DEFF Research Database (Denmark)
Tanackovic, Vanja
Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en......hanced traits known as the domestication syndrome. Wild grasses, on the other side, still have traits lost during the process. Brachypodium distachyon (Brachypodium) is one of the wild grass recently introduced as a model plant for temperate cereals, closely related to pre-domesticated cereals such as barley...... (Hordeum vulgare). This thesis focuses on domestication of grasses – the cereal ancestors, starch in the grass Brachypodium distachyon, and its comparison to domesticated cereal. Grasses can potentially be used for the reintroduction of the lost grass traits, like health-promoting carbohydrates. Therefore...
Starch bioengineering in Brachypodium distachyon
DEFF Research Database (Denmark)
Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A
2011-01-01
Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....
Cell wall composition throughout development for the model grass Brachypodium distachyon
Rancour, David M.; Marita, Jane M.; Hatfield, Ronald D.
2012-01-01
Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distachyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distachyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e., leaves, sheaths, stems, and roots) at three developmental stages of (1) 12-day seedling, (2) vegetative-to-reproductive transition, and (3) mature seed fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distachyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exist between Brachypodium and agronomical important C3 grasses, Brachypodium distachyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production. PMID:23227028
The WRKY transcription factor family in Brachypodium distachyon.
Tripathi, Prateek; Rabara, Roel C; Langum, Tanner J; Boken, Ashley K; Rushton, Deena L; Boomsma, Darius D; Rinerson, Charles I; Rabara, Jennifer; Reese, R Neil; Chen, Xianfeng; Rohila, Jai S; Rushton, Paul J
2012-06-22
A complete assembled genome sequence of wheat is not yet available. Therefore, model plant systems for wheat are very valuable. Brachypodium distachyon (Brachypodium) is such a system. The WRKY family of transcription factors is one of the most important families of plant transcriptional regulators with members regulating important agronomic traits. Studies of WRKY transcription factors in Brachypodium and wheat therefore promise to lead to new strategies for wheat improvement. We have identified and manually curated the WRKY transcription factor family from Brachypodium using a pipeline designed to identify all potential WRKY genes. 86 WRKY transcription factors were found, a total higher than all other current databases. We therefore propose that our numbering system (BdWRKY1-BdWRKY86) becomes the standard nomenclature. In the JGI v1.0 assembly of Brachypodium with the MIPS/JGI v1.0 annotation, nine of the transcription factors have no gene model and eleven gene models are probably incorrectly predicted. In total, twenty WRKY transcription factors (23.3%) do not appear to have accurate gene models. To facilitate use of our data, we have produced The Database of Brachypodium distachyon WRKY Transcription Factors. Each WRKY transcription factor has a gene page that includes predicted protein domains from MEME analyses. These conserved protein domains reflect possible input and output domains in signaling. The database also contains a BLAST search function where a large dataset of WRKY transcription factors, published genes, and an extensive set of wheat ESTs can be searched. We also produced a phylogram containing the WRKY transcription factor families from Brachypodium, rice, Arabidopsis, soybean, and Physcomitrella patens, together with published WRKY transcription factors from wheat. This phylogenetic tree provides evidence for orthologues, co-orthologues, and paralogues of Brachypodium WRKY transcription factors. The description of the WRKY transcription factor
Directory of Open Access Journals (Sweden)
Li Chuan
2012-05-01
Full Text Available Abstract Background Little is known about the potential of Brachypodium distachyon as a model for low temperature stress responses in Pooideae. The ice recrystallization inhibition protein (IRIP genes, fructosyltransferase (FST genes, and many C-repeat binding factor (CBF genes are Pooideae specific and important in low temperature responses. Here we used comparative analyses to study conservation and evolution of these gene families in B. distachyon to better understand its potential as a model species for agriculturally important temperate grasses. Results Brachypodium distachyon contains cold responsive IRIP genes which have evolved through Brachypodium specific gene family expansions. A large cold responsive CBF3 subfamily was identified in B. distachyon, while CBF4 homologs are absent from the genome. No B. distachyon FST gene homologs encode typical core Pooideae FST-motifs and low temperature induced fructan accumulation was dramatically different in B. distachyon compared to core Pooideae species. Conclusions We conclude that B. distachyon can serve as an interesting model for specific molecular mechanisms involved in low temperature responses in core Pooideae species. However, the evolutionary history of key genes involved in low temperature responses has been different in Brachypodium and core Pooideae species. These differences limit the use of B. distachyon as a model for holistic studies relevant for agricultural core Pooideae species.
Barbieri, M.; Marcel, T.C.; Niks, R.E.; Francia, E.; Pasquariello, M.; Mazzamurro, V.; Garvin, D.F.; Pecchioni, N.
2012-01-01
The potential of the model grass Brachypodium distachyon L. (Brachypodium) for studying grass–pathogen interactions is still underexploited. We aimed to identify genomic regions in Brachypodium associated with quantitative resistance to the false brome rust fungus Puccinia brachypodii. The inbred
Brachypodium distachyon. A New Model System for Functional Genomics in Grasses1
Draper, John; Mur, Luis A.J.; Jenkins, Glyn; Ghosh-Biswas, Gadab C.; Bablak, Pauline; Hasterok, Robert; Routledge, Andrew P.M.
2001-01-01
A new model for grass functional genomics is described based on Brachypodium distachyon, which in the evolution of the Pooideae diverged just prior to the clade of “core pooid” genera that contain the majority of important temperate cereals and forage grasses. Diploid ecotypes of B. distachyon (2n = 10) have five easily distinguishable chromosomes that display high levels of chiasma formation at meiosis. The B. distachyon nuclear genome was indistinguishable in size from that of Arabidopsis, making it the simplest genome described in grasses to date. B. distachyon is a self-fertile, inbreeding annual with a life cycle of less than 4 months. These features, coupled with its small size (approximately 20 cm at maturity), lack of seed-head shatter, and undemanding growth requirements should make it amenable to high-throughput genetics and mutant screens. Immature embryos exhibited a high capacity for plant regeneration via somatic embryogenesis. Regenerated plants display very low levels of albinism and have normal fertility. A simple transformation system has been developed based on microprojectile bombardment of embryogenic callus and hygromycin selection. Selected B. distachyon ecotypes were resistant to all tested cereal-adapted Blumeria graminis species and cereal brown rusts (Puccinia reconditia). In contrast, different ecotypes displayed resistance or disease symptoms following challenge with the rice blast pathogen (Magnaporthe grisea) and wheat/barley yellow stripe rusts (Puccinia striformis). Despite its small stature, B. distachyon has large seeds that should prove useful for studies on grain filling. Such biological characteristics represent important traits for study in temperate cereals. PMID:11743099
A Universal Genome Array and Transcriptome Atlas for Brachypodium Distachyon
Energy Technology Data Exchange (ETDEWEB)
Mockler, Todd [Oregon State Univ., Corvallis, OR (United States)
2017-04-17
Brachypodium distachyon is the premier experimental model grass platform and is related to candidate feedstock crops for bioethanol production. Based on the DOE-JGI Brachypodium Bd21 genome sequence and annotation we designed a whole genome DNA microarray platform. The quality of this array platform is unprecedented due to the exceptional quality of the Brachypodium genome assembly and annotation and the stringent probe selection criteria employed in the design. We worked with members of the international community and the bioinformatics/design team at Affymetrix at all stages in the development of the array. We used the Brachypodium arrays to interrogate the transcriptomes of plants grown in a variety of environmental conditions including diurnal and circadian light/temperature conditions and under a variety of environmental conditions. We examined the transciptional responses of Brachypodium seedlings subjected to various abiotic stresses including heat, cold, salt, and high intensity light. We generated a gene expression atlas representing various organs and developmental stages. The results of these efforts including all microarray datasets are published and available at online public databases.
Genome Wide Analysis of Nucleotide-Binding Site Disease Resistance Genes in Brachypodium distachyon
Directory of Open Access Journals (Sweden)
Shenglong Tan
2012-01-01
Full Text Available Nucleotide-binding site (NBS disease resistance genes play an important role in defending plants from a variety of pathogens and insect pests. Many R-genes have been identified in various plant species. However, little is known about the NBS-encoding genes in Brachypodium distachyon. In this study, using computational analysis of the B. distachyon genome, we identified 126 regular NBS-encoding genes and characterized them on the bases of structural diversity, conserved protein motifs, chromosomal locations, gene duplications, promoter region, and phylogenetic relationships. EST hits and full-length cDNA sequences (from Brachypodium database of 126 R-like candidates supported their existence. Based on the occurrence of conserved protein motifs such as coiled-coil (CC, NBS, leucine-rich repeat (LRR, these regular NBS-LRR genes were classified into four subgroups: CC-NBS-LRR, NBS-LRR, CC-NBS, and X-NBS. Further expression analysis of the regular NBS-encoding genes in Brachypodium database revealed that these genes are expressed in a wide range of libraries, including those constructed from various developmental stages, tissue types, and drought challenged or nonchallenged tissue.
