentation is current as of August 2000
Tracing submarine groundwater discharge in the NE Gulf of Mexico by 222Rn
International Nuclear Information System (INIS)
Young, J.E.; Burnett, W.C.; Chanton, J.P.; Cable, P.H.; Corbett, D.R.
1993-01-01
Inputs of freshwater and dissolved components to the ocean by submarine groundwater discharge (SGD) have been largely neglected as source functions for biogeochemical budgets. In order to locate and quantify groundwater inputs, a tracing technique has been developed using 222 Rn, a member of the natural 238 U decay-series. Because 222 Rn has a short half-life (t 1/2 = 3.84 days), is an inert gas, is relatively easy to measure at low concentrations, and has concentrations in groundwater several orders of magnitude greater than seawater, it should make an excellent tracer. Excess 222 Rn concentrations far above ''normal'' ocean values were found in the bottom waters of the northeastern Gulf of Mexico, which suggests this region has significant groundwater discharge. After measuring high water column inventories of excess 222 Rn in this region, an advection/diffusion model was applied to evaluate potential benthic sources of radon. The model is designed to account for sediment diffusion of radon and includes a groundwater term for advective flow into the overlying water. Flow rates and concentrations are adjusted in the model to balance the large difference in the measured water column inventories and the inventory predicted by sediment diffusion alone. The vertical diffusive/advective transport determines the shape of the concentration gradient and fluxes at the sediment-water interface are calculate based on these terms. The authors work shows that SGD could account for as much as 95% of the radon inventory in these offshore waters
International Nuclear Information System (INIS)
Sharman, G.
1992-01-01
Rn-222 enters dwellings as a component of soil gas drawn from the soil by mass flow driven by the pressure difference between the house and soil beneath. In a site on Northampton Sand Ironstone (Aalenian), a preferred path of emanation (hotspot) was found. A difference of 63 Bq L -1 Rn-222 was recorded in July between this point and another 3 m away. Rn-222 in this hotspot shows 12% less variation annually than the surrounding rock. During winter, Rn-222 values within 1.6 m of the house were 44% lower than those at more than 4 m away. Rn-222 showed a 99.5% negative correlation with wind run, showing that on this soil wind pressure can significantly reduce radon in the soil at 500 mm depth. Rn-220 in soil gas correlated positively at the 99.5% level with grass and air temperatures. Rn-220 was not associated with the hotspot. (Author)
Design and construction of a system to analyze Radon 222 by means of alpha spectroscopy
International Nuclear Information System (INIS)
Martinez, J.B.
1991-01-01
Design and construction of a system to measure gaseous Radon 222 which arise from a source of Radium 226 electrodeposited in a stainless disc is described. Such a system allows to differentiate the energies of radium where they come from, as well as energies of daughter products. In this way it is possible to have a more precise measure of the alpha activity of this isotope. The system was constructed in a stainless steel hermetic container made of the camera, a cape and a valve, the used sample was a standards of Radium 226 attained from carnotite ore. The Radon 222 alpha particles, as well as the alpha particles of its decay products namely Polonium 210. Polonium 218 and Polonium 214 were identified by a surface barrier detector. The results in this manner obtained shows clearly well definite peaks of Radon 222 and also peaks of the Radon 222 daughter products with energies of 5.43, 5.31, 6.0 and 7.69 Mev respectively. The system allows to separate and to indentify the energies of Radon and its daughter products coming directly from a standard solid sample of Radium 226 (Author)
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement. 222.54 Section 222.54 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and...
48 CFR 52.222-8 - Payrolls and Basic Records.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Payrolls and Basic Records....222-8 Payrolls and Basic Records. As prescribed in 22.407(a), insert the following clause: Payment for Overtime Premiums (JUN 2010) (a) Payrolls and basic records relating thereto shall be maintained by the...
Occurrence of 222Rn and progeny in natural gas processing plants in western Canada
International Nuclear Information System (INIS)
Drummond, I.; Boucher, P.; Bradford, B.; Evans, H.; McLean, J.; Reczek, E.; Thunem, H.
1990-01-01
In Western Canada, there are many plants that process natural gas to remove impurities (CO 2 , H 2 S, H 2 O) and recover natural gas liquids (propane, butane, etc.). Trace quantities of 222 Rn present in the inlet stream are concentrated in streams rich with propane. Potential hazards to plant operators include direct inhalation of 222 Rn and progeny; exposure to gamma radiation from short-lived progeny deposited inside equipment; or inhalation of 210 Pb when contaminated equipment is opened for repair. Twenty-four plants operated by seven companies cooperated to assess these potential hazards. The findings indicate a substantial flux of 222 Rn and progeny passing through the plants, but little accumulation of radionuclides. In no case was there evidence of significant exposure of plant operators or maintenance personnel to ionizing radiation. Further investigation of pipeline operations, and chemical operations using natural gas liquids as feed stock, is recommended
A multi-detector continuous monitor for assessment of 222Rn in the coastal ocean
International Nuclear Information System (INIS)
Dulaiova, H.; Peterson, R.; Burnett, W.C.
2005-01-01
Radon-222 is a good natural tracer of groundwater discharge and other physical processes in the coastal ocean. Unfortunately, its usefulness is limited by the time consuming nature of collecting individual samples and traditional analysis schemes. An automated multi-detector system is demonstrated that can be used in a continuous survey basis to assess radon activities in coastal ocean waters. The system analyses 222 Rn from a constant stream of water delivered by a submersible pump to an air-water exchanger where radon in the water phase equilibrates with radon in a closed air loop. The air stream is fed to 3 commercial radon-in-air monitors connected in parallel to determine the activity of 222 Rn. By running the detectors out of phase, it is possible to obtain as many as 6 readings per hour with a precision of approximately ±5-15% for typical coastal seawater concentrations. (author)
222-S Laboratory Quality Assurance Plan. Revision 1
International Nuclear Information System (INIS)
Meznarich, H.K.
1995-01-01
This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document
Thoron (RN-220) interference in the determination of RN-222 exhalation rate of soils
Energy Technology Data Exchange (ETDEWEB)
Amaral, Déric S.; Farias, Emerson E.G.; Santos, Mariana L.O.; Silva, Karolayne E.M.; Hazin, Clovis A.; França, Elvis J., E-mail: emersonemiliano@yahoo.com [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, João A., E-mail: adauto@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Geologia
2017-07-01
The transport of Rn-222 from the soil to the atmosphere known as exhalation is influenced by meteorological conditions and soil geophysical parameters. In closed and poorly ventilated rooms, this radioactive gas can reach high activity concentrations, in which the energy of alpha particles released by this radionuclide and its progeny is the second leading cause of lung cancer. Soil exhalation rate is an important parameter for assessing human health risks associated with radon. For radon determination using an exhalation chamber, an ionization chamber detector is used to count the electrical pulses generated by the interaction between the alpha particles produced by Rn-222 and its progeny and the air inside the chamber. In this work, the interference of thoron (Rn-220) in the determination of soil exhalation rate of Rn-222 was studied. For this, the RadonBOX exhalation chamber and the AlphaGuard ionization chamber detector were utilized for analyzing the same soil during two hours on different days under similar meteorological conditions. From zero up to approximately 2,400 s, the radon activity concentrations decreased. After 40 minutes, the radon concentrations started to increase, thereby allowing the calculation of soil exhalation rate. This initial decreasing could be explained by a high Rn-220 than Rn-222 presence in the soil, in which, because of its short half-life, after 40 minutes, most thoron present in the chamber has undergone so that the main alpha emitter become Rn-222. In order to confirm this, Rn-220 activity was estimated by the Ra-228 concentration in the soil determined after 30 days using High Resolution Gamma-Ray Spectrometry with HPGe detectors. Therefore, the thoron interference in the determination of soil radon exhalation rate was considered negligible after 40 minutes of measurement time for the analyzed soil. (author)
2010-10-01
... Safety Standards Act-nursing home care contract supplement. 852.222-70 Section 852.222-70 Federal...—nursing home care contract supplement. As prescribed in 822.305, for nursing home care requirements, insert the following clause: Contract Work Hours and Safety Standards Act—Nursing Home Care Contract...
International Nuclear Information System (INIS)
Song Gang; Wang Xinming; Chen Diyun; Chen Yongheng
2011-01-01
This study investigates the contribution of radon ( 222 Rn)-bearing water to indoor 222 Rn in thermal baths. The 222 Rn concentrations in air were monitored in the bathroom and the bedroom. Particulate matter (PM, both PM 10 and PM 2.5 ) and carbon dioxide (CO 2 ) were also monitored with portable analyzers. The bathrooms were supplied with hot spring water containing 66-260 kBq m -3 of 222 Rn. The results show that the spray of hot spring water from the bath spouts is the dominant mechanism by which 222 Rn is released into the air of the bathroom, and then it diffuses into the bedroom. Average 222 Rn level was 110-410% higher in the bedrooms and 510-1200% higher in the bathrooms compared to the corresponding average levels when there was no use of hot spring water. The indoor 222 Rn levels were influenced by the 222 Rn concentrations in the hot spring water and the bathing times. The average 222 Rn transfer coefficients from water to air were 6.2 x 10 -4 -4.1 x 10 -3 . The 24-h average levels of CO 2 and PM 10 in the hotel rooms were 89% and 22% higher than the present Indoor Air Quality (IAQ) standard of China. The main particle pollutant in the hotel rooms was PM 2.5 . Radon and PM 10 levels in some hotel rooms were at much higher concentrations than guideline levels, and thus the potential health risks to tourists and especially to the hotel workers should be of great concern, and measures should be taken to lower inhalation exposure to these air pollutants. - Highlights: → 222 Rn-bearing water is the main contributor to indoor radon in hot spring hotel. → The PM 2.5 and CO 2 are also the main indoor pollutants in the hotel rooms. → Higher radon and PM levels might have significant negative health effects to human. → The radon transfer coefficients are consistent with the published data.
12 CFR 222.28 - Effective date, compliance date, and prospective application.
2010-01-01
... GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.28... using eligibility information that you receive from an affiliate to make solicitations to a consumer if...
48 CFR 52.222-16 - Approval of Wage Rates.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Approval of Wage Rates. 52....222-16 Approval of Wage Rates. As prescribed in 22.407(b), insert the following clause: Approval of Wage Rates (FEB 1988) All straight time wage rates, and overtime rates based thereon, for laborers and...
12 CFR 222.26 - Delivery of opt-out notices.
2010-01-01
... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.26 Delivery of opt-out notices. (a... the affiliate providing the notice; or (4) Posts the notice on the Internet Web site at which the... affiliate providing the notice; or (3) Posts the notice on an Internet Web site without requiring the...
Time series analysis of soil Radon-222 recorded at Kutch region, Gujarat, India
International Nuclear Information System (INIS)
Madhusudan Rao, K.; Rastogi, B.K.; Barman, Chiranjib; Chaudhuri, Hirok
2013-01-01
Kutch region in Gujarat lies in a seismic vulnerable zone (seismic zone-v). After the devastating Bhuj earthquake (7.7M) of January 26, 2001 in the Kutch region several researcher focused their attention to monitor geophysical and geochemical precursors for earthquakes in the region. In order to find out the possible geochemical precursory signals for earthquake events, we monitored radioactive gas radon-222 in sub surface soil gas at Kutch region. We have analysed the recorded soil radon-222 time series by means of nonlinear techniques such as FFT power spectral analysis, empirical mode decomposition, multi-fractal analysis along with other linear statistical methods. Some fascinating and fruitful results originated out the nonlinear analysis of the said time series have been discussed in the present paper. The entire analytical method aided us to recognize the nature and pattern of soil radon-222 emanation process. Moreover the recording and statistical and non-linear analysis of soil radon data at Kutch region will assist us to understand the preparation phase of an imminent seismic event in the region. (author)
International Nuclear Information System (INIS)
Swindon, T.N.
1978-10-01
Radon-222 sources have been used in Australia for the treatment of patients since 1929 and the calculation of absorbed doses from such sources is well established. An alternative to radon-222 is gold-198 which, in suitable form, may be used for permanent implantations and for surface, interstitial or intra-cavitary applications. Because radon-222 and gold-198 have different characteristics, the data to be used in calculating the absorbed dose to a point in a treatment volume will depend on the particular source used. The data are related to the energies and abundances of the beta and gamma rays emitted from the nuclei and on their half-lives (Tsub(1/2)). The energies of the beta and gamma rays emitted by radon-222 (in equilibrium with its decay products) and by gold-198 are given
Song, Gang; Wang, Xinming; Chen, Diyun; Chen, Yongheng
2011-04-01
This study investigates the contribution of radon ((222)Rn)-bearing water to indoor (222)Rn in thermal baths. The (222)Rn concentrations in air were monitored in the bathroom and the bedroom. Particulate matter (PM, both PM(10) and PM(2.5)) and carbon dioxide (CO(2)) were also monitored with portable analyzers. The bathrooms were supplied with hot spring water containing 66-260 kBq m(-3) of (222)Rn. The results show that the spray of hot spring water from the bath spouts is the dominant mechanism by which (222)Rn is released into the air of the bathroom, and then it diffuses into the bedroom. Average (222)Rn level was 110-410% higher in the bedrooms and 510-1200% higher in the bathrooms compared to the corresponding average levels when there was no use of hot spring water. The indoor (222)Rn levels were influenced by the (222)Rn concentrations in the hot spring water and the bathing times. The average (222)Rn transfer coefficients from water to air were 6.2 × 10(-4)-4.1 × 10(-3). The 24-h average levels of CO(2) and PM(10) in the hotel rooms were 89% and 22% higher than the present Indoor Air Quality (IAQ) standard of China. The main particle pollutant in the hotel rooms was PM(2.5). Radon and PM(10) levels in some hotel rooms were at much higher concentrations than guideline levels, and thus the potential health risks to tourists and especially to the hotel workers should be of great concern, and measures should be taken to lower inhalation exposure to these air pollutants. Copyright © 2011 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Márta Palkó
2011-09-01
Full Text Available all-endo-3-amino-5-hydroxybicyclo[2.2.2]octane-2-carboxylic acid (13 and all-endo-5-amino-6-(hydroxymethylbicyclo[2.2.2]octan-2-ol (10 were prepared via dihydro-1,3-oxazine or g-lactone intermediates by the stereoselective functionalization of an N-protected derivative of endo-3-aminobicyclo[2.2.2]oct-5-ene-2-carboxylic acid (2. Ring closure of b-amino ester 4 resulted in tricyclic pyrimidinones 15 and 16. The structures, stereochemistry and relative configurations of the synthesized compounds were determined by IR and NMR.
Energy Technology Data Exchange (ETDEWEB)
Gerard, J.; Van Hove, L. [S.A. Metallurgie et Mecanique Nucleaires Dessel (Belgium)
1965-09-15
exact de la teneur en {sup 235}U. En conclusion, on montre que la mesure de la teneur en uranium doit se faire en plusieurs etapes faisant intervenir toutes les ressources de methodes relativement simples. On indique la valeur et les limites de chaque etape. Le choix des etalons est base sur l'examen de cliches radiographiques. La mesure de leur teneur exacte en {sup 235}U est effectuee grace a des analyses chimiques et isotopiques. Le controle en cadence industrielle est realise par mesure de densite de l'alliage ou par comptage de l'emission gamma de {sup 235}U. La precision des deux methodes est comparable ({+-} 0,5% relatif). Au point de vue economique, on en arrive a recommander la determination de la teneur par comptage gamma chaque fois qu'une grande serie d'examens est necessaire sur des pieces de forme determinee. Ce sujet a deja ete traite. Le memoire relate et discute les resultats d'une experience industrielle. (author) [Spanish] Muchos reactores para ensayo de materiales utilizan como combustible una aleacion de aluminio y de uranio enriquecido. Es necesario conocer con precision la cantidad de uranio-235 contenida en cada elemento combustible. Los procedimientos utilizados para esa determinacion son en principio sencillos y ademas variados; pueden citarse los siguientes: la medicion de la densidad de la aleacion, el recuento de la emision gamma del uranio- 234, el analisis quimico, la determinacion del contenido isotopico y la evaluacion del ennegrecimiento de una placa radiografica. Por desgracia cada uno de esos metodos ofrece inconvenientes mas o menos graves cuando se los utiliza para controlar una produccion importante. La medicion de la densidad de la aleacion por el metodo de Arquimedes da resultados bastante precisos cuando se procede con cautela y cuando se conoce con exactitud la densidad de los metales que constituyen la aleacion. Ahora bien, las condiciones en que se realiza la operacion hacen que el metodo sea algo lento. Ademas, es necesario
International Nuclear Information System (INIS)
Rabi, Jose A.; Mohamad, Abdulmajeed A.
2004-01-01
Radon-222 is a radionuclide exhaled from phosphogypsum by-produced at phosphate fertilizer industries. Alternative large-scale application of this waste may indicate a material substitute for civil engineering provided that environmental issues concerning its disposal and management are overcome. The first part of this paper outlines a steady-state two-dimensional model for 222 Rn transport through porous media, inside which emanation (source term) and decay (sink term) exist. Boussinesq approach is evoked for the laminar buoyancy-driven interstitial air flow, which is also modeled according to Darcy-Brinkman formulation. In order to account for simultaneous effects of entailed physical parameters, governing equations are cast into dimensionless form. Apart from usual controlling parameters like Reynolds, Prandtl, Schmidt, Grashof and Darcy numbers, three unconventional dimensionless groups are put forward. Having in mind 222 Rn transport in phosphogypsum-bearing porous media, the physical meaning of those newly introduced parameters and representative values for the involved physical parameters are presented. A limiting diffusion-dominated scenario is addressed, for which an analytical solution is deduced for boundary conditions including an impermeable phosphogypsum stack base and a non-zero fixed concentration activity at the stack top. Accordingly, an expression for the average Sherwood number corresponding to the normalized 222 Rn exhalation rate is presented
Energy Technology Data Exchange (ETDEWEB)
Cazula, Camila Dias
2015-07-01
Exposure of the general population to ionizing radiation comes mainly from natural sources. The main contribution is due to inhalation of radon (Rn-222), a gas that occurs naturally (UNSCEAR, 2000). The Rn-222 concentration in the environment is controlled by factors such as soil permeability and water content, the weather variability, materials used in the foundation and the usual positive pressure differential between the soil and the internal environment. Studies indicate that the concentration of radon shows a wide variation in the basement, ground floor and upper floors of buildings. The objective of this study is to determine radon levels in basements, ground floor and floors above ground level, at a university in the city of Sao Paulo and in one residential building in the city of Peruibe. Rn-222 measurements were performed using the method with nuclear track of solid state detectors (CR-39). The studied environments present Rn-222 concentration well below the values recommended by the International Commission on Radiological Protection, published in the 2009 document, of 300 Bq/m{sup 3} for homes and 1000 Bq/m{sup 3} for the workplace. In the residential building, the concentration of Ra-266, Th-232 and K-40 in the materials used in the building construction was also analyzed, by gamma spectrometry. The effective total dose for the resident due to external exposure was 0.8 mSv y{sup -1}, lower than the annual dose limit for the general public of 1 mSv y{sup -1}. (author)
Evaluation of the external exposure to Rn-222 progeny in air
International Nuclear Information System (INIS)
Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmed, A.A.
2003-01-01
The aim of this paper is to evaluate the Rn-222 progeny annual effective dose, skin dose and effective doses to different organs such as Gonad, Lung, Red Marrow, Bone surface, Thyroid, and the Remainder. Dose Coefficients of external exposure to Rn-222 in air was used in mSv s/Bqm -3 to calculate the organ doses. The study was monitored for two places, Nuclear Research Center and Al-Minia University. We have confirmed that the inhalation modes, sleep, sitting, light and heavy exercise influence the activity inhalation rate Bq/hr. It varies from 0.3 to 39.6 Bq/hr., the organ doses of Pb-214 is higher than Bi-214/Po-214 and Po-218 respectively in the case of the organ dose relative to environmental media
The correlation between exhalation from rocks and indoor concentration of 222Rn in the Sydney area
International Nuclear Information System (INIS)
MCKenzie, D.R.; Lenzen, M.; Solomon, S.B.
2001-01-01
The results of a survey of indoor 222 Rn concentrations of 350 dwellings in the Sydney area are combined with measurements of 222 Rn exhalation rates of principal rock types in the survey area. A linear regression is predicted which yields a positive regression coefficient of b=2.4±0.3, a constant of a=3.4±0.5, and a correlation coefficient of R 2 =0.15. This correlation was found to be highly significant by using three different statistical tests. The ratio of the indoor 222 Rn concentrations in dwellings built on the two dominant rock types, the Wianamatta Shale and the Hawkesbury Sandstone, was found to be about 1.6. Copyright (2001) Australasian Radiation Protection Society Inc
12 CFR 222.22 - Scope and duration of opt-out.
2010-01-01
... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.22 Scope and duration of opt-out.... (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship... connection with— (A) A single continuing relationship or multiple continuing relationships that the consumer...
Directory of Open Access Journals (Sweden)
Carlana Ramlochansingh
Full Text Available Anesthetics are drugs that reversibly relieve pain, decrease body movements and suppress neuronal activity. Most drugs only cover one of these effects; for instance, analgesics relieve pain but fail to block primary fiber responses to noxious stimuli. Alternately, paralytic drugs block synaptic transmission at neuromuscular junctions, thereby effectively paralyzing skeletal muscles. Thus, both analgesics and paralytics each accomplish one effect, but fail to singularly account for all three. Tricaine methanesulfonate (MS-222 is structurally similar to benzocaine, a typical anesthetic for anamniote vertebrates, but contains a sulfate moiety rendering this drug more hydrophilic. MS-222 is used as anesthetic in poikilothermic animals such as fish and amphibians. However, it is often argued that MS-222 is only a hypnotic drug and its ability to block neural activity has been questioned. This prompted us to evaluate the potency and dynamics of MS-222-induced effects on neuronal firing of sensory and motor nerves alongside a defined motor behavior in semi-intact in vitro preparations of Xenopus laevis tadpoles. Electrophysiological recordings of extraocular motor discharge and both spontaneous and evoked mechanosensory nerve activity were measured before, during and after administration of MS-222, then compared to benzocaine and a known paralytic, pancuronium. Both MS-222 and benzocaine, but not pancuronium caused a dose-dependent, reversible blockade of extraocular motor and sensory nerve activity. These results indicate that MS-222 as benzocaine blocks the activity of both sensory and motor nerves compatible with the mechanistic action of effective anesthetics, indicating that both caine-derivates are effective as single-drug anesthetics for surgical interventions in anamniotes.