Final technical report for: Insertional Mutagenesis of Brachypodium distachyon DE-AI02-07ER64452
Energy Technology Data Exchange (ETDEWEB)
John, Vogel P. [DOE Joint Genome Institute, Walnut Creek, CA (United States)
2015-10-29
Several bioenergy grasses are poised to become a major source of energy in the United States. Despite their increasing importance, we know little about the basic biology underlying the traits that control the utility of grasses as energy crops. Better knowledge of grass biology (e.g. identification of the genes that control cell wall composition, plant architecture, cell size, cell division, reproduction, nutrient uptake, carbon flux, etc.) could be used to design rational strategies for crop improvement and shorten the time required to domesticate these species. The use of an appropriate model system is an efficient way to gain this knowledge. Brachypodium distachyon is a small annual grass with all the attributes needed to be a modern model organism including simple growth requirements, fast generation time, small stature, small genome size and self-fertility. These attributes led to the recommendation in the DOE’s “Breaking the Biological Barriers to Cellulosic Ethanol: A Joint Research Agenda” report to propose developing and using B. distachyon as a model for energy crops to accelerate their domestication. Strategic investments (e.g. genome sequencing) in B. distachyon by the DOE are now bearing fruit and B. distachyon is being used as a model grass by hundreds of laboratories worldwide. Sequence indexed insertional mutants are an extremely powerful tool for both forward and reverse genetics. They allow researchers to order mutants in any gene tagged in the collection by simply emailing a request. The goal of this project was to create a collection of sequence indexed insertional mutants (T-DNA lines) for the model grass Brachypodium distachyon in order to facilitate research by the scientific community. During the course of this grant we created a collection of 23,649 B. distachyon T-DNA lines and identified 26,112 unique insertion sites. The collection can be queried through the project website (http://jgi.doe.gov/our-science/science-programs/plant-genomics/brachypodium/brachypodium
Directory of Open Access Journals (Sweden)
Akanksha Sharma
Full Text Available Comparative genomics have facilitated the mining of biological information from a genome sequence, through the detection of similarities and differences with genomes of closely or more distantly related species. By using such comparative approaches, knowledge can be transferred from the model to non-model organisms and insights can be gained in the structural and evolutionary patterns of specific genes. In the absence of sequenced genomes for allergenic grasses, this study was aimed at understanding the structure, organisation and expression profiles of grass pollen allergens using the genomic data from Brachypodium distachyon as it is phylogenetically related to the allergenic grasses. Combining genomic data with the anther RNA-Seq dataset revealed 24 pollen allergen genes belonging to eight allergen groups mapping on the five chromosomes in B. distachyon. High levels of anther-specific expression profiles were observed for the 24 identified putative allergen-encoding genes in Brachypodium. The genomic evidence suggests that gene encoding the group 5 allergen, the most potent trigger of hay fever and allergic asthma originated as a pollen specific orphan gene in a common grass ancestor of Brachypodium and Triticiae clades. Gene structure analysis showed that the putative allergen-encoding genes in Brachypodium either lack or contain reduced number of introns. Promoter analysis of the identified Brachypodium genes revealed the presence of specific cis-regulatory sequences likely responsible for high anther/pollen-specific expression. With the identification of putative allergen-encoding genes in Brachypodium, this study has also described some important plant gene families (e.g. expansin superfamily, EF-Hand family, profilins etc for the first time in the model plant Brachypodium. Altogether, the present study provides new insights into structural characterization and evolution of pollen allergens and will further serve as a base for their
Energy Technology Data Exchange (ETDEWEB)
Schulman, Al
2009-08-09
Three subfamilies of grasses, the Erhardtoideae (rice), the Panicoideae (maize, sorghum, sugar cane and millet), and the Pooideae (wheat, barley and cool season forage grasses) provide the basis of human nutrition and are poised to become major sources of renewable energy. Here we describe the complete genome sequence of the wild grass Brachypodium distachyon (Brachypodium), the first member of the Pooideae subfamily to be completely sequenced. Comparison of the Brachypodium, rice and sorghum genomes reveals a precise sequence- based history of genome evolution across a broad diversity of the grass family and identifies nested insertions of whole chromosomes into centromeric regions as a predominant mechanism driving chromosome evolution in the grasses. The relatively compact genome of Brachypodium is maintained by a balance of retroelement replication and loss. The complete genome sequence of Brachypodium, coupled to its exceptional promise as a model system for grass research, will support the development of new energy and food crops
Cell walls and the developmental anatomy of the Brachypodium distachyon stem internode.
Directory of Open Access Journals (Sweden)
Dominick A Matos
Full Text Available While many aspects of plant cell wall polymer structure are known, their spatial and temporal distribution within the stem are not well understood. Here, we studied vascular system and fiber development, which has implication for both biofuel feedstock conversion efficiency and crop yield. The subject of this study, Brachypodium distachyon, has emerged as a grass model for food and energy crop research. Here, we conducted our investigation using B. distachyon by applying various histological approaches and Fourier transform infrared spectroscopy to the stem internode from three key developmental stages. While vascular bundle size and number did not change over time, the size of the interfascicular region increased dramatically, as did cell wall thickness. We also describe internal stem internode anatomy and demonstrate that lignin deposition continues after crystalline cellulose and xylan accumulation ceases. The vascular bundle anatomy of B. distachyon appears to be highly similar to domesticated grasses. While the arrangement of bundles within the stem is highly variable across grasses, B. distachyon appears to be a suitable model for the rind of large C4 grass crops. A better understanding of growth and various anatomical and cell wall features of B. distachyon will further our understanding of plant biomass accumulation processes.
Quantitative Trait Loci Associated with Drought Tolerance in Brachypodium distachyon
Directory of Open Access Journals (Sweden)
Yiwei Jiang
2017-05-01
Full Text Available The temperate wild grass Brachypodium distachyon (Brachypodium serves as model system for studying turf and forage grasses. Brachypodium collections show diverse responses to drought stress, but little is known about the genetic mechanisms of drought tolerance of this species. The objective of this study was to identify quantitative trait loci (QTLs associated with drought tolerance traits in Brachypodium. We assessed leaf fresh weight (LFW, leaf dry weight (LDW, leaf water content (LWC, leaf wilting (WT, and chlorophyll fluorescence (Fv/Fm under well-watered and drought conditions on a recombinant inbred line (RIL population from two parents (Bd3-1 and Bd1-1 known to differ in their drought adaptation. A linkage map of the RIL population was constructed using 467 single nucleotide polymorphism (SNP markers obtained from genotyping-by-sequencing. The Bd3-1/Bd1-1 map spanned 1,618 cM and had an average distance of 3.5 cM between adjacent single nucleotide polymorphisms (SNPs. Twenty-six QTLs were identified in chromosome 1, 2, and 3 in two experiments, with 14 of the QTLs under well-watered conditions and 12 QTLs under drought stress. In Experiment 1, a QTL located on chromosome 2 with a peak at 182 cM appeared to simultaneously control WT, LWC, and Fv/Fm under drought stress, accounting for 11–18.7% of the phenotypic variation. Allelic diversity of candidate genes DREB2B, MYB, and SPK, which reside in one multi-QTL region, may play a role in the natural variation in whole plant drought tolerance in Brachypodium. Co-localization of QTLs for multiple drought-related traits suggest that the gene(s involved are important regulators of drought tolerance in Brachypodium.
Directory of Open Access Journals (Sweden)
Shuhei Noda
Full Text Available To demonstrate that herbaceous biomass is a versatile gene resource, we focused on the model plant Brachypodium distachyon, and screened the B. distachyon for homologs of tyrosine decarboxylase (TDC, which is involved in the modification of aromatic compounds. A total of 5 candidate genes were identified in cDNA libraries of B. distachyon and were introduced into Saccharomyces cerevisiae to evaluate TDC expression and tyramine production. It is suggested that two TDCs encoded in the transcripts Bradi2g51120.1 and Bradi2g51170.1 have L-tyrosine decarboxylation activity. Bradi2g51170.1 was introduced into the L-tyrosine over-producing strain of S. cerevisiae that was constructed by the introduction of mutant genes that promote deregulated feedback inhibition. The amount of tyramine produced by the resulting transformant was 6.6-fold higher (approximately 200 mg/L than the control strain, indicating that B. distachyon TDC effectively converts L-tyrosine to tyramine. Our results suggest that B. distachyon possesses enzymes that are capable of modifying aromatic residues, and that S. cerevisiae is a suitable host for the production of L-tyrosine derivatives.
Sogutmaz Ozdemir, Bahar; Budak, Hikmet
2018-01-01
Brachypodium distachyon has recently emerged as a model plant species for the grass family (Poaceae) that includes major cereal crops and forage grasses. One of the important traits of a model species is its capacity to be transformed and ease of growing both in tissue culture and in greenhouse conditions. Hence, plant transformation technology is crucial for improvements in agricultural studies, both for the study of new genes and in the production of new transgenic plant species. In this chapter, we review an efficient tissue culture and two different transformation systems for Brachypodium using most commonly preferred gene transfer techniques in plant species, microprojectile bombardment method (biolistics) and Agrobacterium-mediated transformation.In plant transformation studies, frequently used explant materials are immature embryos due to their higher transformation efficiencies and regeneration capacity. However, mature embryos are available throughout the year in contrast to immature embryos. We explain a tissue culture protocol for Brachypodium using mature embryos with the selected inbred lines from our collection. Embryogenic calluses obtained from mature embryos are used to transform Brachypodium with both plant transformation techniques that are revised according to previously studied protocols applied in the grasses, such as applying vacuum infiltration, different wounding effects, modification in inoculation and cocultivation steps or optimization of bombardment parameters.
Li, Yinjia; Zuo, Sheng; Zhang, Zhiliang; Li, Zhanjie; Han, Jinlei; Chu, Zhaoqing; Hasterok, Robert; Wang, Kai
2018-03-01
Brachypodium distachyon is a well-established model monocot plant, and its small and compact genome has been used as an accurate reference for the much larger and often polyploid genomes of cereals such as Avena sativa (oats), Hordeum vulgare (barley) and Triticum aestivum (wheat). Centromeres are indispensable functional units of chromosomes and they play a core role in genome polyploidization events during evolution. As the Brachypodium genus contains about 20 species that differ significantly in terms of their basic chromosome numbers, genome size, ploidy levels and life strategies, studying their centromeres may provide important insight into the structure and evolution of the genome in this interesting and important genus. In this study, we isolated the centromeric DNA of the B. distachyon reference line Bd21 and characterized its composition via the chromatin immunoprecipitation of the nucleosomes that contain the centromere-specific histone CENH3. We revealed that the centromeres of Bd21 have the features of typical multicellular eukaryotic centromeres. Strikingly, these centromeres contain relatively few centromeric satellite DNAs; in particular, the centromere of chromosome 5 (Bd5) consists of only ~40 kb. Moreover, the centromeric retrotransposons in B. distachyon (CRBds) are evolutionarily young. These transposable elements are located both within and adjacent to the CENH3 binding domains, and have similar compositions. Moreover, based on the presence of CRBds in the centromeres, the species in this study can be grouped into two distinct lineages. This may provide new evidence regarding the phylogenetic relationships within the Brachypodium genus. © 2018 The Authors The Plant Journal © 2018 John Wiley & Sons Ltd.
Centromeres cluster de novo at the beginning of meiosis in Brachypodium distachyon.
Directory of Open Access Journals (Sweden)
Ruoyu Wen
Full Text Available In most eukaryotes that have been studied, the telomeres cluster into a bouquet early in meiosis, and in wheat and its relatives and in Arabidopsis the centromeres pair at the same time. In Arabidopsis, the telomeres do not cluster as a typical telomere bouquet on the nuclear membrane but are associated with the nucleolus both somatically and at the onset of meiosis. We therefore assessed whether Brachypodium distachyon, a monocot species related to cereals and whose genome is approximately twice the size of Arabidopsis thaliana, also exhibited an atypical telomere bouquet and centromere pairing. In order to investigate the occurrence of a bouquet and centromere pairing in B distachyon, we first had to establish protocols for studying meiosis in this species. This enabled us to visualize chromosome behaviour in meiocytes derived from young B distachyon spikelets in three-dimensions by fluorescent in situ hybridization (FISH, and accurately to stage meiosis based on chromatin morphology in relation to spikelet size and the timing of sample collection. Surprisingly, this study revealed that the centromeres clustered as a single site at the same time as the telomeres also formed a bouquet or single cluster.
Gill, Upinder S; Uppalapati, Srinivasa R; Nakashima, Jin; Mysore, Kirankumar S
2015-05-08
Switchgrass rust, caused by Puccinia emaculata, is an important disease of switchgrass, a potential biofuel crop in the United States. In severe cases, switchgrass rust has the potential to significantly affect biomass yield. In an effort to identify novel sources of resistance against switchgrass rust, we explored nonhost resistance against P. emaculata by characterizing its interactions with six monocot nonhost plant species. We also studied the genetic variations for resistance among Brachypodium inbred accessions and the involvement of various defense pathways in nonhost resistance of Brachypodium. We characterized P. emaculata interactions with six monocot nonhost species and identified Brachypodium distachyon (Bd21) as a suitable nonhost model to study switchgrass rust. Interestingly, screening of Brachypodium accessions identified natural variations in resistance to switchgrass rust. Brachypodium inbred accessions Bd3-1 and Bd30-1 were identified as most and least resistant to switchgrass rust, respectively, when compared to tested accessions. Transcript profiling of defense-related genes indicated that the genes which were induced in Bd21after P. emaculata inoculation also had higher basal transcript abundance in Bd3-1 when compared to Bd30-1 and Bd21 indicating their potential involvement in nonhost resistance against switchgrass rust. In the present study, we identified Brachypodium as a suitable nonhost model to study switchgrass rust which exhibit type I nonhost resistance. Variations in resistance response were also observed among tested Brachypodium accessions. Brachypodium nonhost resistance against P. emaculata may involve various defense pathways as indicated by transcript profiling of defense related genes. Overall, this study provides a new avenue to utilize novel sources of nonhost resistance in Brachypodium against switchgrass rust.
Directory of Open Access Journals (Sweden)
Satoru Koda
2017-11-01
Full Text Available We report the comprehensive identification of periodic genes and their network inference, based on a gene co-expression analysis and an Auto-Regressive eXogenous (ARX model with a group smoothly clipped absolute deviation (SCAD method using a time-series transcriptome dataset in a model grass, Brachypodium distachyon. To reveal the diurnal changes in the transcriptome in B. distachyon, we performed RNA-seq analysis of its leaves sampled through a diurnal cycle of over 48 h at 4 h intervals using three biological replications, and identified 3,621 periodic genes through our wavelet analysis. The expression data are feasible to infer network sparsity based on ARX models. We found that genes involved in biological processes such as transcriptional regulation, protein degradation, and post-transcriptional modification and photosynthesis are significantly enriched in the periodic genes, suggesting that these processes might be regulated by circadian rhythm in B. distachyon. On the basis of the time-series expression patterns of the periodic genes, we constructed a chronological gene co-expression network and identified putative transcription factors encoding genes that might be involved in the time-specific regulatory transcriptional network. Moreover, we inferred a transcriptional network composed of the periodic genes in B. distachyon, aiming to identify genes associated with other genes through variable selection by grouping time points for each gene. Based on the ARX model with the group SCAD regularization using our time-series expression datasets of the periodic genes, we constructed gene networks and found that the networks represent typical scale-free structure. Our findings demonstrate that the diurnal changes in the transcriptome in B. distachyon leaves have a sparse network structure, demonstrating the spatiotemporal gene regulatory network over the cyclic phase transitions in B. distachyon diurnal growth.
Time-dependent leaf proteome alterations of Brachypodium distachyon in response to drought stress.
Tatli, Ozge; Sogutmaz Ozdemir, Bahar; Dinler Doganay, Gizem
2017-08-01
For the first time, a comprehensive proteome analysis was conducted on Brachypodium leaves under drought stress. Gradual changes in response to drought stress were monitored. Drought is one of the major stress factors that dramatically affect the agricultural productivity worldwide. Improving the yield under drought is an urgent challenge in agriculture. Brachypodium distachyon is a model species for monocot plants such as wheat, barley and several potential biofuel grasses. In the current study, a comprehensive proteome analysis was conducted on Brachypodium leaves under different levels of drought application. To screen gradual changes upon drought, Brachypodium leaves subjected to drought for 4, 8 and 12 days were collected for each treatment day and relative water content of the leaves was measured for each time point. Cellular responses of Brachypodium were investigated through a proteomic approach involving two dimensional difference gel electrophoresis (2D-DIGE) and mass spectrometry (MS). Among 497 distinct spots in Brachypodium protein repertoire, a total of 13 differentially expressed proteins (DEPs) were identified as responsive to drought by mass spectrometry and classified according to their functions using bioinformatics tools. The biological functions of DEPs included roles in photosynthesis, protein folding, antioxidant mechanism and metabolic processes, which responded differentially at each time point of drought treatment. To examine further transcriptional expression of the genes that code identified protein, quantitative real time PCR (qRT-PCR) was performed. Identified proteins will contribute to the studies involving development of drought-resistant crop species and lead to the delineation of molecular mechanisms in drought response.
Energy Technology Data Exchange (ETDEWEB)
Harrison, Maria J [Boyce Thompson Institute, Ithaca, NY (United States); Hudson, Matthew E [Univ. of Illinois, Champaign, IL (United States)
2015-11-24
Most vascular flowering plants have the ability to form symbiotic associations with arbuscular mycorrhizal (AM) fungi. The symbiosis develops in the roots and can have a profound effect on plant productivity, largely through improvements in plant mineral nutrition. Within the root cortical cells, the plant and fungus create novel interfaces specialized for nutrient transfer, while the fungus also develops a network of hyphae in the rhizosphere. Through this hyphal network, the fungus acquires and delivers phosphate and nitrogen to the root. In return, the plant provides the fungus with carbon. In addition, to enhancing plant mineral nutrition, the AM symbiosis has an important role in the carbon cycle, and positive effects on soil health. Here we identified and characterized plant genes involved in the regulation and functioning of the AM symbiosis in Medicago truncatula and Brachypodium distachyon. This included the identification and and characterization of a M. truncatula transcription factors that are required for symbiosis. Additionally, we investigated the molecular basis of functional diversity among AM symbioses in B. distachyon and analysed the transcriptome of Brachypodium distachyon during symbiosis.
Annotation and comparative analysis of the glycoside hydrolase genes in Brachypodium distachyon
Directory of Open Access Journals (Sweden)
Wu Jiajie
2010-10-01
Full Text Available Abstract Background Glycoside hydrolases cleave the bond between a carbohydrate and another carbohydrate, a protein, lipid or other moiety. Genes encoding glycoside hydrolases are found in a wide range of organisms, from archea to animals, and are relatively abundant in plant genomes. In plants, these enzymes are involved in diverse processes, including starch metabolism, defense, and cell-wall remodeling. Glycoside hydrolase genes have been previously cataloged for Oryza sativa (rice, the model dicotyledonous plant Arabidopsis thaliana, and the fast-growing tree Populus trichocarpa (poplar. To improve our understanding of glycoside hydrolases in plants generally and in grasses specifically, we annotated the glycoside hydrolase genes in the grasses Brachypodium distachyon (an emerging monocotyledonous model and Sorghum bicolor (sorghum. We then compared the glycoside hydrolases across species, at the levels of the whole genome and individual glycoside hydrolase families. Results We identified 356 glycoside hydrolase genes in Brachypodium and 404 in sorghum. The corresponding proteins fell into the same 34 families that are represented in rice, Arabidopsis, and poplar, helping to define a glycoside hydrolase family profile which may be common to flowering plants. For several glycoside hydrolase familes (GH5, GH13, GH18, GH19, GH28, and GH51, we present a detailed literature review together with an examination of the family structures. This analysis of individual families revealed both similarities and distinctions between monocots and eudicots, as well as between species. Shared evolutionary histories appear to be modified by lineage-specific expansions or deletions. Within GH families, the Brachypodium and sorghum proteins generally cluster with those from other monocots. Conclusions This work provides the foundation for further comparative and functional analyses of plant glycoside hydrolases. Defining the Brachypodium glycoside hydrolases sets
DEFF Research Database (Denmark)
Pacak, Andrzej; Geisler, Katrin; Jørgensen, Bodil
2010-01-01
-expressed genes we wanted to explore the potential of BSMV for silencing genes in root tissues. Furthermore, the newly completed genome sequence of the emerging cereal model species Brachypodium distachyon as well as the increasing amount of EST sequence information available for oat (Avena species) have created...