Energy Technology Data Exchange (ETDEWEB)
Bonifacio M, J [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)
1992-12-31
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
Energy Technology Data Exchange (ETDEWEB)
Bonifacio M, J. [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)
1991-12-31
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
Nitrogen heteroaromatic cations by [2+2+2] cycloaddition
Czech Academy of Sciences Publication Activity Database
Čížková, Martina; Kolivoška, Viliam; Císařová, I.; Šaman, David; Pospíšil, Lubomír; Teplý, Filip
2011-01-01
Roč. 9, č. 2 (2011), s. 450-462 ISSN 1477-0520 R&D Projects: GA ČR GA203/09/1614; GA ČR GA203/09/0705; GA MŠk OC 140 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z40400503 Keywords : modular synthesis * N-heteroaromatic cation * [2+2+2] cycloaddition Subject RIV: CC - Organic Chemistry Impact factor: 3.696, year: 2011
Energy Technology Data Exchange (ETDEWEB)
Perez, R; Germanier, A; Rubio, M [CEPROCOR, Cordoba (Argentina); Sbarato, D; Zappino, R [Observatorio Ambiental de la Municipalidad de Cordoba, Cordoba (Argentina)
1998-07-01
Full text: In this work measurements of the Radon ({sup 222}Rn) concentration in the inside of historical buildings which date back to the end of the 17th and the beginning of the 18th Centuries have been carried out in the city of Cordoba (Argentina). Meteorological factors such as room temperature and atmospheric pressure have not shown to affect, to a great extent, the results obtained. By comparing the concentration of {sup 222}Rn in environments at different levels we inferred that the soil underlying the buildings does not represent an important source of {sup 222}Rn. The main occurrence of the element was found in room walls, which shows that local building materials are an important source of {sup 222}Rn. Among the materials used in these buildings are granitic rocks, and to a lesser extent, lime, sand and marble. The {sup 222}Rn concentrations recorded in some of the rooms surveyed reach values which are close to the minimum intervene level set by international standards in 4pCi/l. The study of the effects of ventilation in the concentration of {sup 222}Rn allows us to conclude that its values decrease to accepted levels by means of a natural and efficient ventilation of the rooms. (author) [Spanish] Texto completo: En este trabajo se han realizado mediciones de la concentracion de radon (radon 222) en el interior de edificios de la ciudad de Cordoba que datan de finales del siglo XVII y comienzos del siglo XVIII. Las concentraciones de radon 222 se determinaron con un detector pasivo Radon Monitor 05-418, marca Victoreen. El mismo consta de una camara de difusion electrostatica y un detector de estado solido (Si) de juntura difundida. No se observo, en los resultados obtenidos, influencias causadas por factores meteorologicos como la temperatura ambiente y la presion atmosferica. Por comparacion de la concentracion de radon 222 en ambientes ubicados en distintas plantas se dedujo que el suelo subyacente bajo los edificios representa una fuente secundaria
International Nuclear Information System (INIS)
Labed, V.; Robe, M.C.
1992-01-01
Membranes that exclude water but are permeable to radon can extend the range of environments in which many radon detection systems could operate. We have studied the permeation of 222 Rn through membranes separating air and water phases. The permeation coefficients and the activation energy were calculated for various conditions. Potential applications such as in situ detection of radon in water are discussed
Radon-222 measurements aboard an airplane for the description of atmospheric diffusion
International Nuclear Information System (INIS)
Bogen, J.
1973-01-01
Radon-222 is absorbed aboard an airplane in tubes filled with 50 g of selected charcoal and cooked in Dewars by carbon dioxide and freon. After air collection at different heights up to 5 km, the tubes are evacuated and heated in the laboratory for desorption of the gas molecules and for transfer into a decay chamber covered with zinc-sulfide serving as a scintillator for the detection of alpha activity from radon-222 and its daughters. In general, the measurements show an exponential decrease of the concentration up to 5 km in height, if there is no cloud layer. The height for a reduction by a factor of two is about 900 meters. Assuming a constant diffusion coefficient K 0 up to 5 km, the measurements yield a K 0 of approximately 3.7 x 10 4 cm 2 s -1 . For flights in stratiform clouds a decrease is observed of the concentration up to a certain height, then radon-222 is again increasing or remains constant. This must be explained with respect to the meteorological situation. Assuming only a constant value for K 0 between the different flying heights, it was possible to appraise the development of the eddy diffusion coefficient with height
222-S LABORATORY FUME HOOD TESTING STUDY
International Nuclear Information System (INIS)
RUELAS, B.H.
2007-01-01
The 222-S Laboratory contains 155 active fume hoods that are used to support analytical work with radioactive and/or toxic materials. The performance of a fume hood was brought into question after employees detected odors in the work area while mixing chemicals within the subject fume hood. Following the event, testing of the fume hood was conducted to assess the performance of the fume hood. Based on observations from the testing, it was deemed appropriate to conduct performance evaluations of other fume hoods within the laboratory
International Nuclear Information System (INIS)
Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.
2017-01-01
It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD TM detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)
Energy Technology Data Exchange (ETDEWEB)
Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A., E-mail: baarreth@gmail.com, E-mail: allan_perna@hotmail.com, E-mail: daninarloch@hotmail.com, E-mail: aviadelclaro@gmail.com, E-mail: janine_nicolosi@hotmail.com, E-mail: spaschuk@gmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil). Departamento Academico de Fisica e Departamento Academico de Construcao Civil
2017-07-01
It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD{sup TM} detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)
Smith, C. G.; Cable, J. E.; Martin, J. B.; Roy, M.
2008-05-01
Pore water distributions of 222Rn (t1/2 = 3.83 d), obtained during two sampling trips 9-12 May 2005 and 6-8 May 2006, are used to determine spatial and temporal variations of fluid discharge from a seepage face located along the mainland shoreline of Indian River Lagoon, Florida. Porewater samples were collected from a 30 m transect of multi-level piezometers and analyzed for 222Rn via liquid scintillation counting; the mean of triplicate measurements was used to represent the porewater 222Rn activities. Sediment samples were collected from five vibracores (0, 10, 17.5, 20, and 30 m offshore) and emanation rates of 222Rn (sediment supported) were determined using a standard cryogenic extraction technique. A conceptual 222Rn transport model and subsequent numerical model were developed based on the vertical distribution of dissolved and sediment-supported 222Rn and applicable processes occurring along the seepage face (e.g. advection, diffusion, and nonlocal exchange). The model was solved inversely with the addition of two Monte Carlo (MC) simulations to increase the statistical reliability of three parameters: fresh groundwater seepage velocity (v), irrigation intensity (α0), and irrigation attenuation (α1). The first MC simulation ensures that the Nelder-Mead minimization algorithm converges on a global minimum of the merit function and that the parameters estimates are consistent within this global minimum. The second MC simulation provides 90% confidence intervals on the parameter estimates using the measured 222Rn activity variance. Fresh groundwater seepage velocities obtained from the model decrease linearly with distance from the shoreline; seepage velocities range between 0.6 and 42.2 cm d-1. Based on this linear relationship, the terminus of the fresh groundwater seepage is approximately 25 m offshore and total fresh groundwater discharge for the May-2005 and May-2006 sampling trips are 1.16 and 1.45 m3 d-1 m-1 of shoreline, respectively. We hypothesize
International Nuclear Information System (INIS)
1995-01-01
The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission
Directory of Open Access Journals (Sweden)
Marianne Wedde
Full Text Available Influenza A(H1N1pdm09 viruses cause sporadically very severe disease including fatal clinical outcomes associated with pneumonia, viremia and myocarditis. A mutation characterized by the substitution of aspartic acid (wild-type to glycine at position 222 within the haemagglutinin gene (HA-D222G was recorded during the 2009 H1N1 pandemic in Germany and other countries with significant frequency in fatal and severe cases. Additionally, A(H1N1pdm09 viruses exhibiting the polymorphism HA-222D/G/N were detected both in the respiratory tract and in blood. Specimens from mild, fatal and severe cases were collected to study the heterogeneity of HA-222 in A(H1N1pdm09 viruses circulating in Germany between 2009 and 2011. In order to enable rapid and large scale analysis we designed a pyrosequencing (PSQ assay. In 2009/2010, the 222D wild-type of A(H1N1pdm09 viruses predominated in fatal and severe outcomes. Moreover, co-circulating virus mutants exhibiting a D222G or D222E substitution (8/6% as well as HA-222 quasispecies were identified (10%. Both the 222D/G and the 222D/G/N/V/Y polymorphisms were confirmed by TA cloning. PSQ analyses of viruses associated with mild outcomes revealed mainly the wild-type 222D and no D222G change in both seasons. However, an increase of variants with 222D/G polymorphism (60% was characteristic for A(H1N1pdm09 viruses causing fatal and severe cases in the season 2010/2011. Pure 222G viruses were not observed. Our results support the hypothesis that the D222G change may result from adaptation of viral receptor specificity to the lower respiratory tract. This could explain why transmission of the 222G variant is less frequent among humans. Thus, amino acid changes at HA position 222 may be the result of viral intra-host evolution leading to the generation of variants with an altered viral tropism.
Safety evaluation for packaging 222-S laboratory cargo tank for onetime type B material shipment
International Nuclear Information System (INIS)
Nguyen, P.M.
1994-01-01
The purpose of this Safety Evaluation for Packaging (SEP) is to evaluate and document the safety of the onetime shipment of bulk radioactive liquids in the 222-S Laboratory cargo tank (222-S cargo tank). The 222-S cargo tank is a US Department of Transportation (DOT) MC-312 specification (DOT 1989) cargo tank, vehicle registration number HO-64-04275, approved for low specific activity (LSA) shipments in accordance with the DOT Title 49, Code of Federal Regulations (CFR). In accordance with the US Department of Energy, Richland Operations Office (RL) Order 5480.1A, Chapter III (RL 1988), an equivalent degree of safety shall be provided for onsite shipments as would be afforded by the DOT shipping regulations for a radioactive material package. This document demonstrates that this packaging system meets the onsite transportation safety criteria for a onetime shipment of Type B contents
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Certification. 52.222-52 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Certification. As... Contract Act to Contracts for Certain Services—Certification (NOV 2007) (a) The offeror shall check the...
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Requirements. 52.222-53 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Requirements. As... Act to Contracts for Certain Services—Requirements (FEB 2009) (a) The services under this contract are...
Applegate, Jeffrey R; Dombrowski, Daniel S; Christian, Larry Shane; Bayer, Meredith P; Harms, Craig A; Lewbart, Gregory A
2016-12-01
The purple-spined sea urchin ( Arbacia punctulata ) is commonly found in shallow waters of the western Atlantic Ocean from the New England area of the United States to the Caribbean. Sea urchins play a major role in ocean ecology, echinoculture, and biomedical research. Additionally, sea urchins are commonly displayed in public aquaria. Baseline parameters were developed in unanesthetized urchins for righting reflex (time to regain oral recumbency) and spine response time to tactile stimulus. Tricaine methanesulfonate (MS-222) was used to sedate and anesthetize purple-spined sea urchins and assess sedation and anesthetic parameters, including adhesion to and release from a vertical surface, times to loss of response to tactile stimulus and recovery of righting reflex, and qualitative observations of induction of spawning and position of spines and pseudopodia. Sedation and anesthetic parameters were evaluated in 11 individuals in three circumstances: unaltered aquarium water for baseline behaviors, 0.4 g/L MS-222, and 0.8 g/L MS-222. Induction was defined as the release from a vertical surface with the loss of righting reflex, sedation as loss of righting reflex with retained tactile spine response, anesthesia as loss of righting reflex and loss of tactile spine response, and recovery as voluntary return to oral recumbency. MS-222 proved to be an effective sedative and anesthetic for the purple-spined sea urchin at 0.4 and 0.8 g/L, respectively. Sodium bicarbonate used to buffer MS-222 had no measurable sedative effects when used alone. Anesthesia was quickly reversed with transfer of each individual to anesthesia-free seawater, and no anesthetic-related mortality occurred. The parameters assessed in this study provide a baseline for sea urchin anesthesia and may provide helpful comparisons to similar species and populations that are in need of anesthesia for surgical procedures or research.
Fijałkowska-Lichwa, L.; Przylibski, T. A.
2011-04-01
The authors investigated short-time changes in 222Rn activity concentration occurring yearly in two underground tourist facilities with limited air exchange with the atmosphere. One of them is Niedźwiedzia (Bear) Cave in Kletno, Poland - a natural space equipped with locks ensuring isolation from the atmosphere. The other site is Fluorite Adit in Kletno, a section of a disused uranium mine. This adit is equipped with a mechanical ventilation system, operated periodically outside the opening times (at night). Both sites are situated within the same metamorphic rock complex, at similar altitudes, about 2 km apart. The measurements conducted revealed spring and autumn occurrence of convective air movements. In Bear Cave, this process causes a reduction in 222Rn activity concentration in the daytime, i.e. when tourists, guides and other staff are present in the cave. From the point of view of radiation protection, this is the best situation. For the rest of the year, daily concentrations of 222Rn activity in the cave are very stable. In Fluorite Adit, on the other hand, significant variations in daily 222Rn activity concentrations are recorded almost all year round. These changes are determined by the periods of activity and inactivity of mechanical ventilation. Unfortunately this is inactive in the daytime, which results in the highest values of 222Rn activity concentration at the times when tourists and staff are present in the adit. Slightly lower concentrations of radon in Fluorite Adit are recorded in the winter season, when convective air movements carry a substantial amount of radon out into the atmosphere. The incorrect usage of mechanical ventilation in Fluorite Adit results in the most unfavourable conditions in terms of radiation protection. The staff working in that facility are exposed practically throughout the year to the highest 222Rn activity concentrations, both at work (in the adit) and at home (outside their working hours). Therefore, not very well
The effect of radon 222 on the oral mucosa of rabbits
International Nuclear Information System (INIS)
Minta, A.; Minta, P.; Kochanski, W.
1975-01-01
In experiments on 52 rabbits the authors investigated the effects of radon 222 administered by inhalation on the oral mucosa. The experimental animals were divided into 3 groups: 1 - controls, 2 - receiving radon inhalations in concentration 1 nCi/1, 3- receiving similar inhalations in a concentration of 5 nCi/l of air. Sections involving the lower lip with the mucosa were obtained for investigations after 10, 20, 30 and 60 days of inhalation. In the group of animals receiving radon in lower concentration its stimulating effect manifested itself as stimulation of mesenchymal cells and vascular endothelium. In group 3 sebaceous glands, atrophy and excessive keratinization of epidermis. Taking into account the analogy of these processes the authors concluded that in balneotherapy of oral diseases radon water application with low content of radon 222 may be satisfactory and safe. (author)
The 18F-labelled alkylating agent 2,2,2-trifluoroethyl triflate: synthesis and specific activity
International Nuclear Information System (INIS)
Johnstroem, P.; Stone-Elander, S.
1995-01-01
A method for synthesizing the alkylating agent 2,2,2-trifluoroethyl triflate labelled with [ 18 ]fluoride in the two position is presented. Ethyl [2- 18 )F]-trifluoroacetate was synthesized by the nucleophilic reaction of [ 18 F]F - with ethyl bromodifluoroacetate in DMSO (45-60%, 5 min, 80 o C) and subsequently converted to [2- 18 F]-2,2,2-trifluoroethanol using alane in THF (85-95%, 2 min, 40 o C. Reaction with triflic anhydride in 2,6-lutidine produced [2- 18 F]-2,2,2-trifluoroethyl triflate (70-80%, 1 min, 0 o C. In all three cases the product was removed from the reaction vessel by heating to distil under a stream of nitrogen. [2- 18 F]-2,2,2-Trifluoroethyl triflate was used to label 2-oxoquazepam by N-alkylation in a toulene:DMF mixture (80-85%, 20 min, 120 o C). Although no-carrier-added [ 18 )F]F - was used, considerable unlabelled ethyl trifluoroacetate was produced in the first reaction. Varying the conditions for the fluoro-debromination reaction did not appreciably improve the relative ratio of labelled to unlabelled ester. The specific activity of the labelled 1,4-benzodiazepine-2-one obtained from 1850 MBq [ 18 F]F - was found to be ≅37 MBq/μmol (1mCi/μmol). (Author)
2010-07-01
... adding together the assessed values determined pursuant to paragraph (a)(4) of this section for all... Uses for Determining Base Values Tax classifications of adjacent properties based on highest and best... aggregate assessed value of its eligible Federal property for its section 8002 payment? 222.23 Section 222...
Weak lensing study of dark matter filaments and application to the binary cluster A 222 and A 223
Dietrich, JP; Schneider, P; Clowe, D; Romano-Diaz, E; Kerp, J
We present a weak lensing analysis of the double cluster system Abell 222 and Abell 223. The lensing reconstruction shows evidence for a possible dark matter filament connecting both clusters. The case for a filamentary connection between A 222/223 is supported by an analysis of the galaxy density
222Radon concentration and irradiation dose inside the department of nuclear medicine in Wuhan
International Nuclear Information System (INIS)
Cheng Xiaoli; Wang Changyin; Gao Jianhua; Zou Xiaofeng
2002-01-01
Objective: Inspecting the high radioactivity area in department of nuclear medicine in Wuhan region and estimating the irradiation dose on relevant doctors. Methods: Select six 'three A' hospitals' high radioactivity area in department of nuclear medicine and common residential houses as examples. A half-year surveillance using 222 Rn detector (type LIH-2) was performed. Results: In high radioactivity rooms, imaging rooms residential houses, the average 222 Rn concentration are 27.8, 48.2, 27.1 (Bq·m -3 ) respectively. Effective dose equivalent absorbed by doctors in high radioactivity room and imaging room are 0.16 and 0.28 mSv. The authors estimated that the effective dose equivalent of doctors in these two room and common residents per year are 0.84, 0.70 and 0.64 mSv respectively. Conclusions: Doctors in imaging room and high radioactivity room are exposed to a relatively higher annual effective dose than common residents. But they are still within the normal range. Only two imaging rooms have high 222 Rn concentrations, which will cause potential harm
20 CFR 222.50 - When child dependency determinations are made.
2010-04-01
... RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.50 When child dependency... the presence of a child in the family group is that the child be dependent upon the employee. The... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When child dependency determinations are made...
Measurement of 222Rn and 220Rn exhalation rate from soil samples of Kumaun Hills, India
Semwal, Poonam; Singh, Kuldeep; Agarwal, T. K.; Joshi, Manish; Pant, Preeti; Kandari, Tushar; Ramola, R. C.
2018-03-01
The source terms, i.e., exhalation and emanation from soil and building materials are the primary contributors to the radon (222Rn)/thoron (220Rn) concentration levels in the dwellings, while the ecological constraints like ventilation rate, temperature, pressure, humidity, etc., are the influencing factors. The present study is focused on Almora District of Kumaun, located in Himalayan belt of Uttarakhand, India. For the measurement of 222Rn and 220Rn exhalation rates, 24 soil samples were collected from different locations. Gamma radiation level was measured at each of these locations. Chamber technique associated with Smart Rn Duo portable monitor was employed for the estimation of 222Rn and 220Rn exhalation rates. Radionuclides (226Ra, 232Th and 40K) concentrations were also measured in soil samples using NaI(Tl) scintillation based gamma ray spectrometry. The mass exhalation rate for 222Rn was varying between 16 and 54 mBq/kg/h, while the 220Rn surface exhalation rate was in the range of 0.65-6.43 Bq/m2/s. Measured gamma dose rate for the same region varied from 0.10 to 0.31 µSv/h. Inter-correlation of exhalation rates and intra-correlation with background gamma levels were studied.
International Nuclear Information System (INIS)
Picolo, Jean-Louis
1995-06-01
Radon 222 metrology is required to obtain higher accuracy in assessing human health risks from exposure to natural radiation. This paper describes the development of a cryogenic facility that allows absolute measurements of radon 222 in order to obtain a primary standard. The method selected is the condensation of a radon 222 sample on a geometrically defined cold surface with a constant, well known and adjustable temperature and facing an alpha particles detector. Counting of the alpha particles reaching the detector and the precisely known detection geometry provide an absolute measurement of the source activity. After describing the cryogenic facility, the measurement accuracy and precision are discussed and a comparison made with other measurement systems. The relative uncertainty is below 1 pc (1 σ). The facility can also be used to improve our knowledge of the nuclear properties of radon 222 and to produce secondary standards. (author) [fr
Opening up Brazil's hydrocarbon sector - the Bolivia-Brazil pipeline
International Nuclear Information System (INIS)
Law, P.
2000-01-01
The Bolivia-Brazil natural gas pipeline, which transports natural gas more than 3000 km from Bolivia to Brazil, cost US$2.1 billion to construct. Despite the substantial benefits for both Bolivia and Brazil and the involvement of reputable private partners, the perceived risks and complexities of this large project made financing it major challenge. neither of these countries has had a tradition of independent regulation or economic fuel pricing, and the pipeline was the first major gas infrastructure project involving the private sector in Brazil. The presentation explains the historical features of the project and how the project was used to open up Brazilian oil and gas sector to private investment and competition. (author)
Energy Technology Data Exchange (ETDEWEB)
Song Gang, E-mail: songg2005@126.co [School of Environmental Science and Engineering, Guangzhou University, Guangzhou 510006 (China); Wang Xinming [Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Chen Diyun; Chen Yongheng [School of Environmental Science and Engineering, Guangzhou University, Guangzhou 510006 (China)
2011-04-15
This study investigates the contribution of radon ({sup 222}Rn)-bearing water to indoor {sup 222}Rn in thermal baths. The {sup 222}Rn concentrations in air were monitored in the bathroom and the bedroom. Particulate matter (PM, both PM{sub 10} and PM{sub 2.5}) and carbon dioxide (CO{sub 2}) were also monitored with portable analyzers. The bathrooms were supplied with hot spring water containing 66-260 kBq m{sup -3} of {sup 222}Rn. The results show that the spray of hot spring water from the bath spouts is the dominant mechanism by which {sup 222}Rn is released into the air of the bathroom, and then it diffuses into the bedroom. Average {sup 222}Rn level was 110-410% higher in the bedrooms and 510-1200% higher in the bathrooms compared to the corresponding average levels when there was no use of hot spring water. The indoor {sup 222}Rn levels were influenced by the {sup 222}Rn concentrations in the hot spring water and the bathing times. The average {sup 222}Rn transfer coefficients from water to air were 6.2 x 10{sup -4}-4.1 x 10{sup -3}. The 24-h average levels of CO{sub 2} and PM{sub 10} in the hotel rooms were 89% and 22% higher than the present Indoor Air Quality (IAQ) standard of China. The main particle pollutant in the hotel rooms was PM{sub 2.5}. Radon and PM{sub 10} levels in some hotel rooms were at much higher concentrations than guideline levels, and thus the potential health risks to tourists and especially to the hotel workers should be of great concern, and measures should be taken to lower inhalation exposure to these air pollutants. - Highlights: {yields} {sup 222}Rn-bearing water is the main contributor to indoor radon in hot spring hotel. {yields} The PM{sub 2.5} and CO{sub 2} are also the main indoor pollutants in the hotel rooms. {yields} Higher radon and PM levels might have significant negative health effects to human. {yields} The radon transfer coefficients are consistent with the published data.