Pushing the boundaries of resistance: insights from Brachypodium-rust interactions
Directory of Open Access Journals (Sweden)
Melania eFigueroa
2015-07-01
Full Text Available The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with increased virulence and recurrent rust epidemics around the world point out the vulnerability of monocultures. Basic research in plant immunity, especially in model plants, can make contributions to understanding plant resistance mechanisms and improve disease management strategies. The development of the grass Brachypodium distachyon as a genetically tractable model for monocots, especially temperate cereals and grasses, offers the possibility to overcome the experimental challenges presented by the genetic and genomic complexities of economically valuable crop plants. The numerous resources and tools available in Brachypodium have opened new doors to investigate the underlying molecular and genetic bases of plant-microbe interactions in grasses and evidence demonstrating the applicability and advantages of working with B. distachyon is increasing. Importantly, several interactions between B. distachyon and devastating plant pathogens, such rust fungi, have been examined in the context of non-host resistance. Here, we discuss the use of B. distachyon in these various pathosystems. Exploiting B. distachyon to understand the mechanisms underpinning disease resistance to non-adapted rust fungi may provide effective and durable approaches to fend off these pathogens. The close phylogenetic relationship among Brachypodium spp. and grasses with industrial and agronomic value support harnessing this model plant to improve cropping systems and encourage its use in
Sibout, Richard; Proost, Sebastian; Hansen, Bjoern Oest; Vaid, Neha; Giorgi, Federico M; Ho-Yue-Kuang, Severine; Legée, Frédéric; Cézart, Laurent; Bouchabké-Coussa, Oumaya; Soulhat, Camille; Provart, Nicholas; Pasha, Asher; Le Bris, Philippe; Roujol, David; Hofte, Herman; Jamet, Elisabeth; Lapierre, Catherine; Persson, Staffan; Mutwil, Marek
2017-08-01
While Brachypodium distachyon (Brachypodium) is an emerging model for grasses, no expression atlas or gene coexpression network is available. Such tools are of high importance to provide insights into the function of Brachypodium genes. We present a detailed Brachypodium expression atlas, capturing gene expression in its major organs at different developmental stages. The data were integrated into a large-scale coexpression database ( www.gene2function.de), enabling identification of duplicated pathways and conserved processes across 10 plant species, thus allowing genome-wide inference of gene function. We highlight the importance of the atlas and the platform through the identification of duplicated cell wall modules, and show that a lignin biosynthesis module is conserved across angiosperms. We identified and functionally characterised a putative ferulate 5-hydroxylase gene through overexpression of it in Brachypodium, which resulted in an increase in lignin syringyl units and reduced lignin content of mature stems, and led to improved saccharification of the stem biomass. Our Brachypodium expression atlas thus provides a powerful resource to reveal functionally related genes, which may advance our understanding of important biological processes in grasses. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Henry D Priest
Full Text Available Brachypodium distachyon is a close relative of many important cereal crops. Abiotic stress tolerance has a significant impact on productivity of agriculturally important food and feedstock crops. Analysis of the transcriptome of Brachypodium after chilling, high-salinity, drought, and heat stresses revealed diverse differential expression of many transcripts. Weighted Gene Co-Expression Network Analysis revealed 22 distinct gene modules with specific profiles of expression under each stress. Promoter analysis implicated short DNA sequences directly upstream of module members in the regulation of 21 of 22 modules. Functional analysis of module members revealed enrichment in functional terms for 10 of 22 network modules. Analysis of condition-specific correlations between differentially expressed gene pairs revealed extensive plasticity in the expression relationships of gene pairs. Photosynthesis, cell cycle, and cell wall expression modules were down-regulated by all abiotic stresses. Modules which were up-regulated by each abiotic stress fell into diverse and unique gene ontology GO categories. This study provides genomics resources and improves our understanding of abiotic stress responses of Brachypodium.
Wen, Feng; Zhu, Hong; Li, Peng; Jiang, Min; Mao, Wenqing; Ong, Chermaine; Chu, Zhaoqing
2014-06-01
Members of plant WRKY gene family are ancient transcription factors that function in plant growth and development and respond to biotic and abiotic stresses. In our present study, we have investigated WRKY family genes in Brachypodium distachyon, a new model plant of family Poaceae. We identified a total of 86 WRKY genes from B. distachyon and explored their chromosomal distribution and evolution, domain alignment, promoter cis-elements, and expression profiles. Combining the analysis of phylogenetic tree of BdWRKY genes and the result of expression profiling, results showed that most of clustered gene pairs had higher similarities in the WRKY domain, suggesting that they might be functionally redundant. Neighbour-joining analysis of 301 WRKY domains from Oryza sativa, Arabidopsis thaliana, and B. distachyon suggested that BdWRKY domains are evolutionarily more closely related to O. sativa WRKY domains than those of A. thaliana. Moreover, tissue-specific expression profile of BdWRKY genes and their responses to phytohormones and several biotic or abiotic stresses were analysed by quantitative real-time PCR. The results showed that the expression of BdWRKY genes was rapidly regulated by stresses and phytohormones, and there was a strong correlation between promoter cis-elements and the phytohormones-induced BdWRKY gene expression. © The Author 2014. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.
2012-01-01
Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW
Energy Technology Data Exchange (ETDEWEB)
Vogel, John P. [USDA ARS Western Regional Research Center, Albany, NY (United States)
2014-12-17
The goal of this project was to apply high-throughput, non-destructive phenotyping (phenomics) to collections of natural variants and induced mutants of the model grass Brachypodium distachyon and characterize a small subset of that material in detail. B. distachyon is well suited to this phenomic approach because its small size and rapid generation time allow researchers to grow many plants under carefully controlled conditions. In addition, the simple diploid genetics, high quality genome sequence and existence of numerous experimental tools available for B. distachyon allow us to rapidly identify genes affecting specific phenotypes. Our phenomic analysis revealed great diversity in biofuel-relevant traits like growth rate, biomass and photosynthetic rate. This clearly demonstrated the feasibility of applying a phenomic approach to the model grass B. distachyon. We also demonstrated the utility of B. distachyon for studying mature root system, something that is virtually impossible to do with biomass crops. We showed tremendous natural variation in root architecture that can potentially be used to design crops with superior nutrient and water harvesting capability. Finally, we demonstrated the speed with which we can link specific genes to specific phenotypes by studying two mutants in detail. Importantly, in both cases, the specific biological lessons learned were grass-specific and could not have been learned from a dicot model system. Furthermore, one of the genes affects cell wall integrity and thus may be a useful target in the context of biomass crop improvement. Ultimately, all this information can be used to accelerate the creation of improved biomass crops.
The deposition and characterization of starch in Brachypodium distachyon
DEFF Research Database (Denmark)
Tanackovic, Vanja; Svensson, Jan T.; Jensen, Susanne Langgård
2014-01-01
doughnut shaped and bimodally distributed into distinct small B-type (2.5-10 µm) and very small C-type (0.5-2.5 µm) granules. Large A-type granules, typical of cereals, were absent. Starch-bound phosphate, important for starch degradation, was 2-fold lower in Brachypodium compared with barley indicating...... different requirements for starch mobilization. The amylopectin branch profiles were similar and the amylose content was only slightly higher compared with barley cv. Golden Promise. The crystallinity of Brachypodium starch granules was low (10%) compared to barley (20%) as determined by wide-angle X......-ray scattering (WAXS) and molecular disorder was confirmed by differential scanning calorimetry (DSC). The expression profiles in grain for most genes were distinctly different for Brachypodium compared to barley, typically showing earlier decline during the course of development, which can explain the low...
Directory of Open Access Journals (Sweden)
Alexander Betekhtin
2018-03-01
Full Text Available The plant cell wall shows a great diversity regarding its chemical composition, which may vary significantly even during different developmental stages. In this study, we analysed the distribution of several cell wall epitopes in embryos of Brachypodium distachyon (Brachypodium. We also described the variations in the nucleus shape and the number of nucleoli that occurred in some embryo cells. The use of transmission electron microscopy, and histological and immunolocalisation techniques permitted the distribution of selected arabinogalactan proteins, extensins, pectins, and hemicelluloses on the embryo surface, internal cell compartments, and in the context of the cell wall ultrastructure to be demonstrated. We revealed that the majority of arabinogalactan proteins and extensins were distributed on the cell surface and that pectins were the main component of the seed coat and other parts, such as the mesocotyl cell walls and the radicula. Hemicelluloses were localised in the cell wall and outside of the radicula protodermis, respectively. The specific arrangement of those components may indicate their significance during embryo development and seed germination, thus suggesting the importance of their protective functions. Despite the differences in the cell wall composition, we found that some of the antibodies can be used as markers to identify specific cells and the parts of the developing Brachypodium embryo.
Update on the genomics and basic biology of Brachypodium
DEFF Research Database (Denmark)
Catalan, Pilar; Chalhoub, Boulos; Chochois, Vincent
2014-01-01
The scientific presentations at the First International Brachypodium Conference (abstracts available at http://www.brachy2013.unimore.it) are evidence of the wide-spread adoption of Brachypodium distachyon as a model system. Furthermore, the wide range of topics presented (genome evolution, roots...
DEFF Research Database (Denmark)
Olsen, P.; Lenk, I.; Jensen, Christian S.
2006-01-01
Despite the great contribution of model organisms, such as Arabidopsis and rice to understand biological processes in plants, these models are less valuable for functional studies of particular genes from temperate grass crop species. Therefore a new model plant is required, displaying features...... including close phylogenetic relationship to the temperate grasses, vernalisation requirement, high transformation efficiency, small genome size and a rapid life cycle. These requirements are all fulfilled by the small annual grass Brachypodium distachyon. As a first step towards implementing this plant...
Dinh Thi, Vinh Ha; Coriton, Olivier; Le Clainche, Isabelle; Arnaud, Dominique; Gordon, Sean P.; Linc, Gabriella; Catalan, Pilar; Hasterok, Robert; Vogel, John P.; Jahier, Joseph; Chalhoub, Boulos
2016-01-01
Brachypodium hybridum (2n = 30) is a natural allopolyploid with highly divergent sub-genomes derived from two extant diploid species, B. distachyon (2n = 10) and B. stacei (2n = 20) that differ in chromosome evolution and number. We created synthetic B. hybridum allotetraploids by hybridizing various lines of B. distachyon and B. stacei. The initial amphihaploid F1 interspecific hybrids were obtained at low frequencies when B. distachyon was used as the maternal parent (0.15% or 0.245% depending on the line used) and were sterile. No hybrids were obtained from reciprocal crosses or when autotetraploids of the parental species were crossed. Colchicine treatment was used to double the genome of the F1 amphihaploid lines leading to allotetraploids. The genome-doubled F1 plants produced a few S1 (first selfed generation) seeds after self-pollination. S1 plants from one parental combination (Bd3-1×Bsta5) were fertile and gave rise to further generations whereas those of another parental combination (Bd21×ABR114) were sterile, illustrating the importance of the parental lineages crossed. The synthetic allotetraploids were stable and resembled the natural B. hybridum at the phenotypic, cytogenetic and genomic levels. The successful creation of synthetic B. hybridum offers the possibility to study changes in genome structure and regulation at the earliest stages of allopolyploid formation in comparison with the parental species and natural B. hybridum. PMID:27936041
Directory of Open Access Journals (Sweden)
Lorraine H.C. Fisher
2016-11-01
Full Text Available Drought is an important environmental stress limiting the productivity of major crops worldwide. Understanding drought tolerance and possible mechanisms for improving drought resistance is therefore a prerequisite to develop drought-tolerant crops that produce significant yields with reduced amounts of water. Brachypodium distachyon (Brachypodium is a key model species for cereals, forage grasses and energy grasses. In this study, initial screening of a Brachypodium germplasm collection consisting of 138 different ecotypes exposed to progressive drought, highlighted the natural variation in morphology, biomass accumulation and responses to drought stress. A core set of ten ecotypes, classified as being either tolerant, susceptible or intermediate, in response to drought stress, were exposed to mild or severe (respectively 15% and 0% soil water content drought stress and phenomic parameters linked to growth and colour changes were assessed. When exposed to severe drought stress, phenotypic data and metabolite profiling combined with multivariate analysis revealed a remarkable consistency in separating the selected ecotypes into their different pre-defined drought tolerance groups. Increases in several metabolites, including for the phytohormones jasmonic acid and salicylic acid, and TCA-cycle intermediates, were positively correlated with biomass yield and with reduced yellow pixel counts; suggestive of delayed senescence, both key target traits for crop improvement to drought stress. While metabolite analysis also separated ecotypes into the distinct tolerance groupings after exposure to mild drought stress, similar analysis of the phenotypic data failed to do so, confirming the value of metabolomics to investigate early responses to drought stress. The results highlight the potential of combining the analyses of phenotypic and metabolic responses to identify key mechanisms and markers associated with drought tolerance in both the Brachypodium
Kouzai, Yusuke; Kimura, Mamiko; Yamanaka, Yurie; Watanabe, Megumi; Matsui, Hidenori; Yamamoto, Mikihiro; Ichinose, Yuki; Toyoda, Kazuhiro; Onda, Yoshihiko; Mochida, Keiichi; Noutoshi, Yoshiteru
2016-03-02
Brachypodium distachyon is a promising model plants for grasses. Infections of Brachypodium by various pathogens that severely impair crop production have been reported, and the species accordingly provides an alternative platform for investigating molecular mechanisms of pathogen virulence and plant disease resistance. To date, we have a broad picture of plant immunity only in Arabidopsis and rice; therefore, Brachypodium may constitute a counterpart that displays the commonality and uniqueness of defence systems among plant species. Phytohormones play key roles in plant biotic stress responses, and hormone-responsive genes are used to qualitatively and quantitatively evaluate disease resistance responses during pathogen infection. For these purposes, defence-related phytohormone marker genes expressed at time points suitable for defence-response monitoring are needed. Information about their expression profiles over time as well as their response specificity is also helpful. However, useful marker genes are still rare in Brachypodium. We selected 34 candidates for Brachypodium marker genes on the basis of protein-sequence similarity to known marker genes used in Arabidopsis and rice. Brachypodium plants were treated with the defence-related phytohormones salicylic acid, jasmonic acid and ethylene, and their transcription levels were measured 24 and 48 h after treatment. Two genes for salicylic acid, 7 for jasmonic acid and 2 for ethylene were significantly induced at either or both time points. We then focused on 11 genes encoding pathogenesis-related (PR) 1 protein and compared their expression patterns with those of Arabidopsis and rice. Phylogenetic analysis suggested that Brachypodium contains several PR1-family genes similar to rice genes. Our expression profiling revealed that regulation patterns of some PR1 genes as well as of markers identified for defence-related phytohormones are closely related to those in rice. We propose that the Brachypodium immune
Directory of Open Access Journals (Sweden)
Hernando-Amado Sara
2012-11-01
Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal
Directory of Open Access Journals (Sweden)
Alexandre Martel
2017-12-01
Full Text Available The epigenetic modulatory SAGA complex is involved in various developmental and stress responsive pathways in plants. Alternative transcripts of the SAGA complex's enzymatic subunit GCN5 have been identified in Brachypodium distachyon. These splice variants differ based on the presence and integrity of their conserved domain sequences: the histone acetyltransferase domain, responsible for catalytic activity, and the bromodomain, involved in acetyl-lysine binding and genomic loci targeting. GCN5 is the wild-type transcript, while alternative splice sites result in the following transcriptional variants: L-GCN5, which is missing the bromodomain and S-GCN5, which lacks the bromodomain as well as certain motifs of the histone acetyltransferase domain. Absolute mRNA quantification revealed that, across eight B. distachyon accessions, GCN5 was the dominant transcript isoform, accounting for up to 90% of the entire transcript pool, followed by L-GCN5 and S-GCN5. A cycloheximide treatment further revealed that the S-GCN5 splice variant was degraded through the nonsense-mediated decay pathway. All alternative BdGCN5 transcripts displayed similar transcript profiles, being induced during early exposure to heat and displaying higher levels of accumulation in the crown, compared to aerial tissues. All predicted protein isoforms localize to the nucleus, which lends weight to their purported epigenetic functions. S-GCN5 was incapable of forming an in vivo protein interaction with ADA2, the transcriptional adaptor that links the histone acetyltransferase subunit to the SAGA complex, while both GCN5 and L-GCN5 interacted with ADA2, which suggests that a complete histone acetyltransferase domain is required for BdGCN5-BdADA2 interaction in vivo. Thus, there has been a diversification in BdGCN5 through alternative splicing that has resulted in differences in conserved domain composition, transcript fate and in vivo protein interaction partners. Furthermore, our
Gordon, Sean P; Contreras-Moreira, Bruno; Woods, Daniel P; Des Marais, David L; Burgess, Diane; Shu, Shengqiang; Stritt, Christoph; Roulin, Anne C; Schackwitz, Wendy; Tyler, Ludmila; Martin, Joel; Lipzen, Anna; Dochy, Niklas; Phillips, Jeremy; Barry, Kerrie; Geuten, Koen; Budak, Hikmet; Juenger, Thomas E; Amasino, Richard; Caicedo, Ana L; Goodstein, David; Davidson, Patrick; Mur, Luis A J; Figueroa, Melania; Freeling, Michael; Catalan, Pilar; Vogel, John P
2017-12-19
While prokaryotic pan-genomes have been shown to contain many more genes than any individual organism, the prevalence and functional significance of differentially present genes in eukaryotes remains poorly understood. Whole-genome de novo assembly and annotation of 54 lines of the grass Brachypodium distachyon yield a pan-genome containing nearly twice the number of genes found in any individual genome. Genes present in all lines are enriched for essential biological functions, while genes present in only some lines are enriched for conditionally beneficial functions (e.g., defense and development), display faster evolutionary rates, lie closer to transposable elements and are less likely to be syntenic with orthologous genes in other grasses. Our data suggest that differentially present genes contribute substantially to phenotypic variation within a eukaryote species, these genes have a major influence in population genetics, and transposable elements play a key role in pan-genome evolution.
Directory of Open Access Journals (Sweden)
Yu Cui
Full Text Available The ND18 strain of Barley stripe mosaic virus (BSMV infects several lines of Brachypodium distachyon, a recently developed model system for genomics research in cereals. Among the inbred lines tested, Bd3-1 is highly resistant at 20 to 25 °C, whereas Bd21 is susceptible and infection results in an intense mosaic phenotype accompanied by high levels of replicating virus. We generated an F(6:7 recombinant inbred line (RIL population from a cross between Bd3-1 and Bd21 and used the RILs, and an F(2 population of a second Bd21 × Bd3-1 cross to evaluate the inheritance of resistance. The results indicate that resistance segregates as expected for a single dominant gene, which we have designated Barley stripe mosaic virus resistance 1 (Bsr1. We constructed a genetic linkage map of the RIL population using SNP markers to map this gene to within 705 Kb of the distal end of the top of chromosome 3. Additional CAPS and Indel markers were used to fine map Bsr1 to a 23 Kb interval containing five putative genes. Our study demonstrates the power of using RILs to rapidly map the genetic determinants of BSMV resistance in Brachypodium. Moreover, the RILs and their associated genetic map, when combined with the complete genomic sequence of Brachypodium, provide new resources for genetic analyses of many other traits.
Directory of Open Access Journals (Sweden)
François Gagné-Bourque
Full Text Available Plant growth-promoting bacteria (PGB induce positive effects in plants, for instance, increased growth and reduced abiotic stresses susceptibility. The mechanisms by which these bacteria impact the host plant are numerous, diverse and often specific. Here, we studied the agronomical, molecular and biochemical effects of the endophytic PGB Bacillus subtilis B26 on the full life cycle of Brachypodium distachyon Bd21, an established model species for functional genomics in cereal crops and temperate grasses. Inoculation of Brachypodium with B. subtilis strain B26 increased root and shoot weights, accelerated growth rate and seed yield as compared to control plants. B. subtilis strain B26 efficiently colonized the plant and was recovered from roots, stems and blades as well as seeds of Brachypodium, indicating that the bacterium is able to migrate, spread systemically inside the plant, establish itself in the aerial plant tissues and organs, and is vertically transmitted to seeds. The presence of B. subtilis strain B26 in the seed led to systemic colonization of the next generation of Brachypodium plants. Inoculated Brachypodium seedlings and mature plants exposed to acute and chronic drought stress minimized the phenotypic effect of drought compared to plants not harbouring the bacterium. Protection from the inhibitory effects of drought by the bacterium was linked to upregulation of the drought-response genes, DREB2B-like, DHN3-like and LEA-14-A-like and modulation of the DNA methylation genes, MET1B-like, CMT3-like and DRM2-like, that regulate the process. Additionally, total soluble sugars and starch contents increased in stressed inoculated plants, a biochemical indication of drought tolerance. In conclusion, we show a single inoculation of Brachypodium with a PGB affected the whole growth cycle of the plant, accelerating its growth rates, shortening its vegetative period, and alleviating drought stress effects. These effects are relevant to
Directory of Open Access Journals (Sweden)
Dominick A Matos
Full Text Available Plant growth is commonly regulated by external cues such as light, temperature, water availability, and internal cues generated by the circadian clock. Changes in the rate of growth within the course of a day have been observed in the leaves, stems, and roots of numerous species. However, the relative impact of the circadian clock on the growth of grasses has not been thoroughly characterized. We examined the influence of diurnal temperature and light changes, and that of the circadian clock on leaf length growth patterns in Brachypodium distachyon using high-resolution time-lapse imaging. Pronounced changes in growth rate were observed under combined photocyles and thermocycles or with thermocycles alone. A considerably more rapid growth rate was observed at 28°C than 12°C, irrespective of the presence or absence of light. In spite of clear circadian clock regulated gene expression, plants exhibited no change in growth rate under conditions of constant light and temperature, and little or no effect under photocycles alone. Therefore, temperature appears to be the primary cue influencing observed oscillations in growth rate and not the circadian clock or photoreceptor activity. Furthermore, the size of the leaf meristem and final cell length did not change in response to changes in temperature. Therefore, the nearly five-fold difference in growth rate observed across thermocycles can be attributed to proportionate changes in the rate of cell division and expansion. A better understanding of the growth cues in B. distachyon will further our ability to model metabolism and biomass accumulation in grasses.