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyun Cheol; Jung, Yoon Hee; Lee, Wanno; Choi, Guen Sik; Chung, Kun Ho; Kang, Mun Ja [Environmental Radioactivity Assessment Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-12-15
Liquid scintillation counters (LSCs) are commonly used as an analytical method for detecting {sup 222}Rn in groundwater because they involve a simple sample pretreatment and allow high throughout with an autosampler. The Quantulus 1220 is the best-selling LSC in Korea, but its production was stopped. Recently, a new type of LSC, the 300SL, was introduced. In this study, the 300SL was compared with the Quantulus 1220 in order to evaluate the ability of each apparatus to detect {sup 222}Rn in groundwater. The Quantulus 1220 and 300SL were used to detect the presence of {sup 222}Rn. Radon gas was extracted from a groundwater sample using a water-immiscible cocktail in a LSC vial. The optimal analytical conditions for each LSC were determined using a {sup 222}Rn calibration source prepared with a {sup 226}Ra source. The optimal pulse shape analysis level for alpha and beta separation was 80 for the Quantulus 1220, and the corresponding pulse length index was 12 in the 300SL. The counting efficiency of the Quantulus 1220 for alpha emissions was similar to that of the 300SL, but the background count rate of the Quantulus 1220 was 10 times lower than that of the 300SL. The minimum detectable activity of the Quantulus 1220 was 0.08 Bq·L{sup -,} while that of the 300SL was 0.20 Bq·L{sup -1}. The analytical results regarding {sup 222}Rn in groundwater were less than 10% different between these LSCs. The 300SL is an LSC that is comparable to the Quantulus 1220 for detecting {sup 222}Rn in groundwater. Both LSCs can be applied to determine the levels of {sup 222}Rn in groundwater under the management of the Ministry of Environment.
The HIV-1 Tat protein modulates CD4 expression in human T cells through the induction of miR-222.
Orecchini, Elisa; Doria, Margherita; Michienzi, Alessandro; Giuliani, Erica; Vassena, Lia; Ciafrè, Silvia Anna; Farace, Maria Giulia; Galardi, Silvia
2014-01-01
Several cellular microRNAs show substantial changes in expression during HIV-1 infection and their active role in the viral life cycle is progressively emerging. In the present study, we found that HIV-1 infection of Jurkat T cells significantly induces the expression of miR-222. We show that this induction depends on HIV-1 Tat protein, which is able to increase the transcriptional activity of NFkB on miR-222 promoter. Moreover, we demonstrate that miR-222 directly targets CD4, a key receptor for HIV-1, thus reducing its expression. We propose that Tat, by inducing miR-222 expression, complements the CD4 downregulation activity exerted by other viral proteins (i.e., Nef, Vpu, and Env), and we suggest that this represents a novel mechanism through which HIV-1 efficiently represses CD4 expression in infected cells.
Radon-222 exhalation from Danish building materials: H + H Industri A/S results
International Nuclear Information System (INIS)
Andersen, C.E.
1999-08-01
This report describes a closed-chamber method for laboratory measurements of the rate at which radon-222 degasses (exhales) from small building material samples. The chamber is 55 L in volume and the main sample geometry is a slab of dimensions 5x30x30 cm 3 . Numerical modelling is used to assess (and partly remove) the bias of the method relative to an ideal measurement of the free exhalation rate. Experimental results obtained with the method are found to be in agreement with the results of an open-chamber method (which is subject to different sources of error). Results of radon-222 exhalation rate measurements for 10 samples of Danish building materials are reported. Samples include ordinary concrete, lightweight aggregate concrete, autoclaved aerated concrete, bricks, and gypsum board. The maximum mass-specific exhalation rate is about 20 mBq h -1 kg -1 . Under consideration of the specific applications of the investigated building materials, the contribution to the indoor radon-222 concentration in a single-family reference house is calculated. Numerical modelling is used to help extrapolate the laboratory measurements on small samples to full scale walls. Application of typical materials will increase the indoor concentration by less than 10 Bq m -3 . (au)
International Nuclear Information System (INIS)
1985-06-01
The report is organized into five main sections. The conclusions of the effort are summarized in Chapter 2. A general description of current milling and tailings management practices and a summary of the site-specific characteristics of operating and standby uranium mills are contained in Chapter-3. The sources and emission rates of radon-222 at licensed mills and their associated tailings piles are contained in Chapter 4 along with the results of an effort to develop generic procedures to estimate radon-222 emissions for milling operations and tailings disposal. Control practices that are being or could be applied to the milling operation and tailings disposal areas and their estimated cost and effectiveness in reducing radon-222 emissions are presented in Chapter 5. The appendices contain detailed information on mill site data and emission estimates
International Nuclear Information System (INIS)
Sudeep Kumara, K.; Karunakara, N.; Sahoo, B.K.; Gaware, J.J.; Sapra, B.K.; Mayya, Y.S.
2018-01-01
222 Rn, produced due to the decay of 226 Ra, can accumulate to high concentrations, and if adequate ventilation is not provided the workers may inhale the 222 Rn laden air, which would result in elevated inhalation dose in Uranium mining and milling operations. Similarly, in thorium mining and processing plants, the 220 Rn generated during monazite processing and thorium handling facility is of concern. In a previous publication it has been shown that adsorption in a flow-through charcoal bed offers an excellent method of alleviating the release of 220 Rn into occupational and public domain. In this paper we examine the utility of TMS as a 222 Rn hold up/delay system by evaluating its performance parameters such as breakthrough time (τ) and adsorption coefficient (K) at different flow rates
Concentrations of 222Rn in well and tap waters of North-Eastern Attiki (Central Greece)
International Nuclear Information System (INIS)
Kritidis, Panaiotis; Angelou, Panaiotis.
1984-07-01
An alpha-scintillation system for determination of low 222 Rn concentrations in water is described. The use of vacuum sampling, the avoidance of sample transfer and the corrections applied result in low systematical errors. The method has been used for a preliminary investigation of 222 Rn concentrations in well waters of NE Attiki, where values between 4 and 345 pCi/1 have been observed. The additional annual effective dose equivalent due to the systematic domestic use of water with the highest radon concentration measured is estimated not to exceed 5 mrem. (author)
Nowakowski, Michał
2017-11-01
BacSp222 is a multifunctional bacteriocin produced by Staphylococcus pseudintermedius strain 222, an opportunistic pathogen of domestic animals. At micromolar concentrations, BacSp222 kills Gram-positive bacteria and is cytotoxic toward mammalian cells, while at nanomolar doses, it acts as an immunomodulatory factor, enhancing nitric oxide release in macrophage-like cell lines. The bacteriocin is a cationic, N-terminally formylated, 50-amino-acid-long linear peptide that is rich in tryptophan residues.In this study, the solution structure of BacSp222 was determined and compared to the currently known structures of similar bacteriocins. BacSp222 was isolated from a liquid culture medium in a uniformly 13C- and 15N-labeled form, and NMR data were collected. The structure was calculated based on NMR-derived constraints and consists of a rigid and tightly packed globular bundle of four alpha-helices separated by three short turns.Although the amino acid sequence of BacSp222 has no significant similarity to any known peptide or protein, a 3D structure similarity search indicates a close relation to other four-helix bundle-motif bacteriocins, such as aureocin A53, lacticin Q and enterocins 7A/7B. Assuming similar functions, biology, structure and physicochemical properties, we propose to distinguish the four-helix bundle bacteriocins as a new Type A in subclass IId of bacteriocins, containing linear, non-pediocin-like peptides.
Detection system for continuous 222Rn monitoring in waters
International Nuclear Information System (INIS)
Holy, K.; Patschova, E.; Bosa, I.; Polaskova, A.; Hola, O.
2001-01-01
This contribution presents one of the high-sensitive systems of continuous radon monitoring in waters. The device can be used for the continual control of 222 Rn activity concentration in water sources, for a study of the daily and seasonal variations of radon activity concentration in water systems, for the determination of the infiltration time of surface water into the ground water and for the next untraditional applications. (authors)
International Nuclear Information System (INIS)
Jha, G.; Raghavayya, M.
1986-01-01
Measurement of time-integrated concentration of 222 Rn in air by using solid-state nuclear track detectors (SSNTD) is finding increasing application in such diverse fields as radiation protection, exploration of radioactive minerals, prediction of earthquakes etc. While there are several types of SSNTDs sensitive to specific types of particulate radiation, films made from cellulose nitrate (CN) are found to be the best suited for quick and quantitative measurement of alpha radiation. This is because CN films are available in small thicknesses, of the order of 10-12 μm, which can be suitably evaluated by spark counting technique. This report describes the use of a sensitive thin film of CN (Kodak LR 115, Type II) for quantitative estimation of 222 Rn. The film (along with the base is exposed in a cylindrical plastic cup closed at one end with a special rubber membrane which permits discrimination of 222 Rn against 220 Rn, which is also present in air to varying extents. The calibration procedure, including etching and evaluation of track registration efficiency, are described in detail. The mean track registration efficiency works out to 41.9 per cent and the sensitivity of the system is found to be 58.92 tracks cm -2 per (Bq.litre -1 ) day. The report lists the advantages and limitations of the system for measurement of time-integrated concentration of 222 Rn in air. (author)
Energy Technology Data Exchange (ETDEWEB)
Wagner, Katie A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Woodley, Christa M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Seaburg, Adam [Univ. of Washington, Seattle, WA (United States); Skalski, John R. [Univ. of Washington, Seattle, WA (United States); Eppard, Matthew B. [U.S. Army Corps of Engineers, Portland, OR (United States)
2014-07-17
While many studies have investigated the effects of transmitters on fish condition, behavior, and survival, to our knowledge, no studies have taken into account anesthetic exposure time in addition to tag and surgery effects. We investigated stress responses to prolonged MS-222 exposure after stage 4 induction in surgically implanted juvenile Chinook salmon (Oncorhynchus tshawytscha). Survival, tag loss, plasma cortisol concentration, and blood Na+, K+, Ca2+, and pH were measured immediately following anesthetic exposure and surgical implantation and 1, 7, and 14 days post-treatment. Despite the prolonged anesthetic exposure, 3-15 minutes post Stage 4 induction, there were no mortalities or tag loss in any treatment. MS-222 was effective at delaying immediate cortisol release during surgical implantation; however, osmotic disturbances resulted, which were more pronounced in longer anesthetic time exposures. From day 1 to day 14, Na+, Ca2+, and pH significantly decreased, while cortisol significantly increased. The cortisol increase was exacerbated by surgical implantation. There was a significant interaction between MS-222 time exposure and observation day for Na+, Ca2+, K+, and pH; variations were seen in the longer time exposures, although not consistently. In conclusion, stress response patterns suggest stress associated with surgical implantation is amplified with increased exposure to MS-222.
A survey of 222Rn in drinking water in mexico city
International Nuclear Information System (INIS)
Vasquez-Lopez, C.; Zendejas-Leal, B. E.; Golzarri, J. I.; Espinosa, G.
2011-01-01
In Mexico City there are more than 22 millions of inhabitants (10 in the metropolitan area and 12 in the suburban zone) exposed to drinking water. The local epidemiological authorities recognised that exposure to radon contaminated drinking water is a potential health hazard, as has been considered worldwide. The United States Environmental Protection Agency has proposed a limit of 11.1 Bq l -1 for the radon level in drinking water. In Mexico a maximum contamination level of radon in drinking water has not yet even considered. In this work, a 222 Rn study of drinking water in Mexico City has revealed a range of concentrations from background level to 3.8 Bq l -1 . 222 Rn was calculated using a portable degassing system (AquaKIT) associated with an AlphaGUARD measuring system. Samples from 70 wells of the water system of the south of the Valley Basin of Mexico City and from houses of some other political administrative divisions of Mexico City were taken. (authors)
International Nuclear Information System (INIS)
Bollhöfer, Andreas; Doering, Che
2016-01-01
Radon-222 exhalation flux densities from two different substrates of several metres thickness, waste rock and waste rock mixed with approximately 30% lateritic material, were measured over a period of five years in the wet-dry tropics of Northern Australia. Fourteen measurement campaigns using activated charcoal canisters (n > 1000) covered both dry and wet seasons and showed differences in seasonal and long term trends of the "2"2"2Rn exhalation flux densities normalised to the "2"2"6Ra activity concentrations of the substrate. Dry season "2"2"2Rn exhalation was generally higher for the mixed substrate, due to the larger fraction of fines. Seasonality established within the first year of landform construction on the mixed substrate, due to the higher water holding capacity of the lateritic material. In contrast, waste rock only shows no seasonality until years four and five after construction, when average normalised dry season "2"2"2Rn exhalation flux densities from waste rock increase to values (0.47 ± 0.06 mBq m"−"2 s"−"1 per Bq kg"−"1) similar to the mixed substrate (0.64 ± 0.08 mBq m"−"2 s"−"1 per Bq kg"−"1), likely due to an increase in fines from rapid weathering of the schistose waste rock. Volumetric water content has been used to parametrize relative "2"2"2Rn exhalation and we determined that wet season "2"2"2Rn exhalation is about 40% of the dry season exhalation. - Highlights: • We determined "2"2"2Rn exhalation flux densities normalised to "2"2"6Ra activity concentrations (R_E_-_R) for two substrates. • R_E_-_R was lower for waste rock only compared to waste rock blended with 30% fine grained lateritic material. • Seasonality in waste rock "2"2"2Rn exhalation flux densities established 4 years after construction. • Wet season R_E_-_R was about 40% of the dry season R_E_-_R.
Energy Technology Data Exchange (ETDEWEB)
Santos, Maristela Souza
2006-07-01
The International Commission on Radiological Protection (ICRP) Publication 66 and Supporting Guidance 3) strongly recommends that specific information on lung retention parameters should be used in preference to default values wherever appropriate, for the derivation of effective doses and for bioassay interpretation of monitoring data. A group of 81 workers exposed to UO{sub 2} at the fuel fabrication facility in Brazil was selected to evaluate the committed effective dose. The workers were monitored for determination of uranium content in the urinary and faecal excretion. The contribution of intakes by ingestion and inhalation were assessed on the basis of the ratios of urinary to fecal excretion. For the selected workers it was concluded that inhalation dominated intake. According to ICRP 66, uranium oxide is classified as insoluble Type S compound. The ICRP Supporting Guidance 3 and some recent studies have recommended specific lung retention parameters to UO{sub 2}. The solubility parameters of the uranium oxide compound handled by the workers at the fuel fabrication facility in Brazil was evaluated on the basis of the ratios of urinary to fecal excretion. Excretion data were corrected for dietary intakes. This paper will discuss the application of lung retention parameters recommended by the ICRP models to these data and also the dependence of the effective committed dose on the lung retention parameters. It will also discuss the problems in the interpretation of monitoring results, when the worker is exposed to several uranium compounds of different solubilities. (author)
The HIV-1 Tat protein modulates CD4 expression in human T cells through the induction of miR-222
Orecchini, Elisa; Doria, Margherita; Michienzi, Alessandro; Giuliani, Erica; Vassena, Lia; Ciafrè, Silvia Anna; Farace, Maria Giulia; Galardi, Silvia
2014-01-01
Several cellular microRNAs show substantial changes in expression during HIV-1 infection and their active role in the viral life cycle is progressively emerging. In the present study, we found that HIV-1 infection of Jurkat T cells significantly induces the expression of miR-222. We show that this induction depends on HIV-1 Tat protein, which is able to increase the transcriptional activity of NFkB on miR-222 promoter. Moreover, we demonstrate that miR-222 directly targets CD4, a key receptor for HIV-1, thus reducing its expression. We propose that Tat, by inducing miR-222 expression, complements the CD4 downregulation activity exerted by other viral proteins (i.e., Nef, Vpu, and Env), and we suggest that this represents a novel mechanism through which HIV-1 efficiently represses CD4 expression in infected cells. PMID:24717285
Energy Technology Data Exchange (ETDEWEB)
Santos, M.L.O.; Farias, E.E.G.; Amaral, D.S.; Hazin, C.A.; França, E.J., E-mail: emersonemiliano@yahoo.com.br [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, J.A. [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)
2017-07-01
Liquid Scintillation Spectrometry (LSC) is one of the most used techniques for quantification of alpha and beta particles in aqueous medium, being used to determine the concentration of Radon-222 in water. The counting efficiency of this methodology depends on the good extraction of the radionuclide and the definition of the most appropriate scintillator cocktail. The study aimed to construct a growth curve of Rn-222 activity in aqueous medium and to test the counting efficiency of this method. For this, samples containing 12 mL Ra-226 standard solution and 12 mL scintillator cocktail were prepared in triplicate. The cocktail was prepared using 1 L of p-xylene, 7 g of 2,5-diphenyloxazole (PPO) and 0.75 g of 1,4-bis- [2- (5-diphenyloxazol)] benzene (POPOP). Subsequently, the containers were sealed and agitated for five minutes, seeking an efficient transfer of the radon to the organic phase. Analytical white was prepared using deionized water and the scintillation cocktail. After 3 hours, the concentrations of this radionuclide were determined by the LSC technique, using QUANTULUS 1220 equipment, Perkin Elmer. Analyzes were performed on nine different days, making a total of 21 days between the first and last analysis. The results obtained allowed to make an analytical curve with good fit (r{sup 2} = 0.98), which could be used as a calibration factor for this method. The method used showed a counting efficiency of 78%. A suitable analytical protocol for determination of Rn-222 in water samples was established.
International Nuclear Information System (INIS)
Yuan Yongling; Shen Tong; Morishima, Hiroshige; Koga, Taeko; Wei Luxin; Sugahara, Tsutomu
2000-01-01
For the renewal of dose estimation from internal irradiation in the high background radiation areas (HBRA) of Yangjiang, the measurements of radon, thoron and their decay products in the environmental air were conducted, including: integrating measurements of Rn-222 and Rn-220 concentrations; equilibrium factor F for Rn-222 and alpha-potential energy value of Rn-220; external gamma radiation in places where radon measurements were undertaken; cumulative exposure to indoor radon for each family in a case-control study on lung cancer. The Rn-Tn cup monitor method was used for the integrating measurement of Rn-222 and Rn-220 concentration. An alpha track detector was used for the integration measurement of Rn-222 concentration in the case-control study on lung cancer. The results of measurements show that although the investigated areas are located between the Equator and the Tropic of Cancer, and that people live in well-ventilated dwellings, the concentrations of radon, especially of Rn-220 are significantly higher in the indoor air of HBRA than those in the control area. The value of equilibrium factors for Rn-222, the alpha potential energy of decay products from Rn-222 and Rn-220 are determined. (author)
International Nuclear Information System (INIS)
Wei Suxia
1992-01-01
A method concerning selection of design parameters of diffusion barrier in a passive 222 Rn sampler based on activated charcoal adsorption. The proper parameter value of diffusion barrier is obtained by means of linearization of 222 Rn adsorption versus the exposure time. Thus, the influence of temperature on measured results may be greatly decreased, and higher sensitivity of the detector may be maintained
Makrlík, Emanuel; Sýkora, David; Böhm, Stanislav; Kvíčalová, Magdalena; Vaňura, Petr
2018-05-01
By means of electrospray ionisation mass spectrometry, it was evidenced experimentally that the ammonium cation (NH4+) reacts with the electroneutral [2.2.2]paracyclophane ligand (C24H24) to form the cationic complex [NH4(C24H24)]+. Moreover, applying quantum chemical calculations, the most probable conformation of the proven [NH4(C24H24)]+ complex was solved. In the complex [NH4(C24H24)]+ having a symmetry very close to C3, the 'central' cation NH4+ is coordinated by three strong bifurcated intramolecular hydrogen bonds to the corresponding six carbon atoms from the three benzene rings of [2.2.2]paracyclophane via cation-π interaction. Finally, the interaction energy, E(int), of the considered complex [NH4(C24H24)]+ was evaluated as -625.8 kJ/mol, confirming the formation of this fascinating complex species as well. It means that the [2.2.2]paracyclophane ligand can be considered as an effective receptor for the ammonium cation in the gas phase.
Energy Technology Data Exchange (ETDEWEB)
Singh, Parminder; Saini, Komal; Bajwa, Bikramjit Singh [Guru Nanak Dev University, Department of Physics, Amritsar, Punjab (India); Mishra, Rosaline; Sahoo, Bijay Kumar [Bhabha Atomic Research Centre, Radiological Physics and Advisory Division, Mumbai (India)
2016-08-15
In this study, measurements of indoor radon ({sup 222}Rn), thoron ({sup 220}Rn) and their equilibrium equivalent concentration (EEC) were carried out in 96 dwellings from 22 different villages situated in Hamirpur district, Himachal Pradesh, India, by using LR-115 type II-based pinhole twin cup dosimeters and deposition-based progeny sensors (DRPS/DTPS). The annual average indoor {sup 222}Rn and {sup 220}Rn concentrations observed in these dwellings were 63.82 and 89.59 Bq/m{sup 3}, respectively, while the average EEC (attached + unattached) for {sup 222}Rn and {sup 220}Rn was 29.28 and 2.74 Bq/m{sup 3}. For {sup 222}Rn (f{sub Rn}) and {sup 220}Rn (f{sub Tn}), the average values of unattached fraction were 0.11 and 0.09, respectively. The equilibrium factors for radon (F{sub Rn}) and thoron (F{sub Tn}) varied from 0.12 to 0.77 with an average of 0.50, and from 0.01 to 0.34 with an average of 0.05, respectively. The annual inhalation dose due to mouth and nasal breathing was calculated using dose conversion factors and unattached fractions. The indoor annual effective doses for {sup 222}Rn (AEDR) and {sup 220}Rn (AEDT) were found to be 1.92 and 0.83 mSv a{sup -1}, respectively. The values of {sup 222}Rn/{sup 220}Rn concentrations and annual effective doses obtained in the present study are within the safe limits as recommended by the International Commission on Radiological Protection for indoor dwelling exposure conditions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hernandez, A.; Aranda, P.; Ceballos, S.; Cruz, D.; Jauregui, B.; Lopez, R.; Pena, P.; Salazar, S.; Segovia, N.; Tamez, E. [Instituto nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
1997-07-01
In this work it is realized a geochemical study which includes the evaluation of {sup 222} Rn concentration in drinking water wells at Toluca city and a spring water of Almoloya de Juarez municipality at State of mexico. the same is studied about evolution of {sup 222} Rn concentration in water of the hydrating which supply it to those wells. the geochemical evaluation also covers the determination of major and minor elements or trace and the biological analysis of water. The study includes two seasonal cycles, the low water mark one and other the rainy for being able to evaluate the aquifers reloading effects in the water composition. (Author)
Mishra, Devi Prasad; Sahu, Patitapaban; Panigrahi, Durga Charan; Jha, Vivekanand; Patnaik, R Lokeswara
2014-02-01
This paper presents a comparative study of (222)Rn emanation from the ore and backfill tailings in an underground uranium mine located at Jaduguda, India. The effects of surface area, porosity, (226)Ra and moisture contents on (222)Rn emanation rate were examined. The study revealed that the bulk porosity of backfill tailings is more than two orders of magnitude than that of the ore. The geometric mean radon emanation rates from the ore body and backfill tailings were found to be 10.01 × 10(-3) and 1.03 Bq m(-2) s(-1), respectively. Significant positive linear correlations between (222)Rn emanation rate and the (226)Ra content of ore and tailings were observed. For normalised (226)Ra content, the (222)Rn emanation rate from tailings was found to be 283 times higher than the ore due to higher bulk porosity and surface area. The relative radon emanation from the tailings with moisture fraction of 0.14 was found to be 2.4 times higher than the oven-dried tailings. The study suggested that the mill tailings used as a backfill material significantly contributes to radon emanation as compared to the ore body itself and the (226)Ra content and bulk porosity are the dominant factors for radon emanation into the mine atmosphere.