RNA-seq analysis of Brachypodium distachyon responses to Barley stripe mosaic virus infection
Directory of Open Access Journals (Sweden)
Guoxin Wang
2017-02-01
Full Text Available Barley stripe mosaic virus (BSMV is the type member of the genus Hordeivirus. Brachypodium distachyon line Bd3-1 shows resistance to the BSMV ND18 strain, but is susceptible to an ND18 double mutant (β NDTGB1R390K, T392K in which lysine is substituted for an arginine at position 390 and for threonine at position 392 of the triple gene block 1 (TGB1 protein. In order to understand differences in gene expression following infection with ND18 and double mutant ND18, Bd3-1 seedlings were subjected to RNA-seq analyses at 1, 6, and 14 days post inoculation (dpi. The results revealed that basal immunity genes involved in cellulose synthesis and pathogenesis-related protein biosynthesis were enhanced in incompatible interactions between Bd3-1 and ND18. Most of the differentially expressed transcripts are related to trehalose biosynthesis, ethylene, jasmonic acid metabolism, protein phosphorylation, protein ubiquitination, transcriptional regulation, and transport process, as well as pathogenesis-related protein biosynthesis. In compatible interactions between Bd3-1 and ND18 mutant, Bd3-1 developed weak basal resistance responses to the virus. Many genes involved in cellulose biosynthesis, protein amino acid phosphorylation, protein biosynthesis, protein glycosylation, glycolysis and cellular macromolecular complex assembly that may be related to virus replication, assembly and movement were up-regulated. Some genes involved in oxidative stress responses were also up-regulated at 14 dpi. BSMV ND18 mutant infection suppressed expression of genes functioning in regulation of transcription, protein kinase, cellular nitrogen compound biosynthetic process and photosynthesis. Differential expression patterns between compatible and incompatible interactions in Bd3-1 to the two BSMV strains provide important clues for understanding mechanism of resistance to BMSV in the model plant Brachypodium.
Jansson, C.; Handakumbura, P. P.; Fortin, D.; Stanfill, B.; Rivas-Ubach, A.
2017-12-01
Predicting carbon uptake, assimilation and allocation for current and future biogeographical environments, including climate, is critical for our ability to select and/or design plant genotypes to meet increasing demand for plant biomass going into food, feed and energy production, while at the same time maintain or increase soil organic matter (SOM for soil fertility and carbon storage, and reduce emission of greenhouse gasses. As has been demonstrated for several plant species allometric relationships may differ between plant genotypes. Exploring plant genotypic diversity for biomass accumulation and allometry will potentially enable selection of genotypes with high CO2 assimilation and favorable allocation of recent photosynthate into above-ground and below-ground biomass. We are investigating genotypic diversity for PFTs in natural accessions of the annual C3 grass Brachypodium distachyon under current and future climate scenarios and how genotypic diversity correlates with metabolite profiles in aboveground and below-ground biomass. In the current study, we compare effects from non-stressed and drought conditions on biomass accumulation and shoot-root allometry.
Directory of Open Access Journals (Sweden)
Tuğba Gürkök
2017-10-01
Full Text Available Transposable elements (TEs are the most abundant group of genomic elements in plants that can be found in genic or intergenic regions of their host genomes. Several stimuli such as biotic or abiotic stress have roles in either activating their transcription or transposition. Here the effect of the Panicum mosaic virus (PMV and its satellite virus (SPMV infection on the transposon transcription of the Brachypodium distachyon model plant was investigated. To evaluate the transcription activity of TEs, transcriptomic data of mock and virus inoculated plants were compared. Our results indicate that major components of TEs are retroelements in all RNA-seq libraries. The number of transcribed TEs detected in mock inoculated plants is higher than virus inoculated plants. In comparison with mock inoculated plants 13% of the TEs showed at least two folds alteration upon PMV infection and 21% upon PMV+SPMV infection. Rather than inoculation with PMV alone inoculation with PMV+SPMV together also increased various TE encoding transcripts expressions. MuDR-N78C_OS encoding transcript was strongly up-regulated against both PMV and PMV+SPMV infection. The synergism generated by PMV and SPMV together enhanced TE transcripts expressions than PMV alone. It was observed that viral infection induced the transcriptional activity of several transposons. The results suggest that increased expressions of TEs might have a role in response to biotic stress in B. distachyon. Identification of TEs which are taking part in stress can serve useful information for functional genomics and designing novel breeding strategies in developing stress resistance crops.
Bouvier d'Yvoire, Madeleine; Bouchabke-Coussa, Oumaya; Voorend, Wannes; Antelme, Sébastien; Cézard, Laurent; Legée, Frédéric; Lebris, Philippe; Legay, Sylvain; Whitehead, Caragh; McQueen-Mason, Simon J; Gomez, Leonardo D; Jouanin, Lise; Lapierre, Catherine; Sibout, Richard
2013-02-01
Brachypodium distachyon (Brachypodium) has been proposed as a model for grasses, but there is limited knowledge regarding its lignins and no data on lignin-related mutants. The cinnamyl alcohol dehydrogenase (CAD) genes involved in lignification are promising targets to improve the cellulose-to-ethanol conversion process. Down-regulation of CAD often induces a reddish coloration of lignified tissues. Based on this observation, we screened a chemically induced population of Brachypodium mutants (Bd21-3 background) for red culm coloration. We identified two mutants (Bd4179 and Bd7591), with mutations in the BdCAD1 gene. The mature stems of these mutants displayed reduced CAD activity and lower lignin content. Their lignins were enriched in 8-O-4- and 4-O-5-coupled sinapaldehyde units, as well as resistant inter-unit bonds and free phenolic groups. By contrast, there was no increase in coniferaldehyde end groups. Moreover, the amount of sinapic acid ester-linked to cell walls was measured for the first time in a lignin-related CAD grass mutant. Functional complementation of the Bd4179 mutant with the wild-type BdCAD1 allele restored the wild-type phenotype and lignification. Saccharification assays revealed that Bd4179 and Bd7591 lines were more susceptible to enzymatic hydrolysis than wild-type plants. Here, we have demonstrated that BdCAD1 is involved in lignification of Brachypodium. We have shown that a single nucleotide change in BdCAD1 reduces the lignin level and increases the degree of branching of lignins through incorporation of sinapaldehyde. These changes make saccharification of cells walls pre-treated with alkaline easier without compromising plant growth. © 2012 The Authors The Plant Journal © 2012 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Kumimoto Roderick W
2011-05-01
Full Text Available Abstract Background Monocots, especially the temperate grasses, represent some of the most agriculturally important crops for both current food needs and future biofuel development. Because most of the agriculturally important grass species are difficult to study (e.g., they often have large, repetitive genomes and can be difficult to grow in laboratory settings, developing genetically tractable model systems is essential. Brachypodium distachyon (hereafter Brachypodium is an emerging model system for the temperate grasses. To fully realize the potential of this model system, publicly accessible discovery tools are essential. High quality cDNA libraries that can be readily adapted for multiple downstream purposes are a needed resource. Additionally, yeast two-hybrid (Y2H libraries are an important discovery tool for protein-protein interactions and are not currently available for Brachypodium. Results We describe the creation of two high quality, publicly available Gateway™ cDNA entry libraries and their derived Y2H libraries for Brachypodium. The first entry library represents cloned cDNA populations from both short day (SD, 8/16-h light/dark and long day (LD, 20/4-h light/dark grown plants, while the second library was generated from hormone treated tissues. Both libraries have extensive genome coverage (~5 × 107 primary clones each and average clone lengths of ~1.5 Kb. These entry libraries were then used to create two recombination-derived Y2H libraries. Initial proof-of-concept screens demonstrated that a protein with known interaction partners could readily re-isolate those partners, as well as novel interactors. Conclusions Accessible community resources are a hallmark of successful biological model systems. Brachypodium has the potential to be a broadly useful model system for the grasses, but still requires many of these resources. The Gateway™ compatible entry libraries created here will facilitate studies for multiple user
Filiz, Ertugrul; Ozyigit, Ibrahim Ilker; Vatansever, Recep
2015-10-01
GolS genes stand as potential candidate genes for molecular breeding and/or engineering programs in order for improving abiotic stress tolerance in plant species. In this study, a total of six galactinol synthase (GolS) genes/proteins were retrieved for Solanum lycopersicum and Brachypodium distachyon. GolS protein sequences were identified to include glyco_transf_8 (PF01501) domain structure, and to have a close molecular weight (36.40-39.59kDa) and amino acid length (318-347 aa) with a slightly acidic pI (5.35-6.40). The sub-cellular location was mainly predicted as cytoplasmic. S. lycopersicum genes located on chr 1 and 2, and included one segmental duplication while genes of B. distachyon were only on chr 1 with one tandem duplication. GolS sequences were found to have well conserved motif structures. Cis-acting analysis was performed for three abiotic stress responsive elements, including ABA responsive element (ABRE), dehydration and cold responsive elements (DRE/CRT) and low-temperature responsive element (LTRE). ABRE elements were found in all GolS genes, except for SlGolS4; DRE/CRT was not detected in any GolS genes and LTRE element found in SlGolS1 and BdGolS1 genes. AU analysis in UTR and ORF regions indicated that SlGolS and BdGolS mRNAs may have a short half-life. SlGolS3 and SlGolS4 genes may generate more stable transcripts since they included AATTAAA motif for polyadenylation signal POLASIG2. Seconder structures of SlGolS proteins were well conserved than that of BdGolS. Some structural divergences were detected in 3D structures and predicted binding sites exhibited various patterns in GolS proteins. Copyright © 2015 Elsevier Ltd. All rights reserved.