International Nuclear Information System (INIS)
Benally, A.B.
1997-01-01
This Sampling and Analysis Plan (SAP) establishes the requirements and guidelines to be used by the Waste Management Federal Services of Hanford, Inc. personnel in characterizing liquid waste generated at the 222-S Laboratory Complex. The characterization process to verify the accuracy of process knowledge used for designation and subsequent management of wastes consists of three steps: to prepare the technical rationale and the appendix in accordance with the steps outlined in this SAP; to implement the SAP by sampling and analyzing the requested waste streams; and to compile the report and evaluate the findings to the objectives of this SAP. This SAP applies to portions of the 222-S Laboratory Complex defined as Generator under the Resource Conservation and Recovery Act (RCRA). Any portion of the 222-S Laboratory Complex that is defined or permitted under RCRA as a treatment, storage, or disposal (TSD) facility is excluded from this document. This SAP applies to the liquid waste generated in the 222-S Laboratory Complex. Because the analytical data obtained will be used to manage waste properly, including waste compatibility and waste designation, this SAP will provide directions for obtaining and maintaining the information as required by WAC173-303
Cape Point GAW Station Rn-222 detector: factors affecting sensitivity and accuracy
CSIR Research Space (South Africa)
Brunke, EG
2002-05-01
Full Text Available Specific factors of a baseline Rn-222 detector installed at Cape Point, South Africa, were studied with the aim of improving its performance. Direct sunlight caused air turbulence within the instrument, resulting in 13.6% variability...
Indoor "2"2"2Rn concentration in the exhibition and storage rooms of Polish geological museums
International Nuclear Information System (INIS)
Długosz-Lisiecka, Magdalena; Krystek, Marcin; Raczyński, Paweł; Głuszek, Ewa; Kietlińska-Michalik, Barbara; Niechwedowicz, Mariusz
2017-01-01
The radon exhaled from radioactive mineral collections exhibited in five Polish geological museums may influence its total indoor concentration. Radon concentrations measured in the exhibition halls do not pose a risk for visitors or museum staff. However, air exceeding the action limit for workers (equal to 300 Bq/m"3) was noted in the storage rooms of two museums. Significant"2"2"2Rn activity concentrations equal to more than ~300 kBq/m"3were measured inside lead containers where radioactive minerals were stored. - Highlights: • In this "2"2"2Rn radionuclide measurements in 5 Polish geological museums have been done. • The review of "2"2"2Rn activity in the air in areas containing radioactive geological collections is not a routine protocol, and is not included in the national radon monitoring program. • Therefore the radiological exposure for museum staff resulting from inhalation of gaseous radon and its products has been including.
Directory of Open Access Journals (Sweden)
Astudillo, J.
1993-08-01
Full Text Available This work summarizes the analogical study of the radioactive elements and rare earths are deposits applied to the modelling and validation of the migration/retention processes of the high level radioactive artificial isotopes in a geological environment. The geological, mineralogical and geochemical characteristics of the El Berrocal granite- U mineralization system suggest that this system cannot be considered as a global natural analogue for a radioactive waste repository. However, the low-temperature hydrothermal processes, which affected it, including that one which originated the uraniferous mineralization, as well as the weathering processes, can be considered as geochemical processes analogous to those that could take place in a high level radioactive repository.En este trabajo se resume la aplicación del estudio analógico de los yacimientos de elementos radiactivos a la modelización y validación de los procesos de migración/retención de los radioisótopos artificiales de alta actividad, en un medio geológico. Las características geológicas, mineralógicas y geoquímicas del sistema granito-mineralización de uranio de El Berrocal sugieren que dicho sistema no puede considerarse como un análogo natural global de un almacenamiento de residuos radiactivos. Sin embargo, los procesos hidrotermales de baja temperatura que lo afectaron, incluido el que originó la mineralización uranífera, así como los de alteración supergénica, pueden considerarse como procesos geoquímicos análogos a los que podrían tener lugar en un almacenamiento de residuos radiactivos de alta actividad.
Makrlík, Emanuel; Sýkora, David; Böhm, Stanislav; Vaňura, Petr
2018-02-01
By employing electrospray ionization mass spectrometry (ESI-MS), it was proven experimentally that the univalent sodium cation (Na+) forms with [2.2.2]paracyclophane (C24H24) the cationic complex [Na(C24H24)]+. Further, applying quantum chemical DFT calculations, the most probable structure of the [Na(C24H24)]+ complex was derived. In the resulting complex with a symmetry very close to C3, the "central" cation Na+, fully located in the cavity of the parent [2.2.2]paracyclophane ligand, is bound to all three benzene rings of [2.2.2]paracyclophane via cation-π interaction. Finally, the interaction energy, E(int), of the considered cation-π complex [Na(C24H24)]+ was found to be -267.3 kJ/mol, confirming the formation of this fascinating complex species as well.
Schmitz, Boris; Rolfes, Florian; Schelleckes, Katrin; Mewes, Mirja; Thorwesten, Lothar; Krüger, Michael; Klose, Andreas; Brand, Stefan-Martin
2018-01-01
Aim: MicroRNA-222 (miR-222) and miR-29c have been identified as important modulators of cardiac growth and may protect against pathological cardiac remodeling. miR-222 and -29c may thus serve as functional biomarkers for exercise-induced cardiac adaptations. This investigation compared the effect of two workload-matched high-intensity interval training (HIIT) protocols with different recovery periods on miR-222 and -29c levels. Methods: Sixty-three moderately trained females and males (22.0 ± 1.7 years) fulfilled the eligibility criteria and were randomized into two HIIT groups using sex and exercise capacity. During a controlled 4-week intervention (two sessions/week) a 4 × 30 HIIT group performed 4 × 30 s runs (all-out, 30 s active recovery) and a 8 × 15 HIIT group performed 8 × 15 s runs (all-out, 15 s active recovery). miR-222 and -29c as well as transforming growth factor-beta1 (TGF-beta1) mRNA levels were determined during high-intensity running as well as aerobic exercise using capillary blood from earlobes. Performance parameters were assessed using an incremental continuous running test (ICRT) protocol with blood lactate diagnostic and heart rate (HR) monitoring to determine HR recovery and power output at individual anaerobic threshold (IAT). Results: At baseline, acute exercise miR-222 and -29c levels were increased only in the 4 × 30 HIIT group (both p HIIT group (p HIIT group again no acute effect was observed. However, both HIIT interventions resulted in elevated resting miR-222 and -29c levels (all p 24% in both HIIT groups (both p ≤ 0.0002) speed at IAT was improved by 3.6% only in the 4 × 30 HIIT group (p HIIT can induce increased circulating levels of cardiac growth-associated miR-222 and -29c. miR-222 and miR-29c could be useful markers to monitor HIIT response in general and to identify optimal work/rest combinations. PMID:29719514
Schmitz, Boris; Rolfes, Florian; Schelleckes, Katrin; Mewes, Mirja; Thorwesten, Lothar; Krüger, Michael; Klose, Andreas; Brand, Stefan-Martin
2018-01-01
Aim: MicroRNA-222 (miR-222) and miR-29c have been identified as important modulators of cardiac growth and may protect against pathological cardiac remodeling. miR-222 and -29c may thus serve as functional biomarkers for exercise-induced cardiac adaptations. This investigation compared the effect of two workload-matched high-intensity interval training (HIIT) protocols with different recovery periods on miR-222 and -29c levels. Methods: Sixty-three moderately trained females and males (22.0 ± 1.7 years) fulfilled the eligibility criteria and were randomized into two HIIT groups using sex and exercise capacity. During a controlled 4-week intervention (two sessions/week) a 4 × 30 HIIT group performed 4 × 30 s runs (all-out, 30 s active recovery) and a 8 × 15 HIIT group performed 8 × 15 s runs (all-out, 15 s active recovery). miR-222 and -29c as well as transforming growth factor-beta1 (TGF-beta1) mRNA levels were determined during high-intensity running as well as aerobic exercise using capillary blood from earlobes. Performance parameters were assessed using an incremental continuous running test (ICRT) protocol with blood lactate diagnostic and heart rate (HR) monitoring to determine HR recovery and power output at individual anaerobic threshold (IAT). Results: At baseline, acute exercise miR-222 and -29c levels were increased only in the 4 × 30 HIIT group (both p HIIT group ( p HIIT group again no acute effect was observed. However, both HIIT interventions resulted in elevated resting miR-222 and -29c levels (all p 24% in both HIIT groups (both p ≤ 0.0002) speed at IAT was improved by 3.6% only in the 4 × 30 HIIT group ( p HIIT can induce increased circulating levels of cardiac growth-associated miR-222 and -29c. miR-222 and miR-29c could be useful markers to monitor HIIT response in general and to identify optimal work/rest combinations.
Energy Technology Data Exchange (ETDEWEB)
Melo, Vicente de Paula
1999-07-01
The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas {sup 222}Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 {sup W}, used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of {sup 222}Rn in the residences of Monte Alegre and CANP. Determinations of the {sup 238}U and {sup 226}Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m{sup 3} (action level) and 600 Bq. m{sup 3} (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)
Energy Technology Data Exchange (ETDEWEB)
Melo, Vicente de Paula
1999-07-01
The human being is constantly exposed to the natural radioactivity in the environment where he lives. This radioactivity comes mainly from materials present in the terrestrial crust that possess in their constitution chemical elements belonging to the radioactive families of uranium and thorium. The use of such materials for the construction of houses constitutes an important exposure form to the natural radiation, above all to the radioactive gas {sup 222}Rn, that it is exhaled from them. The Brazilian soil is composed, among other, of minerals that contain appreciable concentrations of these elements. The inhabitants of Monte Alegre town in Para, located at 2 deg 00' 24,9 'S ; 54 deg 04 ' 13,5 {sup W}, used in the construction of their houses stones obtained from an area 20 km distant of Monte Alegre, denominated Ingles de Souza, located at 01 deg 56' 4 0,1 S; 54 deg 12 149,7 W, where a small residential village, denominated National Agricultural Colony of Para (CANP), is located. The objective of this work was to evaluate the indoor concentration of {sup 222}Rn in the residences of Monte Alegre and CANP. Determinations of the {sup 238}U and {sup 226}Ra concentrations, measurements of the radon flux in samples of stones and soils of the two regions, as well as measurements to the gamma dose close of the soil and inside the residences, were also carried out. The average results of the radon concentration in the air of the investigated residences did not exceed the limits of 200 Bq. m{sup 3} (action level) and 600 Bq. m{sup 3} (intervention level) recommended by the International Commission on Radiological Protection (ICRP). The concentrations of natural radionuclides and the radon flux determined at the village showed values 17 times higher than those found at the urban area of Monte Alegre, while the average indoor gamma dose rate in the village residences was 0.86 mSv/a. (author)
Dosimetry of Rn-222 in the air in environments located above and below ground level
International Nuclear Information System (INIS)
Cazula, Camila Dias
2015-01-01
Exposure of the general population to ionizing radiation comes mainly from natural sources. The main contribution is due to inhalation of radon (Rn-222), a gas that occurs naturally (UNSCEAR, 2000). The Rn-222 concentration in the environment is controlled by factors such as soil permeability and water content, the weather variability, materials used in the foundation and the usual positive pressure differential between the soil and the internal environment. Studies indicate that the concentration of radon shows a wide variation in the basement, ground floor and upper floors of buildings. The objective of this study is to determine radon levels in basements, ground floor and floors above ground level, at a university in the city of Sao Paulo and in one residential building in the city of Peruibe. Rn-222 measurements were performed using the method with nuclear track of solid state detectors (CR-39). The studied environments present Rn-222 concentration well below the values recommended by the International Commission on Radiological Protection, published in the 2009 document, of 300 Bq/m 3 for homes and 1000 Bq/m 3 for the workplace. In the residential building, the concentration of Ra-266, Th-232 and K-40 in the materials used in the building construction was also analyzed, by gamma spectrometry. The effective total dose for the resident due to external exposure was 0.8 mSv y -1 , lower than the annual dose limit for the general public of 1 mSv y -1 . (author)
The transport mechanisms of 222Rn in soil at Tateishi as an anomaly spot in Japan
International Nuclear Information System (INIS)
Iskandar, D.; Iida, T.; Yamazawa, H.; Moriizumi, J.; Koarashi, J.; Yamasoto, K.; Yamasaki, K.; Shimo, M.; Tsujimoto, T.; Ishikawa, S.; Fukuda, M.; Kojima, H.
2005-01-01
The 222 Rn concentration profiles in soil have been measured at an anomaly spot in Tateishi, Japan. In winter, the concentrations were low and showed a negative gradient with depth, but in other seasons, the concentration had both positive and negative gradients with depth, and dramatically changed by time. On the assumption that there was ventilation in deep layers and with driving forces of wind and temperatures, these phenomena were successfully explained. This finding would contribute to a numerical model for 222 Rn transport in soil
Radionuclides as tracers of coastal processes in Brazil: review, synthesis, and perspectives
International Nuclear Information System (INIS)
Santos, Isaac R.; Burnett, William C.
2008-01-01
We review the usefulness, limitations, significance, and coastal management implications of radionuclide measurements in Brazilian coastal environments. We focus on the use of radionuclides as tracers of sedimentary processes and submarine groundwater discharge (SGD). We also discuss artificial radionuclide contamination and high natural radioactivity areas. The interpretation of 14 C-, 137 Cs-, and 210 Pb-derived sedimentation rates has provided evidence that inappropriate soil use by urban and agricultural activities has intensified erosion processes on land, which is reflected in depositional environments, such as coastal lagoons, estuaries and mangroves. Of the processes discussed in this paper, SGD is the one that requires the most scientific effort in the short-term. There have been only two case studies using 222 Rn and radium isotopes as groundwater tracers in Brazil. These investigations showed that SGD can be a major source of nutrients and other dissolved species to the coastal ocean. Baseline 137 Cs, 90 Sr, 239+240 Pu, and 238 Pu concentrations in seawater from the whole Brazilian coastal zone are very low. Therefore, in spite of contamination problems in many ecosystems in the northern hemisphere, artificial radionuclide pollution appears to be negligible along the Brazilian coast. Phosphate fertilizer industries and petroleum processing facilities are the main economic activities producing Technologically Enhanced Naturally Occurring Radioactive Materials (TENORM). Even though a few attempts have been made to assess the radiological effects of these activities, their potential threats indicate a need for the radiological control of their wastes. This review showed that the number of studies within the field of environmental radioactivity is still small in Brazil and much more research is needed to understand processes of high interest for environmental managers. In the near future, it is likely that such studies in Brazil will move from descriptive
Radionuclides as tracers of coastal processes in Brazil: review, synthesis, and perspectives
Energy Technology Data Exchange (ETDEWEB)
Santos, Isaac R.; Burnett, William C., E-mail: santos@ocean.fsu.edu [Florida State University, Tallahassee, FL (United States). Dept. of Oceanography. Environmental Radioactivity Measurement Facility; Godoy, Jose M. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2008-04-15
We review the usefulness, limitations, significance, and coastal management implications of radionuclide measurements in Brazilian coastal environments. We focus on the use of radionuclides as tracers of sedimentary processes and submarine groundwater discharge (SGD). We also discuss artificial radionuclide contamination and high natural radioactivity areas. The interpretation of {sup 14}C-, {sup 137}Cs-, and {sup 210}Pb-derived sedimentation rates has provided evidence that inappropriate soil use by urban and agricultural activities has intensified erosion processes on land, which is reflected in depositional environments, such as coastal lagoons, estuaries and mangroves. Of the processes discussed in this paper, SGD is the one that requires the most scientific effort in the short-term. There have been only two case studies using {sup 222}Rn and radium isotopes as groundwater tracers in Brazil. These investigations showed that SGD can be a major source of nutrients and other dissolved species to the coastal ocean. Baseline {sup 137}Cs, {sup 90}Sr, {sup 239+240}Pu, and {sup 238}Pu concentrations in seawater from the whole Brazilian coastal zone are very low. Therefore, in spite of contamination problems in many ecosystems in the northern hemisphere, artificial radionuclide pollution appears to be negligible along the Brazilian coast. Phosphate fertilizer industries and petroleum processing facilities are the main economic activities producing Technologically Enhanced Naturally Occurring Radioactive Materials (TENORM). Even though a few attempts have been made to assess the radiological effects of these activities, their potential threats indicate a need for the radiological control of their wastes. This review showed that the number of studies within the field of environmental radioactivity is still small in Brazil and much more research is needed to understand processes of high interest for environmental managers. In the near future, it is likely that such studies
50 CFR 222.305 - Rights of succession and transfer of permits.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Rights of succession and transfer of... THREATENED MARINE SPECIES General Permit Procedures § 222.305 Rights of succession and transfer of permits... business activities in connection with a business or commercial enterprise, which is then subject to any...
International Nuclear Information System (INIS)
Bernard, S.R.; Ford, M.R.; Snyder, W.S.
1976-01-01
Some topics discussed are as follows: retention of 222 Rn in fat, bone, heart, muscle, skin, testes, and urinary bladder; retention equations for Rn; decay scheme for Rn and 226 Ra; metabolic models for Po, Pb, and Bi; dose estimates to target organs for 222 Rn and its daughters that are not inhaled but produced from decay of 222 Rn; and estimation of MPC for bone marrow, gonads, and total body
International Nuclear Information System (INIS)
Yoneda, Minoru; Inoue, Yoriteru; Yoshimoto, Keizo
1994-01-01
The activated charcoal passive collector method can be applied to measure the concentration of 222 Rn in river water. The 222 Rn collector is composed of dry activated charcoal sealed in a polyethylene bag. However, we found it very difficult to keep activated charcoal in a collector dry during the period the collector was left in a river. The degree of dampness and the time lapsed when activated charcoal became wet were thought to affect the quantity of 222 Rn collected. First, we studied the effect of some parameters in the activated charcoal passive collector method qualitatively in three experiments. We found that the quantity of 222 Rn collected in a collector was not so sensitive to the quantity of activated charcoal in the collector or the thickness of polyethylene film under the condition of wet activated charcoal, and that wet activated charcoal accumulated less 222 Rn than dry activated charcoal. We present some equations which could explain how much 222 Rn was collected in a collector when activated charcoal was submerged directly in water and when activated charcoal was packed in a polyethylene bag but completely wet. These equations were proved effective by being compared with the results of the other experiments. Finally, we recommended some conditions which proved useful when measuring at an actual river
49 CFR 222.41 - How does this rule affect Pre-Rule Quiet Zones and Pre-Rule Partial Quiet Zones?
2010-10-01
...-Rule Quiet Zone may be established by automatic approval and remain in effect, subject to § 222.51, if... Zone may be established by automatic approval and remain in effect, subject to § 222.51, if the Pre... 49 Transportation 4 2010-10-01 2010-10-01 false How does this rule affect Pre-Rule Quiet Zones and...
Measurement of radon 222 in drinking water and air by liquid scintillation
International Nuclear Information System (INIS)
Schoenhofer, F.
1991-01-01
This is a brief description of the liquid scintillation measuring method for determining radon 222 in drinking water and air. Discussed are the advantages of this method and its reliability or accuracy, as well as some conclusions from the results. (orig.) [de
Estimation of groundwater flow rate using the decay of 222Rn in a well
International Nuclear Information System (INIS)
Hamada, Hiromasa
1999-01-01
A method of estimating groundwater flow rate using the decay of 222 Rn in a well was investigated. Field application revealed that infiltrated water (i.e., precipitation, pond water and irrigation water) accelerated groundwater flow. In addition, the depth at which groundwater was influenced by surface water was determined. The velocity of groundwater in a test well was estimated to be of the order of 10 -6 cm s -1 , based on the ratio of 222 Rn concentration in groundwater before and after it flowed into the well. This method is applicable for monitoring of groundwater flow rate where the velocity in a well is from 10 -5 to 10 -6 cm s -1
Assessment of Effective Dose Equivalent of Indoor 222Rn Daughters in Inchass
International Nuclear Information System (INIS)
Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmad, A.A.
2000-01-01
The dominant component of natural radiation dose for the general population comes from the radon gas 222 Rn and its short-lived decay products, Ra A ( 214 Po), Ra B ( 214 Pb), Ra C ( 214 Bi), Ra C( 214 Po) in the breathing air. The objective of the present work is to assess the affective dose equivalent of the inhalation exposure of indoor 222 Rn for occupational workers. Average indon concentrations (Bqm -3 ) were monitored in several departments in Nuclear Research Center by radon monitor. We have calculated the lung dose equivalent and the effective dose equivalent for the Egyptian workers due to inhalation exposure of an equilibrium equivalent concentrations of radon daughters which varies from 0.27 to 2.5 mSvy -1 and 0.016 to 0.152mSvy -1 respectively. The annual effective doses obtained are within the accepted range of ICRP recommendations
Upregulation of miR-222 in both Helicobacter pylori-infected and ...
Indian Academy of Sciences (India)
MINA NOORMOHAMMAD
less-developed countries, stomach cancer among men is the third most frequently ... ulated host intracellular signalling pathways (Noto and Peek. 2012). Among the ... VGLL4 and RECK. A cell culture-based study has reported the association ... cDNA synthesis for miR-222 was achieved using a Universal. cDNA Synthesis ...
12 CFR 222.25 - Reasonable and simple methods of opting out.
2010-01-01
... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.25 Reasonable and... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery of... opt-out under the Act, and the affiliate marketing opt-out under the Act, by a single method, such as...
International Nuclear Information System (INIS)
Kritidis, Panaiotis; Angelou, Panaiotis.
1984-07-01
An express variant of the three-interval total alpha-counting filter method being suitable for the determination of elevated concentrations of 222 Rn decay products in air of increased humidity is described. The method has been used for the determination of radon daughters in air in the major radon spas of Loutraki. Concentrations of 222 Rn and 226 Ra in spa water have been determined as well. Annual effective dose equivalents for the personnel and the patients have been estimated. The need of certain radiation protection measures is pointed out. (author)
Energy Technology Data Exchange (ETDEWEB)
Hernandez A, A
1998-10-01
Concentration levels of {sup 222} Rn and {sup 226} Rn have been analyzed in water samples from boreholes belonging to the drinking water supply system around Toluca, Mexico. The {sup 222} Rn source is the decay of {sup 226} Rn within the solid matrix of the aquifer. The study was performed during the dry and rainy seasons. {sup 222} Rn concentration was determined by the liquid scintillation technique, {sup 226} Rn was determined by gamma spectrometry, the physicochemical parameters and bacteriological analysis were performed by conventional chemical techniques. Solubilized trace elements were determined by Inductively Coupled Plasma - Mass Spectrometry (Icp-Ms). The radon level fluctuations at the boreholes in Toluca city and Almoloya spring indicated differences in the radon content. At borehole Lodos Prietos 2, the temperature and radon level were systematically the highest in comparison with the other boreholes and the spring indicating a contribution of a regional flow to the water of this particular borehole. The result for {sup 226} Rn, the average {sup 222} Rn observed during the sampling period, no correspondence occurs between the radium and the radon content indicating that, radon is not supported by radium, but is incorporated into the water through fissures in the rocks in contact with the water. The radon levels obtained in house faucets which water is supplied by boreholes decrease as a function of the distance from the source borehole to the house. With the chemical composition of each one of the studied boreholes and spring a Piper diagram was draw indicating the kind of water. The boreholes and spring can be classified as bicarbonate calcium/magnesium. Almost no fluctuation on time was observed in the chemical species and trace elements only a slight increase was observed at the end of the rain season. At Almoloya, spring pollution with coliform bacteria and nitrates showed an anthropogenic contribution to the water deterioration probable and
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions for Earth Stations...) frequency band, operating with Geostationary Orbit (GSO) Satellites in the Fixed-Satellite Service. 25.222 Section 25.222 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES...
International Nuclear Information System (INIS)
Podstawczynska, A.; Pawlak, W.; Kozak, K.; Mazur, J.
2010-01-01
The objective of the study was to investigate temporal variability of outdoor radon ( 222 Rn) concentration registered in the center of Lodz (urban station), at Ciosny (rural station) and Krakow (suburban station) in relation to meteorological parameters (i.e. air temperature, temperature vertical gradient, wind speed, soil heat flux, volumetric water content in soil) with special consideration of urban-rural differences. Continuous measurements of 222 Rn concentration (at 60 min intervals) were performed at a height of 2 m above the ground using AlphaGUARD PQ2000PRO (ionization chamber) from January 2008 to May 2009. 222 Rn levels were characterized by a diurnal cycle with an early morning maximum and a minimum in the afternoon. The well-marked 24 h pattern of radon concentration occurred in summer at anticyclonic weather with cloudless sky, light wind and large diurnal temperature ranges. The urban measurement site was characterized by the lowest atmospheric 222 Rn concentration and an urban-rural differences of radon levels increased from winter to summer and during the nighttime periods. The maximum contrasts of 222 Rn levels between Lodz and Ciosny, reaching - 30 Bq m -3 , were registered in June and July during the urban heat island (UHI) phenomenon (a positive thermal anomaly of a city if compared to rural area) and strong thermal inversion near the ground in the rural area. (authors)
Energy Technology Data Exchange (ETDEWEB)
Fagundes, I.C.; Bonotto, D.M.; Jimenez-Rueda, J.R., E-mail: fagundes.isabella@gmail.com, E-mail: dbonotto@rc.unesp.br, E-mail: jairorjr@rc.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Sao Paulo, SP (Brazil)
2015-07-01
Uranium is a litophile element that migrates to crust together with other light silicates. This work evaluated the relationships among the concentrations of uranium, major oxides (SiO{sub 2}, Al{sub 2}O{sub 3}, Na{sub 2}O, K{sub 2}O, CaO, MgO, Fe{sub 2}O{sub 3}, MnO, TiO{sub 2}, P{sub 2}O{sub 5}) and organic matter in different horizons of a soil profile located over siltstone from Tatui Formation, Piracicaba River sub-basin, Sao Paulo State, Brazil. Different techniques were utilized for data acquisition, for instance, alpha spectrometry, X-ray fluorescence spectrometry and smectrophotometry. The major U concentrations were found in horizons enriched in Fe{sub 2}O{sub 3}, indicating its tending to be retained in iron oxides. (author)
48 CFR 1253.222 - Application of labor laws to Government acquisitions.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application of labor laws... DEPARTMENT OF TRANSPORTATION CLAUSES AND FORMS FORMS Prescription of Forms 1253.222 Application of labor laws... application of labor laws, as specified in (TAR) 48 CFR 1222.406-9: Form DOT F 4220.7, Employee Claim for Wage...
International Nuclear Information System (INIS)
Molerio Leon, LF; Fernandez Gomez, IM; Carrazana Gonzalez, J A
2012-01-01
This is a second and last paper on these theme and presents the typical behavior of Rn 222a nd 3H at the Northern Havana-Matanzas Heavy Oil Belt for the following cases: a) fresh ground waters (unaffected by sea water intrusion), b) fresh ground water affected by isolated advances of sea water intrusion, c) fresh ground water intruded by sea water, d) ground water affected by oil spill and e) ground water affected by produced water spill
Behaviour of 222Rn and its daughter products in open atmosphere
International Nuclear Information System (INIS)
Ondo-Estok, D.; Holy, K.; Stanys, T.; Polaskova, A.; Hola, O.
2003-01-01
In this contribution the influence of the meteorological conditions on activity concentrations of the outdoor 222 Rn and its daughter products is discussed in detail. In addition, the correlation between concentrations of measured radionuclides is studied and empirical relations for concentrations of radon daughter products are presented. he courses of the activity concentrations of 222 Rn and its short-lived decay products in the outdoor atmosphere are very similar even in some details. The average equilibrium factor F determined on the basis of our measurements in the outdoor atmosphere is approximately about 20 % lower than the value F recommended by UNSCEAR 1996 for the open air (F = 0,7). The obtained nonlinear relations between radon and its decay products reduce the applications of decay products in the atmospheric studies on one hand but on the other hand they can be useful at the calculation of the equilibrium equivalent radon concentration with the aim to determine the effective radon dose on the basis of the measurements of its activity concentrations only. (authors)
Geochemical behaviour of uranium and thorium in the waste of a uranium conversion facility
Fernandes, Teresa
2017-01-01
Los residuos contenidos en las balsas de decantación de la planta de conversión de uranio de Comurhex - Malvési, Francia, han sido caracterizados con el objectivo de investigar el comportamiento de uranio y torio en este entorno específico. El residuo es una sucesión de estratos heterogénea que comprende una mezcla de los efluentes del proceso con el suelo (que han tenido su origen en la re-construcción de los diques de las balsas, el efluente de lodo, y los antiguos desechos d...
International Nuclear Information System (INIS)
Sexsmith, K.S.
1996-01-01
This study examines hydrological, geological and geochemical controls on 222 Rn variability in groundwater in the Front Range of Colorado. Specific objectives of the study are: (1) to determine if there are any correlations or spatial relationships between 222 Rn and the geological, geochemical and hydrogeological data; and (2) to determine whether it is geochemically reasonable for observed 222 Rn levels to be the result of U and 226 Ra accumulation by fracture filling minerals. Domestic-water wells were sampled and tested to determine the local aquifer characteristics and aqueous geochemistry. A multivariate and staged approach was used in the data analyses. Analysis of variance tests were used to test for relationships between 222 Rn and the lithology of the study wells. The effects of rock-type were then removed from the chemical and hydrological variables by subtracting the mean value for each rock-type from each of the measured values within that rock-type (a residual transformation). Linear and linear multiple regression techniques were used to test for expected relationships between residual 222 Rn levels and these variables, and stepwise linear regressions were used to test for any unforeseen multivariate relationships in the data. Correlograms, distance-weighted average and inverse-distance-weighted average predictions were used to look for spatial relationships in the data
Directory of Open Access Journals (Sweden)
Neri Mercatelli
Full Text Available BACKGROUND: MiR-221 and miR-222 are two highly homologous microRNAs whose upregulation has been recently described in several types of human tumors, for some of which their oncogenic role was explained by the discovery of their target p27, a key cell cycle regulator. We previously showed this regulatory relationship in prostate carcinoma cell lines in vitro, underlying the role of miR-221/222 as inducers of proliferation and tumorigenicity. METHODOLOGY/PRINCIPAL FINDINGS: Here we describe a number of in vivo approaches confirming our previous data. The ectopic overexpression of miR-221 is able, per se, to confer a high growth advantage to LNCaP-derived tumors in SCID mice. Consistently, the anti-miR-221/222 antagomir treatment of established subcutaneous tumors derived from the highly aggressive PC3 cell line, naturally expressing high levels of miR-221/222, reduces tumor growth by increasing intratumoral p27 amount; this effect is long lasting, as it is detectable as long as 25 days after the treatment. Furthermore, we provide evidence in favour of a clinical relevance of the role of miR-221/222 in prostate carcinoma, by showing their general upregulation in patient-derived primary cell lines, where we find a significant inverse correlation with p27 expression. CONCLUSIONS/SIGNIFICANCE: These findings suggest that modulating miR-221/222 levels may have a therapeutic potential in prostate carcinoma.
222Rn Measurements in Dwellings of Argentina
International Nuclear Information System (INIS)
Gnoni, G.; Canoba, A.; Czerniczyniec, M.
2011-01-01
Radon gas ( 222 Rn) is responsible of about fifty per cent of the world population dose due to natural sources, being the most important pathway the inhalation of radon progeny, specially indoors. Radon concentration has been measured in dwellings at different locations in Argentina. The places selected to be evaluated are representative of the different geologic zones of the country. Near 3000 dwellings have been analyzed since 1983 up today. The measuring methods used in this case were track etched detectors, electrets and detectors based on activated charcoal adsorption. Two different methods with track etched detectors were used: a simple one, which determines only the average radon concentration, and a second one that measures both radon concentration and the equilibrium factor (F) between radon and its daughters. The last one is a method that uses two Makrofol passive track detectors in the same device. The average radon concentration value obtained from all the dwellings evaluated was 44.2 Bq.m-3. The annual effective dose calculated from this average concentration, using a dosimetric factor of 25 μSv.a- 1. (Bq.m -3 ) -1 , which assumes an equilibrium factor of 0.4, was 1.11 mSv. The average value obtained from the 222 dwellings evaluated by the second method was 49.3 Bq.m -3 and 0,37 the equilibrium factor, resulting the annual effective dose estimated 1,44 mSv. The measured equilibrium factor of 0,37 allows us to verify the assumed equilibrium factor of 0,4. Finally, radon levels in dwellings of Argentina are within the acceptable values for population, not being necessary to implement remedial actions, except in isolate cases that are still under study. (authors)
International Nuclear Information System (INIS)
Macacini, Jose Flavio
2008-01-01
The Brazilian uranium mining company (INB) processed 2.32 10 6 tons of uranium ore in its ore treatment unit (UTM - Caldas), located in the Pocos de Caldas plateau. During 16 years of operation, this unit discarded 2.39 10 6 tons of solid waste in a tailing dam, with an average activity concentration of 226 Ra of 7311 ± 184 Bq kg -1 . Most of the atoms of 222 Rn generated from the radioactive waste of the tailing dam remain bounded to the mineral structure. However, a fraction of these atoms can be released from the mineral structure and then emanate. Reaching the porous space of the waste piles, the 222 Rn moves towards the interface waste-atmosphere, exhaling into the atmosphere. The featuring properties of the 222 Rn transport and the biological damage caused by its progeny transform this small chain of radionuclides into a scourge of nature. Because of that, the dry area of the tailing dam was the scope of this work. A methodology was developed for quantifying the exhalation rate of 222 Rn. Moreover, the soil from its surroundings was experimentally evaluated as a cover material to reduce the exhalation of 222 Rn. A collector of 222 Rn was developed, being denominated 607. This collector was proved to be exact and precise after laboratory tests, when a standard for 222 Rn exhalation was prepared with caldasite, an uranium ore with high concentration of 226 Ra (26611 ± 581 Bq kg -1 ), crushed to the granulometric interval from 1.168 mm to 0.589 mm. The results of 222 Rn exhalation rate using the collector 607 were not influenced by the adsorption of water steam, considering sampling periods lower than 5 days and mass of water steam lower than 7 g. Sampling for measuring 222 Rn exhalation rates in the dry area of the tailing dam was carried out using the collector 607, following the experimental design established by the United States Environmental Protection Agency (US EPA). The average exhalation rate in the west part of the tailing dam was 1.30 ± 1.24 Bq m
Directory of Open Access Journals (Sweden)
Boris Schmitz
2018-04-01
Full Text Available Aim: MicroRNA-222 (miR-222 and miR-29c have been identified as important modulators of cardiac growth and may protect against pathological cardiac remodeling. miR-222 and -29c may thus serve as functional biomarkers for exercise-induced cardiac adaptations. This investigation compared the effect of two workload-matched high-intensity interval training (HIIT protocols with different recovery periods on miR-222 and -29c levels.Methods: Sixty-three moderately trained females and males (22.0 ± 1.7 years fulfilled the eligibility criteria and were randomized into two HIIT groups using sex and exercise capacity. During a controlled 4-week intervention (two sessions/week a 4 × 30 HIIT group performed 4 × 30 s runs (all-out, 30 s active recovery and a 8 × 15 HIIT group performed 8 × 15 s runs (all-out, 15 s active recovery. miR-222 and -29c as well as transforming growth factor-beta1 (TGF-beta1 mRNA levels were determined during high-intensity running as well as aerobic exercise using capillary blood from earlobes. Performance parameters were assessed using an incremental continuous running test (ICRT protocol with blood lactate diagnostic and heart rate (HR monitoring to determine HR recovery and power output at individual anaerobic threshold (IAT.Results: At baseline, acute exercise miR-222 and -29c levels were increased only in the 4 × 30 HIIT group (both p < 0.01, pre- vs. post-exercise. After the intervention, acute exercise miR-222 levels were still increased in the 4 × 30 HIIT group (p < 0.01, pre- vs. post-exercise while in the 8 × 15 HIIT group again no acute effect was observed. However, both HIIT interventions resulted in elevated resting miR-222 and -29c levels (all p < 0.001, pre- vs. post-intervention. Neither of the two miRNAs were elevated at any ICRT speed level at baseline nor follow-up. While HR recovery was improved by >24% in both HIIT groups (both p ≤ 0.0002 speed at IAT was improved by 3.6% only in the 4 × 30 HIIT group
International Nuclear Information System (INIS)
Harley, N.H.
1982-01-01
This report covers progress made from 1 June 1981 to 31 May 1982 in developing a continuous monitor which measures only 222 Rn without interference from the daughters. Five 222 Rn counters have been built which determine 222 Rn alone by alpha scintillation counting in the presence of an electret to remove the short-lived daughter products from the counting chamber. The chamber design is based on the work of Chittaporn et al., (1981) at New York University's Department of Environmental Medicine. The detection chamber is a 1.8 liter (12.7 cm diameter by 14 cm high) cylinder lined with zinc sulfide alpha phosphor. The detector sits directly on a 12.7 cm diameter phototube. The 5 units have calibration factors which range from 155 to 186 counts/hour per pCi 222 Rn/liter and an average background count of 6 counts/hour. The lower limit of detection for a one hour count is thus 0.03 pCi 222 Rn/l, well below environmental levels
Fast, C; Goldmann, W; Berthon, P; Tauscher, K; Andréoletti, O; Lantier, I; Rossignol, C; Bossers, A; Jacobs, J G; Hunter, N; Groschup, M H; Lantier, F; Langeveld, J P M
2017-09-19
Breeding towards genetic resistance to prion disease is effective in eliminating scrapie. In sheep, classical forms of scrapie have been eradicated almost completely in several countries by breeding programs using a prion protein (PrP) gene (PRNP) amino acid polymorphism. For goats, field and experimental studies have provided evidence for several amino acid polymorphisms that are associated with resistance to scrapie, but only limited data are available concerning the susceptibility of caprine PRNP genotypes to BSE. In this study, goat kids representing five PRNP genotypes based on three polymorphisms (M142, Q211 and K222 and the wild type I142, R211 and Q222) were orally challenged with bovine or goat BSE. Wild type goats were killed with clinical signs between 24-28 months post inoculation (mpi) to both challenges, and goats with genotype R/Q211 succumbed between 29-36 mpi. I/M142 goats developed clinical signs at 44-45 mpi and M/M142 goats remained healthy until euthanasia at 48 mpi. None of the Q/K222 goats showed definite clinical signs. Taken together the highest attack ratios were seen in wild type and R/Q211 goats, and the lowest in I/M142, M/M142 and Q/K222. In all genotype groups, one or more goats remained healthy within the incubation period in both challenges and without detectable PrP deposition in the tissues. Our data show that both the K222 and M142 polymorphisms lengthen the incubation period significantly compared to wild type animals, but only K222 was associated with a significant increase in resistance to BSE infection after oral exposure to both BSE sources.
Design and construction of a system to determine Radon-222 through alpha spectroscopy
International Nuclear Information System (INIS)
Bonifacio M, J.
1991-01-01
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
EFFECTS OF ANESTHESIA (MS222) ON LIVER BIOTRANSFORMATION IN RAINBOW TROUT (ONCORHYNCHUS MYKISS)
Tricaine methanesulfonate (3-aminobenzoic acid ethyl ester methanesulfonate; MS222) is a widely used fish anaesthetic. While there have been several studies addressing the impact of its use on subsequently measured biotransformation rates, the measured influence on normal functio...
Hernández-Ceballos, M A; Vargas, A; Arnold, D; Bolívar, J P
2015-07-01
The combined analysis of (222)Rn activity concentrations and mesoscale meteorological conditions at Huelva city (Spain) was addressed in this study to understand the potential impact of phosphogypsum piles on the (222)Rn activity concentrations registered at this area. Hourly mean data from April 2012 to February 2013 registered at two sampling sites (Huelva city and in the background station of El Arenosillo, located 27 km to the south-east) have been used in the study. The results of the present study showed a large difference in mean radon concentrations between the two stations during the sampling period, 6.3 ± 0.4 Bq m(-3) at Huelva and 3.0 ± 0.2 Bq m(-3) at El Arenosillo. The analysis has demonstrated that hourly (222)Rn concentrations at Huelva city above 22 Bq m(-3), with nocturnal peaks up to 50 Bq/m(3), mainly coincided with the occurrence of a pure sea-land breeze cycle. Mesoscale circulations in this region are mainly characterized by two patterns of sea-land breeze, pure and non-pure, with the phosphosypsum piles directly upstream (south) of the city during the afternoon on pure sea-breeze days. The difference between mean (222)Rn activity concentrations at Huelva city were 9.9 ± 1.5 Bq m(-3) for the pure pattern and 3.3 ± 0.5 Bq m(-3) for the non-pure pattern, while in the background station concentrations were 3.9 ± 0.4 Bq m(-3) and 2.8 ± 0.4 Bq m(-3) respectively. Considering these large differences, a detailed analysis of composites and case studies of representative sea-land breeze cycles of both types and their impact on (222)Rn activity concentration was performed. The results suggested that the presence of the phosphogypsum piles was necessary in order to justify the high (222)Rn activity concentrations observed at Huelva compared with the background station in the afternoons on pure sea breeze days (1.5-2.0 Bq m(-3)). On the other hand, large night time differences between the two sites on these days were
20 CFR 222.30 - When determinations of relationship as child are made.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determinations of relationship as child... RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.30 When determinations of... determination will be made regarding a claimant's relationship as the child of the employee when the claimant...
International Nuclear Information System (INIS)
Przylibski, Tadeusz A.; Gorecka, Joanna
2014-01-01
Based on research conducted in three Variscan granitoid massifs located within the crystalline Bohemian Massif, the authors confirmed that the higher the degree of their erosional dissection, the smaller the concentration of 222 Rn in groundwaters circulating in these massifs. This notion implies that radon waters and high-radon waters, from which at least some of the dissolved radon should be removed before feeding them as drinking water to the water-supply system, could be expected in granitoid massifs which have been poorly exposed by erosion. At the same time, such massifs must be taken into account as the areas of possible occurrence of radon medicinal waters, which in some countries can be used for balneotherapy in health resorts. Slightly eroded granitoid massifs should be also regarded as very probable radon prone areas or areas of high radon potential. - Highlights: • The concentration of 222 Rn in groundwater depends on the zone of the granitoid massif which is exposed on the ground surface. • The highest 222 Rn concentrations occur in the least eroded granitoid massifs, the lowest in massifs with exposed root parts. • The stronger the erosional dissection of a granitoid massif, the lower 222 Rn concentration in groundwaters in this massif. • Not all granitoid massifs are areas with groundwaters containing high concentrations of 222 Rn. • The least eroded granitoid massifs are radon prone areas with the occurrence of high-radon and radon groundwaters
Tricaine methanesulfonate (3-aminobenzoic acid eithyl ester methanesulfonate, tricaine, MS-222, Finquel), an anesthetic for fish, has been used extensively in aquatic toxicology to allow surgical procedures for in vivo studies and to permit in vitro preparations of isolated perfu...
25 CFR 1000.222 - How does a Tribe/Consortium obtain a waiver?
2010-04-01
... ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.222 How does a Tribe/Consortium obtain a waiver? To...; (b) Identify the regulation to be waived and the reasons for the request; (c) Identify the programs...
48 CFR 52.222-49 - Service Contract Act-Place of Performance Unknown.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Service Contract Act-Place... Provisions and Clauses 52.222-49 Service Contract Act—Place of Performance Unknown. As prescribed in 22.1006(f), insert the following clause: Service Contract Act—Place of Performance Unknown (MAY 1989) (a...
2010-02-23
... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...
Energy Technology Data Exchange (ETDEWEB)
Villalba, L.; Colmenero S, L.; Montero C, M.E. [Centro de Investigacion en Materiales Avanzados (CIMAV), Av. Miguel de Cervantes Saavedra 120, 31109 Chihuahua (Mexico)]. e-mail: lourdes.villalba@cimav. edu. mx
2004-07-01
The study of the content of dissolved Rn{sup 222} is presented in underground water and of domicile of the cities of Chihuahua and Aldama of the State of Chihuahua. The existence of the Rn{sup 222} in the underground waters comes from its constant production in the rocks of the terrestrial bark. It has been determined that the radon is a noble gas of more solubility in the water, this solubility induces high concentrations in underground water, as well as bigger risk to the health in the human body once ingested or inhaled. Of the 32 wells studied in the cities of Chihuahua and Aldama, the content of dissolved Rn{sup 222} in the water of 22 of them is bigger than 11 Bq/l and of 73 studied samples of water of domiciles 47 show bigger values that 11 Bq/l. These radon contents are attributable to the uraniferous rocks present in the aquifers. (Author)
International Nuclear Information System (INIS)
Hernandez A, A.