do Amaral, Fernanda P; Pankievicz, Vânia C S; Arisi, Ana Carolina M; de Souza, Emanuel M; Pedrosa, Fabio; Stacey, Gary
2016-04-01
Plant growth promoting rhizobacteria (PGPR) can associate and enhance the growth of important crop grasses. However, in most cases, the molecular mechanisms responsible for growth promotion are not known. Such research could benefit by the adoption of a grass model species that showed a positive response to bacterial inoculation and was amenable to genetic and molecular research methods. In this work we inoculated different genotypes of the model grass Brachypodium distachyon with two, well-characterized PGPR bacteria, Azospirillum brasilense and Herbaspirillum seropedicae, and evaluated the growth response. Plants were grown in soil under no nitrogen or with low nitrogen (i.e., 0.5 mM KNO3). A variety of growth parameters (e.g., shoot height, root length, number of lateral roots, fresh and dry weight) were measured 35 days after inoculation. The data indicate that plant genotype plays a very important role in determining the plant response to PGPR inoculation. A positive growth response was observed with only four genotypes grown under no nitrogen and three genotypes tested under low nitrogen. However, in contrast, relatively good root colonization was seen with most genotypes, as measured by drop plate counting and direct, microscopic examination of roots. In particular, the endophytic bacteria H. seropedicae showed strong epiphytic and endophytic colonization of roots.
Directory of Open Access Journals (Sweden)
ERTUĞRUL FILIZ
2014-04-01
Full Text Available Beta-amylase (β-amylase, EC 3.2.1.2 is an enzyme that catalyses hydrolysis of glucosidic bonds in polysaccharides. In this study, we analyzed protein sequence of predicted beta-amylase 7-like protein in Brachypodium distachyon. pI (isoelectric point value was found as 5.23 in acidic character, while the instability index (II was found as 50.28 with accepted unstable protein. The prediction of subcellular localization was revealed that the protein may reside in chloroplast by using CELLO v.2.5. The 3D structure of protein was performed using comparative homology modeling with SWISS-MODEL. The accuracy of the predicted 3D structure was checked using Ramachandran plot analysis showed that 95.4% in favored region. The results of our study contribute to understanding of β-amylase protein structure in grass species and will be scientific base for 3D modeling of beta-amylase proteins in further studies.
Directory of Open Access Journals (Sweden)
Chul Min Kim
2016-08-01
Full Text Available Genes encoding ROOT HAIR DEFECTIVE SIX-LIKE (RSL class I basic helix loop helix proteins are expressed in future root hair cells of the Arabidopsis thaliana root meristem where they positively regulate root hair cell development. Here we show that there are three RSL class I protein coding genes in the Brachypodium distachyon genome, BdRSL1, BdRSL2 and BdRSL3, and each is expressed in developing root hair cells after the asymmetric cell division that forms root hair cells and hairless epidermal cells. Expression of BdRSL class I genes is sufficient for root hair cell development: ectopic overexpression of any of the three RSL class I genes induces the development of root hairs in every cell of the root epidermis. Expression of BdRSL class I genes in root hairless Arabidopsis thaliana root hair defective 6 (Atrhd6 Atrsl1 double mutants, devoid of RSL class I function, restores root hair development indicating that the function of these proteins has been conserved. However, neither AtRSL nor BdRSL class I genes is sufficient for root hair development in A. thaliana. These data demonstrate that the spatial pattern of class I RSL activity can account for the pattern of root hair cell differentiation in B. distachyon. However, the spatial pattern of class I RSL activity cannot account for the spatial pattern of root hair cells in A. thaliana. Taken together these data indicate that that the functions of RSL class I proteins have been conserved among most angiosperms-monocots and eudicots-despite the dramatically different patterns of root hair cell development.
Directory of Open Access Journals (Sweden)
Aditya Dev
2013-06-01
Full Text Available The Shikimate pathway is an attractive target for herbicides and antimicrobial agents because it is essential in microbes and plants but absent in animals. The 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase (DAHPS is the first enzyme of this pathway, which is involved in the condensation of phosphoenolpyruvate (PEP and D-erythrose 4-phosphate (E4P to produce 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP. DAHPS enzymes have been divided into two types, class I and class II, based on their primary amino acid sequence and three dimensional structures. The plant DAHPS belongs to class II and is regulated differently than DAHPS from microorganisms. To understand the structural basis of such differences in DAHPS from plants and its catalytic mechanism, we have used sequence analysis, homology modeling and docking approach to generate the three dimensional models of DAHP synthase from Brachypodium distachyon (Bd-DAHPS complexed with substrate PEP for the first time. The three dimensional models of Bd-DAHPS provides a detailed knowledge of the active site and the important secondary structural regions that play significant roles in the regulatory mechanism and further may be helpful for design of specific inhibitors towards herbicide development.
Pogorelko, Gennady; Lionetti, Vincenzo; Fursova, Oksana; Sundaram, Raman M.; Qi, Mingsheng; Whitham, Steven A.; Bogdanove, Adam J.; Bellincampi, Daniela; Zabotina, Olga A.
2013-01-01
The plant cell wall has many significant structural and physiological roles, but the contributions of the various components to these roles remain unclear. Modification of cell wall properties can affect key agronomic traits such as disease resistance and plant growth. The plant cell wall is composed of diverse polysaccharides often decorated with methyl, acetyl, and feruloyl groups linked to the sugar subunits. In this study, we examined the effect of perturbing cell wall acetylation by making transgenic Arabidopsis (Arabidopsis thaliana) and Brachypodium (Brachypodium distachyon) plants expressing hemicellulose- and pectin-specific fungal acetylesterases. All transgenic plants carried highly expressed active Aspergillus nidulans acetylesterases localized to the apoplast and had significant reduction of cell wall acetylation compared with wild-type plants. Partial deacetylation of polysaccharides caused compensatory up-regulation of three known acetyltransferases and increased polysaccharide accessibility to glycosyl hydrolases. Transgenic plants showed increased resistance to the fungal pathogens Botrytis cinerea and Bipolaris sorokiniana but not to the bacterial pathogens Pseudomonas syringae and Xanthomonas oryzae. These results demonstrate a role, in both monocot and dicot plants, of hemicellulose and pectin acetylation in plant defense against fungal pathogens. PMID:23463782
Rancour, David M.; Hatfield, Ronald D.; Marita, Jane M.; Rohr, Nicholas A.; Schmitz, Robert J.
2015-01-01
Nucleotide-activated sugars are essential substrates for plant cell-wall carbohydrate-polymer biosynthesis. The most prevalent grass cell wall (CW) sugars are glucose (Glc), xylose (Xyl), and arabinose (Ara). These sugars are biosynthetically related via the UDP–sugar interconversion pathway. We sought to target and generate UDP–sugar interconversion pathway transgenic Brachypodium distachyon lines resulting in CW carbohydrate composition changes with improved digestibility and normal plant stature. Both RNAi-mediated gene-suppression and constitutive gene-expression approaches were performed. CWs from 336 T0 transgenic plants with normal appearance were screened for complete carbohydrate composition. RNAi mutants of BdRGP1, a UDP-arabinopyranose mutase, resulted in large alterations in CW carbohydrate composition with significant decreases in CW Ara content but with minimal change in plant stature. Five independent RNAi-RGP1 T1 plant lines were used for in-depth analysis of plant CWs. Real-time PCR analysis indicated that gene expression levels for BdRGP1, BdRGP2, and BdRGP3 were reduced in RNAi-RGP1 plants to 15–20% of controls. CW Ara content was reduced by 23–51% of control levels. No alterations in CW Xyl and Glc content were observed. Corresponding decreases in CW ferulic acid (FA) and ferulic acid-dimers (FA-dimers) were observed. Additionally, CW p-coumarates (pCA) were decreased. We demonstrate the CW pCA decrease corresponds to Ara-coupled pCA. Xylanase-mediated digestibility of RNAi-RGP1 Brachypodium CWs resulted in a near twofold increase of released total carbohydrate. However, cellulolytic hydrolysis of CW material was inhibited in leaves of RNAi-RGP1 mutants. Our results indicate that targeted manipulation of UDP–sugar biosynthesis can result in biomass with substantially altered compositions and highlights the complex effect CW composition has on digestibility. PMID:26136761
Meineke, Till; Manisseri, Chithra; Voigt, Christian A.
2014-01-01
The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat) with the C4 grasses Zea mays (maize) and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108–117 mg ethanol·g−1 dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type. PMID:25133818
Directory of Open Access Journals (Sweden)
Hugo Bruno Correa Molinari
2013-03-01
Full Text Available The cell walls of grasses such as wheat, maize, rice and sugar cane, contain large amounts of ferulate that is ester-linked to the cell wall polysaccharide glucuronoarabinoxylan (GAX. This ferulate is considered to limit the digestibility of polysaccharide in grass biomass as it forms covalent linkages between polysaccharide and lignin components. Candidate genes within a grass-specific clade of the BAHD acyl-coA transferase superfamily have been identified as being responsible for the ester linkage of ferulate to GAX. Manipulation of these BAHD genes may therefore be a biotechnological target for increasing efficiency of conversion of grass biomass into biofuel. Here, we describe the expression of these candidate genes and amounts of bound ferulate from various tissues and developmental stages of the model grass Brachypodium distachyon. BAHD candidate transcripts and significant amounts of bound ferulate were present in every tissue and developmental stage. We hypothesise that BAHD candidate genes similar to the recently described rice OsPMT gene (PMT sub-clade are principally responsible for the bound coumaric acid (pCA, and that other BAHD candidates (non-PMT sub-clade are responsible for bound ferulic acid (FA. There were some similarities with between the ratio of expression non-PMT / PMT genes and the ratio of bound FA / pCA between tissue types, compatible with this hypothesis. However, much further work to modify BAHD genes in grasses and to characterise the heterologously expressed proteins is required to demonstrate their function.