1998-01-01
Concentration levels of 222 Rn and 226 Rn have been analyzed in water samples from boreholes belonging to the drinking water supply system around Toluca, Mexico. The 222 Rn source is the decay of 226 Rn within the solid matrix of the aquifer. The study was performed during the dry and rainy seasons. 222 Rn concentration was determined by the liquid scintillation technique, 226 Rn was determined by gamma spectrometry, the physicochemical parameters and bacteriological analysis were performed by conventional chemical techniques. Solubilized trace elements were determined by Inductively Coupled Plasma - Mass Spectrometry (Icp-Ms). The radon level fluctuations at the boreholes in Toluca city and Almoloya spring indicated differences in the radon content. At borehole Lodos Prietos 2, the temperature and radon level were systematically the highest in comparison with the other boreholes and the spring indicating a contribution of a regional flow to the water of this particular borehole. The result for 226 Rn, the average 222 Rn observed during the sampling period, no correspondence occurs between the radium and the radon content indicating that, radon is not supported by radium, but is incorporated into the water through fissures in the rocks in contact with the water. The radon levels obtained in house faucets which water is supplied by boreholes decrease as a function of the distance from the source borehole to the house. With the chemical composition of each one of the studied boreholes and spring a Piper diagram was draw indicating the kind of water. The boreholes and spring can be classified as bicarbonate calcium/magnesium. Almost no fluctuation on time was observed in the chemical species and trace elements only a slight increase was observed at the end of the rain season. At Almoloya, spring pollution with coliform bacteria and nitrates showed an anthropogenic contribution to the water deterioration probable and fertilizers and detritus. Most of the studied water
International Nuclear Information System (INIS)
Abdurabu, Wedad Ali; Ramli, Ahmad Termizi; Saleh, Muneer Aziz; Heryansyah, Arien
2016-01-01
This study aims to evaluate the activity concentrations of 222 Rn and to assess the corresponding health risk in groundwater samples obtained in Juban District, Ad Dali’ Governorate, Yemen. The measurements were performed by RAD 7 radon detector manufactured by DURRIDGE COMPANY Inc. The activity concentrations of 222 Rn ranged from 1.0±0.2 Bq l −1 to 896.0±0.8 Bq l −1 . 57% of the groundwater samples were above the US Environmental Protection Agency (USEPA) recommended value for Rn in water. Induced coupled plasma mass spectrometry (ICP-MS) was used to determine the concentrations of uranium in groundwater samples. The measured concentration of U ranged from 0.33±0.01 μg l −1 to 24.6±0.6 μg l −1 . The results were comparable to internationally recommended values. The highest concentration of U and 222 Rn were found to be in the basement aquifer, while the lowest concentrations of both radionuclides were in the sandstone aquifer. High concentrations of Rn are found along fault zones. The relationship between the activity concentration of 222 Rn, concentration of U and physicochemical parameters were investigated. The results showed a very strong relationship between activity concentrations of 222 Rn with concentrations of U and the salinity of water. - Highlights: • The highest concentration of U and 222 Rn was found to be in the basement aquifer. • A 57% of the groundwater samples were above the USEPA recommended value. • Mean annual effective dose for ingestion was 24 times the world average. • Mean annual effective dose for inhalation was 23 times the world. • Strong relationship between 222 Rn with concentration of U in the basement aquifer.
International Nuclear Information System (INIS)
Rabi, Jose A.; Mohamad, Abdulmajeed A.
2004-01-01
The first part of this paper proposes a steady-state 2-D model for 222 Rn transport in phosphogypsum stacks. In this second part, the dimensionless model equations are solved numerically with the help of an existing finite-volume simulator that has been successfully used to solve heat and mass transfer problems in porous media. As a test case, a rectangular shaped stack is considered in order to verify the ability of the proposed parametric approach to account for concurrent effects on the 222 Rn exhalation into the local atmosphere. Air flow is supposed to be strictly buoyancy driven and the ground is assumed to be impermeable to 222 Rn and at a higher temperature under the stack base. Dimensionless controlling parameters are set to representative values and results are presented for Grashof number in the range 10 6 ≤Gr≤ 10 8 , corresponding to very small to small temperature differences between incoming air and ground underneath the stack base. For the particular set of parameters and inasmuch as Gr increases, streamlines presented basically the same pattern while internal isotherms and iso concentration lines remained almost unchanged. Total average Sherwood number proved to be rather insensitive to Gr while total average Nusselt increased slightly with Gr. (author)
Relationship of 220Rn and 222Rn progeny levels in Canadian underground U mines
International Nuclear Information System (INIS)
Bigu, J.
1988-01-01
Radon-222 and 220 Rn progeny are found in some Canadian underground U mines. Because both can contribute to lung dose, their experimental determinations are important. The relationship between 222 Rn progeny Working Level [WL(Rn)] and 220 Rn progeny Working Level [WL(Tn)] has been investigated in U mines. Experimental measurements extended from 1981 to 1986 and consisted of about 700 measurements of each WL(Rn) and WL(Tn). The data were analyzed by standard linear and power-function regression analysis. A power-function relationship between WL(Rn) and WL(Tn) seemed to fit the experimental data best. The relationship obtained permits the calculation of WL(Tn) from experimental values of WL(Rn). The relationship is useful for lung-dose-calculation purposes and in mine-ventilation-engineering calculations
International Nuclear Information System (INIS)
Morris, R.C.; Fraley, L. Jr.
1989-01-01
We measured 222 Rn fluence rate and several environmental variables on two plots with U mill tailings buried beneath 30 cm of overburden and 20 cm of topsoil. An additional 30 cm of clay covered the tailings on one plot and each plot was subdivided into bare soil and vegetated subplots. We used linear correlation, two-way ANOVA and stepwise multiple regression to analyze the effects of the plot characteristics and the environmental variables on 222 Rn fluence rate. The most important effect on 222 Rn fluence rates from these plots was the combination of a clay cap and a vegetated surface. The mean annual fluence rate from the plot having both of these characteristics (520 +/- 370 mBq m-2 s-1) was over three times that of the vegetated plot without a clay cap (170 +/- 130 mBq m-2 s-1) and 18 times that of the bare plot with a clay cap (29 +/- 13 mBq m-2 s-1). The interaction effect may have been due to the growth of roots in the moist clay and active transport of dissolved 222 Rn to the surface in water. This speculation is supported by the observation that on vegetated plots with a clay cap, moisture in the clay enhanced the fluence rate
Directory of Open Access Journals (Sweden)
Vanderly Janeiro
2010-09-01
Full Text Available We determined the occurrence of human cases of intestinal parasites and their spatial distribution in an agricultural center of the state of Paraná in southern Brazil. Results from 5,219 stool examinations carried out in 2003 and 2004 in public and private clinical-pathology laboratories were analyzed. The overall occurrence of intestinal parasites was 19.8%. Entamoeba coli (7.2% and Giardia duodenalis (5.2% were the most frequent species. E. coli was present in 36.4%, G. duodenalis in 26.2% and E. nana in 13.6% of positive cases. According to spatial distribution, the highest occurrence of intestinal parasites was observed in the Piquiri/Guarujá area (p G. duodenalis (22.2% and E. coli (7.4%. Significant differences in the occurrence of enteroparasites were observed for females (p We determined the occurrence of human cases of intestinal parasites and their spatial distribution in an agricultural center of the state of Paraná in southern Brazil. Results from 5,219 stool examinations carried out in 2003 and 2004 in public and private clinical-pathology laboratories were analyzed. The overall occurrence of intestinal parasites was 19.8%. Entamoeba coli (7.2% and Giardia duodenalis (5.2% were the most frequent species. E. coli was present in 36.4%, G. duodenalis in 26.2% and E. nana in 13.6% of positive cases. According to spatial distribution, the highest occurrence of intestinal parasites was observed in the Piquiri/Guarujá area (p G. duodenalis (22.2% and E. coli (7.4%. Significant differences in the occurrence of enteroparasites were observed for females (p < 0.05 and children 0 to 10 years of age (p < 0.05. The occurrence of intestinal parasites in the municipality was mostly related to children, females, and residence in rural areas and the peripheries of urban centers, where the risk of infection is greater. This information will allow the development of appropriate measures for disease prevention and optimization of resources.
Energy Technology Data Exchange (ETDEWEB)
Care, A; Bonci, D [Department of Haematology, Oncology and Molecular Medicine, Istituto Superiore di Sanita, Rome (Italy); Peschle, C [IRCCS MultiMedica, Milan (Italy)
2009-07-01
Micro RNAs (miRs) are small ({approx}22 nucleotides) non coding RNAs involved in gene expression, as negative regulators of specific mRNA targets. Growing evidences indicated miR functional roles in all the main biological processes, including cancer where they can act as oncogenes as well as tumor suppressor genes. Several studies reported the involvement of miR- 221 and -222 in the induction and/or progression of different neoplasias. We have analyzed miR-221/-222 functional role in a panel of differently staged melanoma cell lines and primary bioptic samples, showing their capabilities to regulate two distinct, but functionally convergent pathways of melanocyte transformation through the cell cycle inhibitor p27Kip and c-kit receptor. We also demonstrated the lack of the tumor suppressor gene PLZF as a direct cause of miR-221/-222 up regulation in melanoma cells. In vitro and, more important, in vivo studies confirmed that suppression of miR-221/-222 strongly reduced melanoma growth and dissemination.
International Nuclear Information System (INIS)
Care, A.; Bonci, D.; Peschle, C.
2009-01-01
Micro RNAs (miRs) are small (∼22 nucleotides) non coding RNAs involved in gene expression, as negative regulators of specific mRNA targets. Growing evidences indicated miR functional roles in all the main biological processes, including cancer where they can act as oncogenes as well as tumor suppressor genes. Several studies reported the involvement of miR- 221 and -222 in the induction and/or progression of different neoplasias. We have analyzed miR-221/-222 functional role in a panel of differently staged melanoma cell lines and primary bioptic samples, showing their capabilities to regulate two distinct, but functionally convergent pathways of melanocyte transformation through the cell cycle inhibitor p27Kip and c-kit receptor. We also demonstrated the lack of the tumor suppressor gene PLZF as a direct cause of miR-221/-222 up regulation in melanoma cells. In vitro and, more important, in vivo studies confirmed that suppression of miR-221/-222 strongly reduced melanoma growth and dissemination
Energy Technology Data Exchange (ETDEWEB)
Takata, Shigeru; Saito, Masaaki (Tokyo Metropolitan Isotope Research Center (Japan))
1991-02-01
Measuring techniques for environmental {sup 3}H, {sup 14}C and {sup 222}Rn with a liquid scintillation counter have been studied. {sup 3}H in environmental water was enriched by electrolysis and measured with a low background liquid scintillation counter. By this technique, {sup 3}H concentration of ground water, river water, sea water and rain water at Tokyo was founded to be 0.1 {approx} 2.5 Bq/1. {sup 14}C in taurine and ethyl-alcohol was measured directly liquid scintillation counter. By this {sup 14}C measuring, natural products, contain low level {sup 14}C, were distinguished from synthesised products contain no {sup 14}C. {sup 222}Rn in toluene extracted from environmental water or air was measured by scintillation pulse interval analysis method. By this technique, {sup 222}Rn was able to be measured under very low background counting rate, 0.03cpm, and high efficiency. (author).
International Nuclear Information System (INIS)
Fields, D.E.; Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.
1979-12-01
The report represents a compilation of computer codes used to estimate potential human exposures and inhalation doses due to unit releases of 222 Rn from uranium milling sites in western United States. The populations considered for potential exposure to risk from 222 Rn and associated daughters are the inhabitants of North America between 20 0 and 60 0 North latitude. The primary function of these codes is to integrate spatially atmospheric radionuclide concentrations with current population data for the geographic area under consideration. It is expected that these codes will be of assistance to anyone interested in assessing nuclear or nonnuclear population exposures over large geographic areas
International Nuclear Information System (INIS)
Hernandez, A.; Aranda, P.; Ceballos, S.; Cruz, D.; Jauregui, B.; Lopez, R.; Pena, P.; Salazar, S.; Segovia, N.; Tamez, E.
1997-01-01
In this work it is realized a geochemical study which includes the evaluation of 222 Rn concentration in drinking water wells at Toluca city and a spring water of Almoloya de Juarez municipality at State of mexico. the same is studied about evolution of 222 Rn concentration in water of the hydrating which supply it to those wells. the geochemical evaluation also covers the determination of major and minor elements or trace and the biological analysis of water. The study includes two seasonal cycles, the low water mark one and other the rainy for being able to evaluate the aquifers reloading effects in the water composition. (Author)
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What disparity standard must a State meet in order to be certified and how are disparities in current expenditures or revenues per pupil measured? 222.162... of the Act § 222.162 What disparity standard must a State meet in order to be certified and how are...
222Rn in the Antarctic Peninsula during 1986
International Nuclear Information System (INIS)
Pereira, E.B.; Setzer, A.W.; Cavalcanti, I.F.A.
1988-01-01
222 Rn was continuously measured at the Brazilian Antarctic Station (62 0 S, 58 0 W) during the year of 1986. Baseline radon concentration averaged 0.02 Bq.m -3 with surges peaking 0.4 Bq.m -3 . The data exhibited a characteristic periodicity of about 25 days and a strong positive association with short term fluctuations of atmospheric temperature. No seasonal variations of radon were observed. Interpretation of the radon surges with reference to synoptic charts and weather satellite pictures showed that the continental influence of radon at the Antarctic Peninsula is very small and comes only from the tip of the South American cone. (author)
Energy Technology Data Exchange (ETDEWEB)
Hamard, J; Beau, P G; Ergas, A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires, departement de la protection sanitaire, service d' hygiene atomique
1968-09-01
In order to verify the validity of the values proposed for the maximum permissible concentration of {sup 222}Rn in air, one can either approach the problem: - by epidemiological studies tending to determine the relation dose-effect both quantitatively and qualitatively; - or by choosing a lung model and clearance constants allowing a more accurate determination of the delivered dose and the localisation of the more severely irradiated portions of the bronchial tree. The radon MPC have been calculated using the model and the respiration constants set up by the I.C.R.P. Task Group on Lung dynamics. Two cases have been considered, i.e. when the radon daughter products behave as soluble materials and as insoluble ones. The values which have been found have been compared with those given up to now by several national and international bodies. (authors) [French] Deux voies d'approche peuvent etre empruntees pour verifier la validite des valeurs proposees pour la concentration maximale admissible du radon 222 dans l'air: - etudes epidemiologiques tendant a preciser qualitativement et quantitativement la relation dose-effet; - choix d'un modele pulmonaire et de constantes d'epuration permettant une determination plus precise de la dose delivree et la localisation des segments de l'arbre pulmonaire les plus irradies. Les auteurs ont utilise pour le calcul de la CMA du radon le modele et les constantes respiratoires proposees par le Task Group on Lungs dynamics de la C.I.P.R. On a pris en consideration le cas ou les descendants du radon se comportent comme des substances solubles et celui ou ils se comportent comme des substances insolubles. Les valeurs trouvees sont comparees a celles proposees jusqu'alors par divers organismes nationaux et internationaux. (auteurs)
Photochemistry of acrylates at 222 nm
International Nuclear Information System (INIS)
Knolle, Wolfgang; Naumov, Sergej; Madani, Mohamed; Sonntag, Clemens von
2005-01-01
Excimer lamps as monochromatic UV sources with an intense short-wavelength emission (especially KrCl * , 222 nm) allow a photoinitiator-free initiation of the acrylate polymerisation. Laser photolysis (KrCl * excimer laser, pulse width 20 ns, up to 5 mJ per pulse) gives rise to similar transient spectra (λ max ∼ 280 nm) for all acrylates studied. As the rather unspecific spectra do not allow conclusions as to the main reaction channel, a product study has been performed by GC-MS following steady-state photolysis of acrylate solutions in acetonitrile, methanol and n-hexane. Somewhat unexpected, α-cleavage seems to be a main reaction channel, and quantum chemical calculations show that such a reaction can occur from either the excited singlet state or the unrelaxed triplet state, but not from the relaxed triplet state that is observed spectroscopically. A reaction scheme accounting for the observed products is presented
Energy Technology Data Exchange (ETDEWEB)
Valberg, Anna Helene
2011-07-01
This report examines the role played by Brazil in connection with certain international negotiations, such as the climate negotiations and the CBD. It identifies the driving factors that have influenced environmental politics and standards in Brazil, and take note of conflicts that must be discussed when Norway is seeking expanded cooperation with Brazil. In line with the mandate, FNI identifies areas of particular interest for further collaboration between the two countries, and recommend directions for supplementary Norwegian policy-making in light of a broadened scope for Norway-Brazil interaction. In recent years, the Norwegian government has initiated an extensive process aimed at reducing emissions from deforestation and forest degradation (REDD). This is the most obvious shared environmental scope between Norway and Brazil. However, given the large body of literature that already exists on this field, this report will concentrate instead on issues more on the outskirts of the REDD discourse, such as biodiversity conservation, biofuel efficiency and challenges concerning hydropower, all of which threaten to impact negatively on the Amazonian areas. In our recommendations, we cite tangible examples to illustrate issues where we believe lessons learnt in Norway may have applicability to Brazil.(auth)
Using 222Rn as a tracer of geodynamical processes in underground environments
International Nuclear Information System (INIS)
Valladares, D.L.; Silva, A.A.R. da; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Lacerda, T.; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Anjos, R.M.; Rizzotto, M.; Velasco, H.; Rosas, J.P. de; Tognelli, G.
2014-01-01
Radon levels in two old mines in San Luis, Argentina, were measured and analyzed, with the aim to assess the potential use of this radioactive noble gas as a tracer of geological processes in underground environments. La Carolina gold mine and Los Cóndores tungsten mine are today used as tourism mines. CR-39 nuclear track detectors were used for this purpose. Measurements were performed during both winter and summer seasons. The findings show that in these environments, significant radon concentrations are subject to large seasonal fluctuations, due to the strong dependence on natural ventilation with the outside temperature variations. For both mines, higher concentration values of 222 Rn were observed in summer than in winter; with an extreme ratio of 2.5 times between summer and winter seasons for Los Cóndores mine. The pattern of radon transport inside La Carolina mine revealed, contrary to what was believed, that this mine behaves as a system with two entrances located at different levels. However, this feature can only be observed in the winter season, when there is a marked difference between the inside and outside temperatures of the mine. In the case of Los Cóndores mine, the radon concentration pattern distribution is principally established by air current due to chimney-effect in summer and winter seasons. In both cases, the analyses of radon pattern distribution appear as a good method to trace air currents, and then localize unknown ducts, fissures or secondary tunnels in subterranean environments. - Highlights: • 222 Rn levels in two old mines in San Luis, Argentina • CR-39 nuclear track detectors were used for this purpose • higher concentration values of 222 Rn were observed in summer than in winter • radon pattern distribution appear as a good method to trace air currents • it localizes unknown ducts, fissures or secondary tunnels in subterranean environments
48 CFR 3053.222-70 - Application of labor laws to Government acquisitions.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Application of labor laws... Prescription of Forms 3053.222-70 Application of labor laws to Government acquisitions. The following form is prescribed for use in connection with the application of labor laws, as specified in (HSAR) 48 CFR 3022.406-9...
International Nuclear Information System (INIS)
Colle, R.; Unterweger, M.P.; Hutchinson, J.M.R.
1996-01-01
As part of an international measurement intercomparison of instruments used to measure atmospheric 222 Rn, four participating laboratories made nearly simultaneous measurements of 222 Rn activity concentration in commonly sampled, ambient air over approximately a 2 week period, and three of these four laboratories participated in the measurement comparison of 14 introduced samples with known, but undisclosed (blind) 222 Rn activity concentration. The exercise was conducted in Bermuda in October 1991. The 222 Rn activity concentrations in ambient Bermudian air over the course of the intercomparison ranged from a few hundredths of a Bq · m -3 to about 2 Bq · m -3 , while the standardized sample additions covered a range from approximately 2.5 Bq · m -3 to 35 Bq · m -3 . The overall uncertainty in the latter concentrations was in the general range of 10%, approximating a 3 standard deviation uncertainty interval. The results of the intercomparison indicated that two of the laboratories were within very good agreement with the standard additions, and almost within expected statistical variations. These same two laboratories, however, at lower ambient concentrations, exhibited a systematic difference with an averaged offset of roughly 0.3 Bq · m -3 . The third laboratory participating in the measurement of standardized sample additions was systematically low by about 65% to 70%, with respect to the standard addition which was also confirmed in their ambient air concentration measurements. The fourth laboratory, participating in only the ambient measurement part of the intercomparison, was also systematically low by at least 40% with respect to the first two laboratories
International Nuclear Information System (INIS)
Anon.
2000-01-01
Almost all the electric power in Brazil comes from large-scale hydroelectric plants: only about 3% comes from cogeneration. But, now that the barriers which discouraged cogeneration are being removed, there will be more and more investment in cogeneration and distributed generation. The circumstances which have brought about these changes are described. It is expected that cogeneration will be responsible for producing 10-15% of Brazil's electricity by 2010 and the demand for cogeneration will reach 11-17 GW. It is concluded that Brazil represents one of the world's most attractive market for cogeneration and distributed generation
Tan, Y.; Yuan, H.; Kearfott, K. J.
2018-04-01
CR-39 detectors are widely used to measure environmental levels of Rn-222, Rn-220 and their progeny. Prior research reported the CR-39 detection efficiency for alpha particles from Rn-222, Rn-220 and their progeny under a variety of etching conditions. This paper provides an explanation for interesting observations included in that work, namely that the critical incidence angle decreases with the increasing particle energy and the detection efficiency for 8.78 MeV alpha particles is zero. This paper explains these phenomena from a consideration of the interaction of alpha particles with the CR-39 detectors and the physics of etching dynamics. The proposed theory provides a rationale for an approach to optimizing the etching conditions of CR-39 detector for measuring Rn-222, Rn-220 and their progenies.
Energy Technology Data Exchange (ETDEWEB)
Sexsmith, K.S.
1996-12-31
This study examines hydrological, geological and geochemical controls on {sup 222}Rn variability in groundwater in the Front Range of Colorado. Specific objectives of the study are: (1) to determine if there are any correlations or spatial relationships between {sup 222}Rn and the geological, geochemical and hydrogeological data; and (2) to determine whether it is geochemically reasonable for observed {sup 222}Rn levels to be the result of U and {sup 226}Ra accumulation by fracture filling minerals. Domestic-water wells were sampled and tested to determine the local aquifer characteristics and aqueous geochemistry. A multivariate and staged approach was used in the data analyses. Analysis of variance tests were used to test for relationships between {sup 222}Rn and the lithology of the study wells. The effects of rock-type were then removed from the chemical and hydrological variables by subtracting the mean value for each rock-type from each of the measured values within that rock-type (a residual transformation). Linear and linear multiple regression techniques were used to test for expected relationships between residual {sup 222}Rn levels and these variables, and stepwise linear regressions were used to test for any unforeseen multivariate relationships in the data. Correlograms, distance-weighted average and inverse-distance-weighted average predictions were used to look for spatial relationships in the data.
5 CFR 591.222 - How does OPM use the expenditure weights to combine price indexes?
2010-01-01
... MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.222 How does OPM use the expenditure weights to...
222Rn determination in some thermal baths of a central eastern Italian area
International Nuclear Information System (INIS)
Desideri, D.; Bruno, M.R.; Roselli, C.
2004-01-01
Some recent Italian laws, based on the Euratom Directive 26/96, introduce the obligation of monitoring the exposition to natural radioactivity in particular worksites (thermal baths, mines, basements, etc.). Results of 222 Rn measurements in some thermal baths of Rimini and Pesaro-Urbino provinces (Central Eastern Italy), by Radosys-2000, a complete set suitable to radon concentration measurements with CR-39 plastic alpha-track detectors are reported. Some areas where radon could accumulate (bathing, reaction, muddy, inhalation, insufflation rooms and swimming pools) were selected for the investigation. The dosimeters have been exposed for 98 days. The results show that 222 Rn concentrations are very low in the considered thermal baths (7-71 Bq x m -3 ). Moreover, no difference was observed between the concentrations measured in the therapy rooms (bathing, muddy, inhalation and insufflation rooms, swimming pools) and in the normal areas (passages, reaction rooms, dressing rooms, etc.). The calculated dose contribution to workers was about one tenth of the legally suggested value. (author)
Directory of Open Access Journals (Sweden)
Bohannon Sean B
2004-12-01
Full Text Available Abstract Background Homozygosity or compound heterozygosity for coding region mutations of the hemojuvelin gene (HJV in whites is a cause of early age-of-onset iron overload (juvenile hemochromatosis, and of hemochromatosis phenotypes in some young or middle-aged adults. HJV coding region mutations have also been identified recently in African American primary iron overload and control subjects. Primary iron overload unexplained by typical hemochromatosis-associated HFE genotypes is common in white and black adults in Alabama, and HJV I222N and G320V were detected in a white Alabama juvenile hemochromatosis index patient. Thus, we estimated the frequency of the HJV missense mutations I222N and G320V in adult whites and African Americans from Alabama general population convenience samples. Methods We evaluated the genomic DNA of 241 Alabama white and 124 African American adults who reported no history of hemochromatosis or iron overload to detect HJV missense mutations I222N and G320V using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP technique. Analysis for HJV I222N was performed in 240 whites and 124 African Americans. Analysis for HJV G320V was performed in 241 whites and 118 African Americans. Results One of 240 white control subjects was heterozygous for HJV I222N; she was also heterozygous for HFE C282Y, but had normal serum iron measures and bone marrow iron stores. HJV I222N was not detected in 124 African American subjects. HJV G320V was not detected in 241 white or 118 African American subjects. Conclusions HJV I222N and G320V are probably uncommon causes or modifiers of primary iron overload in adult whites and African Americans in Alabama. Double heterozygosity for HJV I222N and HFE C282Y may not promote increased iron absorption.
Volume activity of 222Rn in the atmosphere of the nearby localities with the different orography
International Nuclear Information System (INIS)
Bulko, M.; Holy, K.; Polaskova, A.; Simon, J.; Hola, O.
2006-01-01
The monitoring of the volume activity of 222 Rn in the outdoor atmosphere was carried out in two areas - on the Faculty of Mathematics, Physics and Informatics, Comenius University (FMPI CU) and on the Slovak Metrological Institute (SMI) in Bratislava. The most significant differences were found out in the average daily courses of the 222 Rn volume activity for summer months, which show the different amplitudes and a relative displacement of a couple of hours. A possible reason for this can be that while on the FMPI CU there the solar radiation flux is not shielded by the terrain obstacles, the SMI measurement area is exposed to the solar radiation due to the shielding of the hills from the west only until 3 p.m. in summer and until 12 a.m. in winter. This produces the conditions for an earlier decrease of an intensity of the vertical exchange processes and therefore an earlier increase of the radon volume activity in 'SMI air', always in a couple of hours earlier than a similar observed increase in F MPI CU air . The daily course analysis also showed that the equivalent mixing height in the SMI area is about 30% lower than that one in the FMPI CU area. The analyses presented in this paper show that the daily courses of the 222 Rn volume activity can differ significantly even for two nearby areas with the different orography and that 222 Rn concentration is sensitive to these differences. It was also found out that if the long-term radon data should be collected in order to obtain the representative data for a larger area, an adequate attention should be paid to the selection of the measurement area. (authors)
International Nuclear Information System (INIS)
Freyer, K.; Treutler, H.C.
1997-01-01
With a half life of 3.8 days, the 222 Rn found in all groundwater makes an excellent tracer for solving several problems in the field of environmental research and hydrology. In Germany alluvial aquifers connected to rivers are used for drinking water extraction. Consequently importance is attached to studying the exchange processes between surface water and groundwater in order to determine infiltration velocities and infiltrate retention times in the aquifer. However, such investigations require a reliable, reproducible method for determining radon activity concentrations in groundwater samples, as well as a suitable sampling technique. This paper reports on just such a method, containing detailed instructions for sampling, transportation and activity determination using liquid scintillation spectrometry following toluene extraction. Spectral analysis and α/β separation improve the accuracy of measurement. The detection limit is about 0.05 Bq/1; the total error is 222 Rn by employing the effect that surface water infiltrating an aquifer absorbs 222 Rn along the infiltration pathway. As the degree of uptake is a function of the retention time, flow paths and flow velocities can all be determined by measuring the radon activity concentrations at the various groundwater gauging stations along measuring profiles. Corresponding investigations were carried out into a pleistocene aquifer below the River Elbe near a waterworks extracting bank-filtered water. The findings are presented and the technique's possibilities and limitations are discussed
48 CFR 252.222-7004 - Compliance with Spanish social security laws and regulations.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Compliance with Spanish... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.222-7004 Compliance with Spanish social... Spanish Social Security Laws and Regulations (JUN 1997) (a) The Contractor shall comply with all Spanish...
Manenti, Sandra Aparecida; Galato Júnior, João; Silveira, Elizângela da Silva; Oenning, Roberto Teixeira; Simões, Priscyla Waleska Targino de Azevedo; Moreira, Jeverson; Fochesato, Celine Maria; Brígido, Luís Fernando de Macedo; Rodrigues, Rosângela; Romão, Pedro Roosevelt Torres
2011-01-01
Southern Brazil has the highest prevalence rate of AIDS in the country and is the only region in the Americas where HIV-1 subtype C prevails. We evaluated the epidemiologic and clinical characteristics of pregnant women living with HIV/AIDS in the South region of Santa Catarina, Brazil. All pregnant women with HIV infection attending the obstetric outpatient clinic of Criciúma, State of Santa Catarina, in 2007 (n = 46) were invited to participate. Data of 36 eligible participants were obtained through a standardized questionnaire. The great majority were young, with a steady partner, low family income, low education level and referring early first sexual intercourse. Many reported use of illicit non-injecting drugs (55.5%) and unprotected sex with partners that were HIV-positive (57.7%), injecting drug user (22.2%), male inmate (19.4%), truck driver (13.8%), with history of sexually transmitted disease (11.1%) or men who have sex with men (MSM) (2.8%). Most (66.7%) of the participants had their HIV diagnosis done during the pregnancy, 7 (19.4%) had a previous history of HIV mother-to-child transmission. Therapy based on highly active antiretroviral therapy (94%) was initiated at 19.3 weeks on average and 33% showed irregular antiretroviral adherence. These results confirm previous data on HIV epidemiology in Brazil and suggest that the women partners' sexual behavior and unprotected sexual intercourse are important aspects of HIV epidemic. Additional efforts in education, prophylaxis and medication adherence are needed.
Investigation of radon-222 in subsurface waters as an earthquake predictor
International Nuclear Information System (INIS)
Smith, A.R.; Bowman, H.R.; Mosier, D.F.; Asaro, F.; Wollenberg, H.A.; King, C.Y.
1975-11-01
Changes of radon-222 content of well waters in seismically active regions may provide earthquake precursor signals, according to reports of recent Chinese and Russian work. A high-precision γ-ray system for continuous monitoring of radon in wells and springs has been developed at the Lawrence Berkeley Laboratory, where monitoring began in April 1975, and has been extended to other sites including the San Andreas fault zone
Investigation of 222Rn in subsurface waters as an earthquake predictor
International Nuclear Information System (INIS)
Smith, A.R.; Bowman, H.R.; Mosier, D.F.; Asaro, F.; Wollenberg, H.A.; King, C.Y.
1976-01-01
Changes of 222 Ra content of well waters in seismically active regions may provide earthquake precursor signals, according to reports of recent Chinese and Russian work. A high-precision γ-ray system for continuous monitoring of radon in wells and springs has been developed at the Lawrence Berkeley Laboratory, where monitoring began in April 1975, and has been extended to other sites including the San Andreas fault zone
Directory of Open Access Journals (Sweden)
Narcís Saubi
2011-01-01
Full Text Available We have evaluated the influence of age and immunization routes for induction of HIV-1- and M. tuberculosis-specific immune responses after neonatal (7 days old and adult (7 weeks old BALB/c mice immunization with BCG.HIVA222 prime and MVA.HIVA boost. The specific HIV-1 cellular immune responses were analyzed in spleen cells. The body weight of the newborn mice was weekly recorded. The frequencies of HIV-specific CD8+ T cells producing IFN-γ were higher in adult mice vaccinated intradermally and lower in adult and newborn mice vaccinated subcutaneously. In all cases the IFN-γ production was significantly higher when mice were primed with BCG.HIVA222 compared with BCGwt. When the HIV-specific CTL activity was assessed, the frequencies of specific killing were higher in newborn mice than in adults. The prime-boost vaccination regimen which includes BCG.HIVA222 and MVA.HIVA was safe when inoculated to newborn mice. The administration of BCG.HIVA222 to newborn mice is safe and immunogenic and increased the HIV-specific responses induced by MVA.HIVA vaccine. It might be a good model for infant HIV and Tuberculosis bivalent vaccine.
Saubi, Narcís; Im, Eung-Jun; Fernández-Lloris, Raquel; Gil, Olga; Cardona, Pere-Joan; Gatell, Josep Maria; Hanke, Tomáš; Joseph, Joan
2011-01-01
We have evaluated the influence of age and immunization routes for induction of HIV-1- and M. tuberculosis-specific immune responses after neonatal (7 days old) and adult (7 weeks old) BALB/c mice immunization with BCG.HIVA222 prime and MVA.HIVA boost. The specific HIV-1 cellular immune responses were analyzed in spleen cells. The body weight of the newborn mice was weekly recorded. The frequencies of HIV-specific CD8+ T cells producing IFN-γ were higher in adult mice vaccinated intradermally and lower in adult and newborn mice vaccinated subcutaneously. In all cases the IFN-γ production was significantly higher when mice were primed with BCG.HIVA222 compared with BCGwt. When the HIV-specific CTL activity was assessed, the frequencies of specific killing were higher in newborn mice than in adults. The prime-boost vaccination regimen which includes BCG.HIVA222 and MVA.HIVA was safe when inoculated to newborn mice. The administration of BCG.HIVA222 to newborn mice is safe and immunogenic and increased the HIV-specific responses induced by MVA.HIVA vaccine. It might be a good model for infant HIV and Tuberculosis bivalent vaccine. PMID:21603216
International Nuclear Information System (INIS)
Villalba, L.; Colmenero S, L.; Montero C, M.E.
2004-01-01
The study of the content of dissolved Rn 222 is presented in underground water and of domicile of the cities of Chihuahua and Aldama of the State of Chihuahua. The existence of the Rn 222 in the underground waters comes from its constant production in the rocks of the terrestrial bark. It has been determined that the radon is a noble gas of more solubility in the water, this solubility induces high concentrations in underground water, as well as bigger risk to the health in the human body once ingested or inhaled. Of the 32 wells studied in the cities of Chihuahua and Aldama, the content of dissolved Rn 222 in the water of 22 of them is bigger than 11 Bq/l and of 73 studied samples of water of domiciles 47 show bigger values that 11 Bq/l. These radon contents are attributable to the uraniferous rocks present in the aquifers. (Author)
International Nuclear Information System (INIS)
Bangotra, P.; Mehra, R.; Jakhu, R.; Sahoo, B.K
2016-01-01
The natural radioactivity in soil is usually determined from the 226 Ra (Radium), 232 Th (Thorium) and 40 K (potassium). 222 Rn and 220 Rn are produced in soil as a result of the presence of these radionuclides. As 226 Ra decay, the newly created 222 Rn radionuclide recoil from the parent grain and then exhale through the soil. Since 98.5% of radiological effects of 238 U series are produced by 226 Ra and its daughter products. The assessment of gamma radiation dose from natural sources is of particular importance as natural radiation is the largest contributor to the external dose of the world population. Authors are advised to maximize the information content utilizing the full space available. The main objective of the present study is to measure the level of natural radioactivity 226 Ra, 232 Th, 40 K and 222 Rn exhalation rate in the soil samples for health risk assessment
International Nuclear Information System (INIS)
Nakao, Ryuji; Ito, Takehito; Yamaguchi, Masatoshi; Suzuki, Kazutoshi
2008-01-01
A practical, sensitive and rapid analytical method was established and validated for chemical impurity tests of 2-deoxy-2-fluoro-D-glucose (FDG), 2-deoxy-2-chloro-D-glucose (ClDG) and Kryptofix 2.2.2 (K-222) in [ 18 F]FDG. This method was based on precolumn derivatization with ultraviolet (UV) detection. FDG and ClDG were rapidly derivatized with 1-phenyl-3-methyl-5-pyrazolone in the presence of borate buffer at 40 o C, and the labeled derivatives and K-222 were separated by reversed-phase high-performance liquid chromatography and monitored by UV absorbance at 210 nm. After optimization of the conditions, FDG, ClDG and K-222 could be determined within 15 min and showed good performance in terms of sensitivity, linearity and reproducibility. This method could be successfully applied to the quality control test of [ 18 F]FDG produced by a commercially available apparatus
International Nuclear Information System (INIS)
Przylibski, Tadeusz Andrzej; Wyłomańska, Agnieszka; Zimroz, Radosław; Fijałkowska-Lichwa, Lidia
2015-01-01
The authors present an application of spectral decomposition of 222 Rn activity concentration signal series as a mathematical tool used for distinguishing processes determining temporal changes of radon concentration in cave air. The authors demonstrate that decomposition of monitored signal such as 222 Rn activity concentration in cave air facilitates characterizing the processes affecting changes in the measured concentration of this gas. Thanks to this, one can better correlate and characterize the influence of various processes on radon behaviour in cave air. Distinguishing and characterising these processes enables the understanding of radon behaviour in cave environment and it may also enable and facilitate using radon as a precursor of geodynamic phenomena in the lithosphere. Thanks to the conducted analyses, the authors confirmed the unquestionable influence of convective air exchange between the cave and the atmosphere on seasonal and short-term (diurnal) changes in 222 Rn activity concentration in cave air. Thanks to the applied methodology of signal analysis and decomposition, the authors also identified a third process affecting 222 Rn activity concentration changes in cave air. This is a deterministic process causing changes in radon concentration, with a distribution different from the Gaussian one. The authors consider these changes to be the effect of turbulent air movements caused by the movement of visitors in caves. This movement is heterogeneous in terms of the number of visitors per group and the number of groups visiting a cave per day and per year. Such a process perfectly elucidates the observed character of the registered changes in 222 Rn activity concentration in one of the decomposed components of the analysed signal. The obtained results encourage further research into precise relationships between the registered 222 Rn activity concentration changes and factors causing them, as well as into using radon as a precursor of geodynamic
Directory of Open Access Journals (Sweden)
Batiot-Guilhe Christelle
2007-01-01
Full Text Available Carbon dioxide and 222Rn monitoring of the atmosphere of a Mediterranean sink hole - spring (SE France during two hydrological cycles (from September 2004 to September 2006 showed seasonal variations with very high concentrations during summer (greater than 6% and 20 000 Bq/m3, respectively. Gas dynamics in caves often show seasonal variations.Meteorological parameters (barometric pressure and temperature mainly, cave geometry and fracture networks control exchanges between the cavity and outside atmosphere. Carbon dioxide and 222Rn may have different sources (atmosphere, soil, bedrock, deep gas diffusion, in situ oxidation of organic matter and, in some caves, the key role of swift underground streams.For a CO2 origin, 13C measurements on water and gas samples taken into the cavity suggest a superficial origin. Radon-222 appears to be locally produced and transported by biogenic CO2. Further investigations will be carried out in order to study the relationship of gas-level variations with barometric pressure variations and piezometric level fluctuations within the aquifer.
Diurnal radon-222 concentrations in the outflow of a complex basin
International Nuclear Information System (INIS)
Clements, W.E.; Wilkening, M.
1981-01-01
Radon 222 concentrations were monitored continuously in the outflow from the Anderson and Putah Creek air drainage basin as part of the Department of Energy's Atmospheric Studies in Complex Terrain September 1980 field studies. Radon 222, an inert gas having a half-life of 3.8 days, can be considered to be exhaled uniformly at a constant rate from the earth's surface throughout the basin. The contribution to the total radon budget from vented steam from geothermal wells in the Geysers area is neglected. Hence, radon in this application is used as an extended-source atmospheric tracer in contrast with point-source release of tracer materials. One of the purposes of this study is to help classify drainage flow nights in terms of the diurnal patterns of radon concentration. As cool slope winds move along the terrain and into the valley, the air masses involved accumulate radon through the night until morning instabilities mix it to greater depths. Hence, the measured diurnal trend of radon in the outflow of the basin reflects the integrated behavior of nocturnal flows in the basin and subsequent breakup in the morning. The use of this technique to classify drainage flows has been used by Wilkening and Rust
Phylogenetic analysis of Dengue virus 1 isolated from South Minas Gerais, Brazil.
Drumond, Betania Paiva; Fagundes, Luiz Gustavo da Silva; Rocha, Raissa Prado; Fumagalli, Marcilio Jorge; Araki, Carlos Shigueru; Colombo, Tatiana Elisa; Nogueira, Mauricio Lacerda; Castilho, Thiago Elias; da Silveira, Nelson José Freitas; Malaquias, Luiz Cosme Cotta; Coelho, Luiz Felipe Leomil
2016-01-01
Dengue is a major worldwide public health problem, especially in the tropical and subtropical regions of the world. Primary infection with a single Dengue virus serotype causes a mild, self-limiting febrile illness called dengue fever. However, a subset of patients who experience secondary infection with a different serotype can progress to a more severe form of the disease, called dengue hemorrhagic fever. The four Dengue virus serotypes (1-4) are antigenically and genetically distinct and each serotype is composed of multiple genotypes. In this study we isolated one Dengue virus 1 serotype, named BR/Alfenas/2012, from a patient with dengue hemorrhagic fever in Alfenas, South Minas Gerais, Brazil and molecular identification was performed based on the analysis of NS5 gene. Swiss mice were infected with this isolate to verify its potential to induce histopathological alterations characteristic of dengue. Liver histopathological analysis of infected animals showed the presence of inflammatory infiltrates, hepatic steatosis, as well as edema, hemorrhage and necrosis focal points. Phylogenetic and evolutionary analyses based on the envelope gene provided evidence that the isolate BR/Alfenas/2012 belongs to genotype V, lineage I and it is probably derived from isolates of Rio de Janeiro, Brazil. The isolate BR/Alfenas/2012 showed two unique amino acids substitutions (SER222THRE and PHE306SER) when compared to other Brazilian isolates from the same genotype/lineage. Molecular models were generated for the envelope protein indicating that the amino acid alteration PHE 306 SER could contribute to a different folding in this region located within the domain III. Further genetic and animal model studies using BR/Alfenas/2012 and other isolates belonging to the same lineage/genotype could help determine the relation of these genetic alterations and dengue hemorrhagic fever in a susceptible population. Copyright © 2015 Sociedade Brasileira de Microbiologia. Published by
Phylogenetic analysis of Dengue virus 1 isolated from South Minas Gerais, Brazil
Directory of Open Access Journals (Sweden)
Betania Paiva Drumond
2016-03-01
Full Text Available Abstract Dengue is a major worldwide public health problem, especially in the tropical and subtropical regions of the world. Primary infection with a single Dengue virus serotype causes a mild, self-limiting febrile illness called dengue fever. However, a subset of patients who experience secondary infection with a different serotype can progress to a more severe form of the disease, called dengue hemorrhagic fever. The four Dengue virus serotypes (1–4 are antigenically and genetically distinct and each serotype is composed of multiple genotypes. In this study we isolated one Dengue virus 1 serotype, named BR/Alfenas/2012, from a patient with dengue hemorrhagic fever in Alfenas, South Minas Gerais, Brazil and molecular identification was performed based on the analysis of NS5 gene. Swiss mice were infected with this isolate to verify its potential to induce histopathological alterations characteristic of dengue. Liver histopathological analysis of infected animals showed the presence of inflammatory infiltrates, hepatic steatosis, as well as edema, hemorrhage and necrosis focal points. Phylogenetic and evolutionary analyses based on the envelope gene provided evidence that the isolate BR/Alfenas/2012 belongs to genotype V, lineage I and it is probably derived from isolates of Rio de Janeiro, Brazil. The isolate BR/Alfenas/2012 showed two unique amino acids substitutions (SER222THRE and PHE306SER when compared to other Brazilian isolates from the same genotype/lineage. Molecular models were generated for the envelope protein indicating that the amino acid alteration PHE 306 SER could contribute to a different folding in this region located within the domain III. Further genetic and animal model studies using BR/Alfenas/2012 and other isolates belonging to the same lineage/genotype could help determine the relation of these genetic alterations and dengue hemorrhagic fever in a susceptible population.
Effect of source and environmental factors on Rn-222 air concentration
International Nuclear Information System (INIS)
Mamoon, A.
2005-01-01
Rn-222(radon) air concentration depends on several factors. Some of the factors are source related and other factors are environmentally related. Because high levels of radon concentrations in air have potential health effects, it is important to study the impact of the various factors affecting radon air concentration. Laboratory scale investigations of the various factors affecting radon air concentration were carried out under controlled conditions that allow variation of the various variables
International Nuclear Information System (INIS)
Abu-Samreh, Mohammad M.
2005-01-01
Radon, as a natural noble gas, has three main natural isotopes; namely, radon 222 (Rn), a decay product of 238U, radon-220(220Rn, known as thoron), produced in the decay series of thorium-232(232Th), and radon-219 (219Rn), a decay product from the chain originating with 235U [1]. Both 238U and 232th occur naturally in soil and rocks at variable concentrations of about 1pCi/g and also 226Ra, the parent of 222Rn [2]. The 222Rn isotope has half-life of 3.82 days; while 220Rn isotope has a half-life of 55 seconds and 219Rn isotope has a half-life of about 3.96 seconds. 222Rn decays into polonium-218(218Po), which in turn decays within minutes to lead-214 (214Pb), bismuth-214 (214Bi), and polonium-218 (218Po), which in turn decays within minutes to lead-214 (214Pb), bismuth 214 (214Bi), and polonium-214 (214Po)[3]. In particular, 222Rn poses a major concern in regard to radiation pollution and human health hazard [4, 5]. The radon gas can diffuse easily out of the soil surface into air or houses; it can be trapped in poorly ventilated houses and so its concentration can build up to higher levels. Although soil is considered to be the main source of indoor radon concentration, raw building materials (especially quartz, cement, etc.) can make a significant contribution to the level of natural radioactivity in closed spaces such as stores and badly-ventilated dwelling [6]. Moreover, the production rate of radon in dwellings depends on the concentration of radium content in the subsoil, building materials, and porosity as well as the density of the wall material [7, 8]. The emission of radon from building materials is found to be a function of ventilation as well as of the radium content in building materials. The nongaseous 222 Rn decay products are partially suspended in air as mixture of attached and unattached fractions and partially deposited on walls and furniture [9]. Over the past four decades, natural radiation exposure due to 222Rn and its progeny inside houses
Brazil, China, US: a triangular relation?
Directory of Open Access Journals (Sweden)
José-Augusto Guilhon-Albuquerque
2014-01-01
Full Text Available This article is divided in three sections. The first one explores the so-called "strategic partnership" between Brazil and China. In the second section we shall examine how US-China relations in the global system could affect both Brazil-US, and Brazil-China bilateral relations. A final section presents some recommendations for Brazil strategic orientations regarding the current systemic transition in the allotment of global power.
222Rn determination in water and brine samples using liquid scintillation spectrometry
International Nuclear Information System (INIS)
Oliveira, Thiago C.; Oliveira, Arno H.
2017-01-01
Liquid scintillation spectrometry (LSC) is the most common technique used for 222 Rn determination in environmental aqueous sample. In this study, the performance of water-miscible (Ultima Gold AB) and immiscible (Optiscint) liquid scintillation cocktails has been compared for different matrices. 241 Am, 90 Sr and 226 Ra standard solutions were used for LSC calibration. 214 Po region was defined as better for both cocktails. Counting efficiency of 76 % and optimum PSA level of 95 for Ultima Gold AB cocktail, and counting efficiency of 82 % and optimum PSA level of 85 for Optiscint cocktail were obtained. Both cocktails showed similar results when applied for 222 Rn activity determination in water and brine samples. However the Optiscint is recommended due to its quenching resistance. Limit of detection of 0.08 and 0.06 Bq l -1 were obtained for water samples using a sample:cocktail ratio of 10:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. Limit of detection of 0.08 and 0.04 Bq l -1 were obtained for brine samples using a sample:cocktail ratio of 8:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. (author)
International Nuclear Information System (INIS)
Seidel, C.M.
1998-01-01
The Hanford Tank Waste Remediation Systems (TWRS) Characterization Program is responsible for coordinating the sampling and analysis of the 177 large underground storage tanks at the Hanford site. The 222-S laboratory has been the primary laboratory for chemical analysis of this highly-radioactive material and has been accumulating these samples for many years. As part of the Fiscal Year 1998 laboratory work scope, the 222-S laboratory has performed a formal physical inventory of all tank characterization samples which are currently being stored. In addition, an updated inventory/archive program has been designed. This program defines sample storage, retention, consolidation, maintenance, and disposition activities which will ensure that the sample integrity is preserved to the greatest practical extent. In addition, the new program provides for continued availability of waste material in a form which will be useful for future bench-scale studies. Finally, when the samples have exceeded their useful lifetime, the program provides for sample disposition from,the laboratory in a controlled, safe and environmentally compliant manner. The 222-S laboratory maintains custody over samples of tank waste material which have been shipped to the laboratory for chemical analysis. The storage of these samples currently requires an entire hotcell, fully dedicated to sample archive storage, and is rapidly encroaching on additional hotcell space. As additional samples are received, they are beginning to limit the 222-S laboratory hotcell utility for other activities such as sample extrusion and subsampling. The 222-S laboratory tracks the number of sample containers and the mass of each sample through an internal database which has recently been verified and updated via a physical inventory
Galardi, Silvia; Mercatelli, Neri; Giorda, Ezio; Massalini, Simone; Frajese, Giovanni Vanni; Ciafrè, Silvia Anna; Farace, Maria Giulia
2007-08-10
MicroRNAs are short regulatory RNAs that negatively modulate protein expression at a post-transcriptional level and are deeply involved in the pathogenesis of several types of cancers. Here we show that miR-221 and miR-222, encoded in tandem on chromosome X, are overexpressed in the PC3 cellular model of aggressive prostate carcinoma, as compared with LNCaP and 22Rv1 cell line models of slowly growing carcinomas. In all cell lines tested, we show an inverse relationship between the expression of miR-221 and miR-222 and the cell cycle inhibitor p27(Kip1). We recognize two target sites for the microRNAs in the 3' untranslated region of p27 mRNA, and we show that miR-221/222 ectopic overexpression directly results in p27 down-regulation in LNCaP cells. In those cells, we demonstrate that the ectopic overexpression of miR-221/222 strongly affects their growth potential by inducing a G(1) to S shift in the cell cycle and is sufficient to induce a powerful enhancement of their colony-forming potential in soft agar. Consistently, miR-221 and miR-222 knock-down through antisense LNA oligonucleotides increases p27(Kip1) in PC3 cells and strongly reduces their clonogenicity in vitro. Our results suggest that miR-221/222 can be regarded as a new family of oncogenes, directly targeting the tumor suppressor p27(Kip1), and that their overexpression might be one of the factors contributing to the oncogenesis and progression of prostate carcinoma through p27(Kip1) down-regulation.
All projects related to | Page 222 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Violence toward youth in Brazil is among the highest in the world. ... Obesity in South Africa is becoming a major public health issue for the country - nearly ... GROUPS, RESEARCH NETWORKS, NUTRITION POLICY, ATTITUDES, Gender.
20 CFR 222.31 - Relationship as child for annuity and lump-sum payment purposes.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as child for annuity and lump... UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.31 Relationship as... the employee. For procedures on how a determination of the person's relationship to the employee is...
33 CFR 222.2 - Acquisition of lands downstream from spillways for hydrologic safety purposes.
2010-07-01
... CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.2... that would prevail without the project. General hydrologic engineering considerations are as follows... property. (iii) Flood durations are a maximum of 3 hours in urban areas and 24 hours in agricultural areas...
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Paulo Roberto Rocha; Lessa, Edmilson de Lima; Oliveira, Evaldo Paulo de, E-mail: epoliveira@aluno.ird.gov.br [Instituto de Radioprotecao e Dosimetria, (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Radioprotecao Ambiental e Ocupacional
2014-07-01
This study aims to evaluate the efficiency of measuring the radioactive gas Radon ({sup 222} Rn) with passive detector activated carbon. Alpha Guard, exposure chamber, air sampler, default font Radio, calibrator flow, flow adjuster, ducts drivers: For this, various equipment to make the measurement system as were used. An assembly of such equipment, with specific sequence was used allowing for more efficient exposure of passive detectors Radon gas. Twenty samples were heated to remove moisture and then stored in desiccator until the experiment were made. The exhibition was held passive dosimeters being removed from the chamber, and one hour after, subjected to analysis by gamma spectrometry in germanium (HPGe) for an hour. Subsequently, other measurements were made at scheduled times and sequential for one hour. The results were presented in report form and spectra, measures and graphs generated by Alpha Guard were also extracted. Finally we calculated the efficiency of the passive meter activated carbon. (author)
International Nuclear Information System (INIS)
Morato de Andrade, C.
2003-05-01
To prepare the Gross Domestic Product increase of 4 % in the next years, it is necessary to increase the capacity in Brazil. The government decided actions in favor of the installed capacity growth speeding up and planed investments. This document takes stock on the energy situation in Brazil, the human, political and geographical constraints and the decided measures in favor the energy development. (A.L.B.)
An overview on small hydro in Brazil
International Nuclear Information System (INIS)
Filho, G.T.
2008-01-01
An overview of small-scale hydro development in Brazil was presented in the context of the Brazilian energy sector. Brazil's energy sector is currently comprised of 45 per cent renewable energy. Brazil is the tenth largest energy producer in the world, with an installed capacity of 105.986 MW. Brazil currently has an estimated 258.410 MW of hydroelectric power potential. Small hydropower (SHP) plants in Brazil are defined as plants capable of producing up to 30 MW of power, with a reservoir area smaller than 12 km 2 . It is estimated that SHP plants will provide 5 per cent of Brazil's electrical supply by 2030. SHP plants in Brazil typically use Kaplan and Pelton hydraulic turbines, as well as Michell-Banki cross-flow turbines. Hydrokinetic turbine prototypes are also being designed at the Federal University of Brazil. Researchers are currently developing a diffuser enhancement design. However, there are currently no designs available that use peripheric generators. Researchers are currently investigating the design of fish-friendly turbines as well as mobile dams. Development projects in the Amazon region were outlined. tabs., figs.
International Nuclear Information System (INIS)
Tait, David; Wiechen, Arnold; Haase, Gerhard
1995-01-01
Several commercially available resins have been found to bind the bicyclic polyether cryptand C222 from aqueous acetonitrile solutions. The presence of C222 on some of these resins strongly improved their affinity for Sr, so that relatively small amounts of such resins sorbed Sr from milk. The resins investigated were silica gel, polyacrylic acid crosslinked with divinylbenzene (DVB), polystyrene crosslinked with divinylbenzene (PS-DVB) and PS-DVB containing sulphonate, aminomethylphosphonate, iminodiacetate and mercapto groups. The resins for which binding of C222 resulted in the largest improvement in Sr sorption from milk were PS-DVB containing mercapto groups (Chelite S) and silica gel (Si 60). Thus, 2 ml wet volume of either Chelite S containing 133 μmol of C222, or silica gel Si-60 containing 143 μmol of C222 sorbed 90 and 48%, respectively, of the Sr from 100-ml milk samples. As the sorption of Sr from milk by these systems is relatively slow, contact times of 24-36 h are required to attain these results. The Chelite S-C222 system separates Sr effectively from Cs and Ca. Under the conditions described here some 6% of the natural 40 K in milk sorbs with Sr to the resin. Ba behaves similarly to Sr. 90 Sr/ 90 Y sorbed on the silica gel Si-60-C222 system can be measured directly and efficiently by liquid scintillation counting. If adequate specificity can be attained this system might provide a very simple method of determining 90 Sr in milk
International Nuclear Information System (INIS)
Munoz, S.N.M.; Hadler, J.C.; Paulo, S.R.
1996-01-01
For the determination of the ventilation influence (directional flux of air induced by a fan) on the spatial distribution of Rn-222 and its decay products (daughters) present in human inhabited environments, a group of experimental results were obtained by means of the fission nuclear tracks left by α-particles over adequate plastic detectors CR-39). The exposure of these detectors was done in a closed environment considering the influence of ventilation for different angles, velocities and distances from fan. The results show that a relative quantity of daughters of Rn-222 are pulled out of the environment due to the effects of ventilation and plat-out
Activity-based Calculation Models for the Brazilian Air Force Cellular Unit of Intendancy
2013-03-01
Business Press, 1997. Cruz, Luciene and M Wellton. “Health, Defense and cities ministries were the most affected by cuts”. Brazil Agency, Sao Paulo ... Brazil ......................................27 2.2.2 Elaboration of Budget...relevant to the CUI was support to the military of the Field Hospital. At that time support was provided to the victims of the floods in the State of
Energy Technology Data Exchange (ETDEWEB)
Bonifacio, J.; Iturbe, J.L
1992-02-15
The study of the present work consists on designing a system to measure gas {sup 222} Rn, using a surface barrier detector, in order to obtaining a more accuracy measure of this isotope by means of an alpha particle spectra and thus to try to avoid the influence of the radioactivity of the isotope descendants of short half life, which are also emitting of alpha particles, since by other methods its should make a series of corrections to obtain the real value of the radon activity. (Author)
Exhalation velocity of radon-222 of Dutch building materials and the influence of paint systems
International Nuclear Information System (INIS)
Dijk, W. van; Jong, P. de
1989-02-01
In order to achieve a better insight concerning the source terms of radon in the Dutch dwelling in the framework of the RENA-programme an investigation has been performed into the exhalation velocity of radon-222 from building materials. From this investigation it turned out that the ventilation factor does not have any influence upon the exhalation velocity, neither an influence of alteration of air pressure could be demonstrated. The influence of air humidity upon the exhalation velocity showed a twofold picture; for gypsum a linear increase of the exhalation velocity with vapour pressure was found, while for concrete a linear decrease with vapour pressure was observed. Further it has been investigated in how far paint systems diminish the exhalation velocity of the Rn-222 from gypsum and concrete. Acryl paints, mostly used in the Dutch dwelling, did not show a decrease of the exhalation velocity and structure paints did even cause an increase of the exhalation velocity. Other types of paint based on chlorous rubber, epoxy resins and poly-urethane, in contrast, showed a clear reduction. From these those based on poly-urethane showed the largest reduction (60-75%) at a double sided treatment of the wall. With the help of a mathematical modelling of the exhalation estimations have been made of the exhalation velocity of Rn-222 at single sided treatment of a wall and for the exhalation velocity of Rn-220. For the fore mentioned poly-urethane-paints this yelds, at an estimate, a reduction of respectively 90-95% and 100%. (author). 40 refs.; 15 figs.; 8 tabs
Woodrow Wilson International Center for Scholars, 2006
2006-01-01
"Thinking Brazil" is an electronic publication of the Brazil Institute. This issue of "Thinking Brazil" highlights the research of Elizabeth Balbachevsky. On July 24, 2006, Elizabeth Balbachevsky, Woodrow Wilson Center Public Policy Scholar and Associate Professor of Political Science, Universidade de Sao Paulo, presented her research on the…
Continuous 222Rn measurements in water to perform a hydrograph separation
International Nuclear Information System (INIS)
Hofmann, H.; Kies, A.; Tosheva, Z.
2004-01-01
To get information about the different components of runoff before, during and after heavy rain events, micro catchments were selected to perform hydrograph separations using the radioactive noble gas 222 Rn and the stable isotope 18 O as natural occurring, conservative tracers. These tracers help to separate 'pre event', 'event', and 'post event' water in the total runoff. The selected micro basins are situated in the western part of Luxembourg and belong to the Attert River catchment area. Our investigations are a part of the project 'Cycleau' which is studying risk assessments in the Attert River area. By combining the databases great opportunities for comparison were realized. So far the catchment areas have been studied for two years. Continuous monitoring radon detectors were installed at selected measuring points, which were important for the different flow regimes. Along with the detectors precision thermometers, conductivity instruments, CO 2 -detectors, flow meter, v-notches, and automatic sampler for chemical analysis were set up. Besides the continuous measurements for 222 Rn, point samples were taken for liquid scintillation analysis (LCS). Single rain events will have been sampled and measured intensively for 222 Rn (LCS) and 18 O in two to three days field campaigns, for a comparison of the continuous method with the 18 O results and to strengthen our data by the end of march 2004. During the first year of this study instrument testing and evaluation was performed. Different radon monitor units were examined to find instruments that work best under field conditions. Additionally, separate units had to be constructed for a degassing of the solved gases out of the water, because the instruments for radon measuring were constructed for radon in air not for radon in water. A 'bubbler' had be developed that performs the degassing process. The techniques will be presented. Through stable results from our instrument developments, we observed different radon
Measurement of 226Ra in water and 222Rn in water and air by liquid scintillation counting
International Nuclear Information System (INIS)
Schoenhofer, F.
1992-01-01
In the Austrian province of Lower Austria a comprehensive programme for measurement of 222 Rn and 226 Ra in drinking water was conducted. A simple liquid scintillation counting (LSC) method was used which gives a LLD of 30 mBq per litre for 226 Ra without any chemical separation. Results are presented and the health significance is discussed. For 222 Rn in air a commercially available simple charcoal system with LSC was used. The system was tested in a house with elevated radon concentration under normal living conditions. During relatively short 2-day periods a maximum deviation of ± 30% from the monthly mean value was found. The advantages of LSC are that the procedures are very simple and cheap. (author)
An overview on small hydro in Brazil
Energy Technology Data Exchange (ETDEWEB)
Filho, G.T. [Federal Univ. of Itajuba (Brazil). National Reference Centre for Small Hydro
2008-07-01
An overview of small-scale hydro development in Brazil was presented in the context of the Brazilian energy sector. Brazil's energy sector is currently comprised of 45 per cent renewable energy. Brazil is the tenth largest energy producer in the world, with an installed capacity of 105.986 MW. Brazil currently has an estimated 258.410 MW of hydroelectric power potential. Small hydropower (SHP) plants in Brazil are defined as plants capable of producing up to 30 MW of power, with a reservoir area smaller than 12 km{sup 2}. It is estimated that SHP plants will provide 5 per cent of Brazil's electrical supply by 2030. SHP plants in Brazil typically use Kaplan and Pelton hydraulic turbines, as well as Michell-Banki cross-flow turbines. Hydrokinetic turbine prototypes are also being designed at the Federal University of Brazil. Researchers are currently developing a diffuser enhancement design. However, there are currently no designs available that use peripheric generators. Researchers are currently investigating the design of fish-friendly turbines as well as mobile dams. Development projects in the Amazon region were outlined. tabs., figs.
International Nuclear Information System (INIS)
Wada, A.; Matsueda, H.; Tsuboi, K.; Sawa, Y.; Murayama, S.; Taguchi, S.; Kamada, A.; Nosaka, M.
2012-01-01
We used the observed CO/"2"2"2Rn ratio in the Asian outflows at Minamitorishima (MNM), Yonagunijima (YON), and Ryori (RYO) in the western North Pacific from 2007 to 2011, together with a three-dimensional chemical transport model (STAG), in order to estimate anthropogenic emissions of CO in East Asia. The measurements captured high-frequency synoptic variations of enhanced "2"2"2Rn (ERN) events associated with the long-range transport of continental air masses. "2"2"2Rn and CO showed high correlation during the ERN events observed at MNM and YON in the winter and spring, but not at RYO. The STAG transport model reproduced well the concentrations of observed "2"2"2Rn when forced with a constant and uniform flux density of 1.0 atom cm"-"2 s"-"1, but underestimated the associated enhancement of synoptically variable CO caused by the underestimated flux values in the EDGAR ver. 4.1 emission database used in the model for East Asia. Better estimates for the East Asian emission were derived using a radon tracer method based on the difference in the enhancement ratio of CO/"2"2"2Rn between the observation and the model. The anthropogenic emissions of CO for China, Japan, and Korea were estimated to be 203 Tg CO yr"-"1, 91% of which originated in China. When compared with other estimated emissions of CO, our estimated result showed consistency with those of the inverse method, whereas the emission database of EDGAR was about 45% smaller than our anthropogenic estimation for China.
Brazil in the global energy world
Energy Technology Data Exchange (ETDEWEB)
Kim, Frank D.; Vossoughi, Shapour [University of Kansas (KU), KS (United States)
2012-07-01
Brazil is the 10th largest energy consumer in the world and the third largest in the Western Hemisphere, behind the United States and Canada. Total primary energy consumption in Brazil has increased significantly in recent years; and over the past decade, Brazil has made great strides in increasing its total energy production, particularly oil. Brazil has the second-largest crude oil reserves in South America (behind Venezuela), and is one of the fastest growing oil producers in the world. According to United States Energy Information Administration (EIA), Brazil had 12.2 billion barrels of proven oil reserves in 2008. In 2007, Brazil's state owned Petroleo Brasileiro S.A. (PETROBRAS) announced that it had discovered an estimated 5-8 billion barrels of recoverable reserves (including both oil and natural gas) in the Tupi field, located in the Santos Basin. In 2008, subsequent discoveries were announced, to include Jupiter and Carioca (aka Sugar Loaf). Although PETROBRAS has yet to confirm the size of the discoveries, some industry analysts estimate the total extent of recoverable oil and natural gas reserves in the entire pre-salt layer have approached 40 to 80 billion barrels of oil equivalent. The reserves occur below a salt zone that is estimated to be 7,000 meters below the ocean surface. However, Brazil faces many challenges to recover the hydrocarbons to include technical, political, fiscal, and infrastructure hurdles. In spite of the challenges ahead, these discoveries transformed the nature and focus of Brazil's oil industry, economy, and future; and the potential impact of the pre-salt discoveries upon world oil markets is vast. The purpose of this paper is to discuss how the recent discoveries will affect Brazil's future and the impact it will have on the global energy world. (author)
Energy Technology Data Exchange (ETDEWEB)
Freyer, K.; Treutler, H.C. [Leipzig-Halle Ltd, Permoserstr, Leipzig (Germany). Centre for Environmental Research; Dehnert, J.; Nestler, W. [Hochschule fuer Technik und Wirtschaft Dresrden, Dresden (Germany)
1997-10-01
With a half life of 3.8 days, the {sup 222}Rn found in all groundwater makes an excellent tracer for solving several problems in the field of environmental research and hydrology. In Germany alluvial aquifers connected to rivers are used for drinking water extraction. Consequently importance is attached to studying the exchange processes between surface water and groundwater in order to determine infiltration velocities and infiltrate retention times in the aquifer. However, such investigations require a reliable, reproducible method for determining radon activity concentrations in groundwater samples, as well as a suitable sampling technique. This paper reports on just such a method, containing detailed instructions for sampling, transportation and activity determination using liquid scintillation spectrometry following toluene extraction. Spectral analysis and {alpha}/{beta} separation improve the accuracy of measurement. The detection limit is about 0.05 Bq/1; the total error is <{+-}10%. Infiltration processes are studied with {sup 222}Rn by employing the effect that surface water infiltrating an aquifer absorbs {sup 222}Rn along the infiltration pathway. As the degree of uptake is a function of the retention time, flow paths and flow velocities can all be determined by measuring the radon activity concentrations at the various groundwater gauging stations along measuring profiles. Corresponding investigations were carried out into a pleistocene aquifer below the River Elbe near a waterworks extracting bank-filtered water. The findings are presented and the technique`s possibilities and limitations are discussed 12 refs., 3 figs.
International Nuclear Information System (INIS)
Lobao, N.
1977-01-01
A method for the indoor determination of airborne radon and radon daughters is described, based in the utilization of cellulose nitrate (CN) ionographic detectors (LR-115-Kodak-Pathe) These track-etching detectors are coupled to an air sample and to a difusion chamber respectively. In the first system ambient air is pulled through a fiber glass filter for collection of airborne radon daughters (Flow: 230 ml/min). In the second system, the cellulose nitrate detectors is coupled/min). In the second system, the cellulose nitrate detectors is coupled to a difusion chamber electrostatic precipitator arrangement. Here the CN detector will register only the alpha particles given off by the decay products of Rn-222 formed within the sensitive volume of electrostatic precipitator. The construction of calibration curves for the two systems using adequate steady-state concentrations of Rn-220 and Rn-222 in an exposure chamber (1 cubic meter), will allow the use of the system for measurement of measurement of averaged integrated radon concentrations. The CN attached to the CN attached to the air sampler is exposed in the reference atmosphere with and without a mylar filter for discrimination of alpha particles with different energies Field sampling indicated however, that efficiency of the two systems are still low for the measurement of environmental levels of Rn-220 and Rn-222 within houses of the AENR, recommendations for efficienty improvement of the system are proposed [pt