Chen, Guanxing; Zhu, Jiantang; Zhou, Jianwen; Subburaj, Saminathan; Zhang, Ming; Han, Caixia; Hao, Pengchao; Li, Xiaohui; Yan, Yueming
2014-08-06
Thorough understanding of seed starch biosynthesis and accumulation mechanisms is of great importance for agriculture and crop improvement strategies. We conducted the first comprehensive study of the dynamic development of starch granules and the regulation of starch biosynthesis in Brachypodium distachyon and compared the findings with those reported for common wheat (Chinese Spring, CS) and Aegilops peregrina. Only B-granules were identified in Brachypodium Bd21, and the shape variation and development of starch granules were similar in the B-granules of CS and Bd21. Phylogenetic analysis showed that most of the Bd21 starch synthesis-related genes were more similar to those in wheat than in rice. Early expression of key genes in Bd21 starch biosynthesis mediate starch synthesis in the pericarp; intermediate-stage expression increases the number and size of starch granules. In contrast, these enzymes in CS and Ae. peregrina were mostly expressed at intermediate stages, driving production of new B-granules and increasing the granule size, respectively. Immunogold labeling showed that granule-bound starch synthase (GBSSI; related to amylose synthesis) was mainly present in starch granules: at lower levels in the B-granules of Bd21 than in CS. Furthermore, GBSSI was phosphorylated at threonine 183 and tyrosine 185 in the starch synthase catalytic domain in CS and Ae. peregrina, but neither site was phosphorylated in Bd21, suggesting GBSSI phosphorylation could improve amylose biosynthesis. Bd21 contains only B-granules, and the expression of key genes in the three studied genera is consistent with the dynamic development of starch granules. GBSSI is present in greater amounts in the B-granules of CS than in Bd21; two phosphorylation sites (Thr183 and Tyr185) were found in Triticum and Aegilops; these sites were not phosphorylated in Bd21. GBSSI phosphorylation may reflect its importance in amylose synthesis.
Brachypodium distachyon is regarded as non-host to the causal agent of stem rust in wheat and barley, P. graminis f. sp. tritici (Pgt), and a near-host to the pathogens of forage grasses, P. graminis f. sp. lolii (Pgl) and P. graminis f. sp. phlei-pratensis (Pgp). Given the devastating effect of ste...
Genome-Wide Analysis of miRNA targets in Brachypodium and Biomass Energy Crops
Energy Technology Data Exchange (ETDEWEB)
Green, Pamela J. [Univ. of Delaware, Newark, DE (United States)
2015-08-11
MicroRNAs (miRNAs) contribute to the control of numerous biological processes through the regulation of specific target mRNAs. Although the identities of these targets are essential to elucidate miRNA function, the targets are much more difficult to identify than the small RNAs themselves. Before this work, we pioneered the genome-wide identification of the targets of Arabidopsis miRNAs using an approach called PARE (German et al., Nature Biotech. 2008; Nature Protocols, 2009). Under this project, we applied PARE to Brachypodium distachyon (Brachypodium), a model plant in the Poaceae family, which includes the major food grain and bioenergy crops. Through in-depth global analysis and examination of specific examples, this research greatly expanded our knowledge of miRNAs and target RNAs of Brachypodium. New regulation in response to environmental stress or tissue type was found, and many new miRNAs were discovered. More than 260 targets of new and known miRNAs with PARE sequences at the precise sites of miRNA-guided cleavage were identified and characterized. Combining PARE data with the small RNA data also identified the miRNAs responsible for initiating approximately 500 phased loci, including one of the novel miRNAs. PARE analysis also revealed that differentially expressed miRNAs in the same family guide specific target RNA cleavage in a correspondingly tissue-preferential manner. The project included generation of small RNA and PARE resources for bioenergy crops, to facilitate ongoing discovery of conserved miRNA-target RNA regulation. By associating specific miRNA-target RNA pairs with known physiological functions, the research provides insights about gene regulation in different tissues and in response to environmental stress. This, and release of new PARE and small RNA data sets should contribute basic knowledge to enhance breeding and may suggest new strategies for improvement of biomass energy crops.
Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae
Directory of Open Access Journals (Sweden)
Samuel E. Fox
2013-03-01
Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.
Directory of Open Access Journals (Sweden)
Chong Kang
2009-09-01
Full Text Available Abstract Background MicroRNAs (miRNAs are endogenous small RNAs having large-scale regulatory effects on plant development and stress responses. Extensive studies of miRNAs have only been performed in a few model plants. Although miRNAs are proved to be involved in plant cold stress responses, little is known for winter-habit monocots. Brachypodium distachyon, with close evolutionary relationship to cool-season cereals, has recently emerged as a novel model plant. There are few reports of Brachypodium miRNAs. Results High-throughput sequencing and whole-genome-wide data mining led to the identification of 27 conserved miRNAs, as well as 129 predicted miRNAs in Brachypodium. For multiple-member conserved miRNA families, their sizes in Brachypodium were much smaller than those in rice and Populus. The genome organization of miR395 family in Brachypodium was quite different from that in rice. The expression of 3 conserved miRNAs and 25 predicted miRNAs showed significant changes in response to cold stress. Among these miRNAs, some were cold-induced and some were cold-suppressed, but all the conserved miRNAs were up-regulated under cold stress condition. Conclusion Our results suggest that Brachypodium miRNAs are composed of a set of conserved miRNAs and a large proportion of non-conserved miRNAs with low expression levels. Both kinds of miRNAs were involved in cold stress response, but all the conserved miRNAs were up-regulated, implying an important role for cold-induced miRNAs. The different size and genome organization of miRNA families in Brachypodium and rice suggest that the frequency of duplication events or the selection pressure on duplicated miRNAs are different between these two closely related plant species.
Silicon affects seed development and leaf macrohair formation in Brachypodium distachyon
DEFF Research Database (Denmark)
Głazowska, Sylwia Emilia; Murozuka, Emiko; Persson, Daniel Olof
2018-01-01
Silicon (Si) has many beneficial effects in plants, especially for the survival from biotic and abiotic stresses. However, Si may negatively affect the quality of lignocellulosic biomass for bioenergy purposes. Despite many studies, the regulation of Si distribution and deposition in plants remains...... was similar to that in the wild-type. The Bdlsi1-1 plants supplied with Si had significantly lower seed weights, compared to the wild-type. In low-Si media, the seed weight of wild-type plants was similar to that of Bdlsi1-1 mutants supplied with Si, while the Bdlsi1-1 seed weight decreased further. We...... conclude that Si deficiency results in widespread alterations in leaf surface morphology and seed formation in Brachypodium, showing the importance of Si for successful development in grasses....
Tamura, Ken-Ichi; Sanada, Yasuharu; Tase, Kazuhiro; Kawakami, Akira; Yoshida, Midori; Yamada, Toshihiko
2014-04-01
Fructans can act as cryoprotectants and contribute to freezing tolerance in plant species, such as in members of the grass subfamily Pooideae that includes Triticeae species and forage grasses. To elucidate the relationship of freezing tolerance, carbohydrate composition and degree of polymerization (DP) of fructans, we generated transgenic plants in the model grass species Brachypodium distachyon that expressed cDNAs for sucrose:fructan 6-fructosyltransferases (6-SFTs) with different enzymatic properties: one cDNA encoded PpFT1 from timothy grass (Phleum pratense), an enzyme that produces high-DP levans; a second cDNA encoded wft1 from wheat (Triticum aestivum), an enzyme that produces low-DP levans. Transgenic lines expressing PpFT1 and wft1 showed retarded growth; this effect was particularly notable in the PpFT1 transgenic lines. When grown at 22 °C, both types of transgenic line showed little or no accumulation of fructans. However, after a cold treatment, wft1 transgenic plants accumulated fructans with DP = 3-40, whereas PpFT1 transgenic plants accumulated fructans with higher DPs (20 to the separation limit). The different compositions of the accumulated fructans in the two types of transgenic line were correlated with the differences in the enzymatic properties of the overexpressed 6-SFTs. Transgenic lines expressing PpFT1 accumulated greater amounts of mono- and disaccharides than wild type and wft1 expressing lines. Examination of leaf blades showed that after cold acclimation, PpFT1 overexpression increased tolerance to freezing; by contrast, the freezing tolerance of the wft1 expressing lines was the same as that of wild type plants. These results provide new insights into the relationship of the composition of water-soluble carbohydrates and the DP of fructans to freezing tolerance in plants.
Characterization of FLOWERING LOCUS T1 (FT1 gene in Brachypodium and wheat.
Directory of Open Access Journals (Sweden)
Bo Lv
Full Text Available The phase transition from vegetative to reproductive growth is a critical event in the life cycle of flowering plants. FLOWERING LOCUS T (FT plays a central role in the regulation of this transition by integrating signals from multiple flowering pathways in the leaves and transmitting them to the shoot apical meristem. In this study, we characterized FT homologs in the temperate grasses Brachypodium distachyon and polyploid wheat using transgenic and mutant approaches. Downregulation of FT1 by RNAi was associated with a significant downregulation of the FT-like genes FT2 and FT4 in Brachypodium and FT2 and FT5 in wheat. In a transgenic wheat line carrying a highly-expressed FT1 allele, FT2 and FT3 were upregulated under both long and short days. Overexpression of FT1 caused extremely early flowering during shoot regeneration in both Brachypodium and hexaploid wheat, and resulted in insufficient vegetative tissue to support the production of viable seeds. Downregulation of FT1 transcripts by RNA interference (RNAi resulted in non-flowering Brachypodium plants and late flowering plants (2-4 weeks delay in wheat. A similar delay in heading time was observed in tetraploid wheat plants carrying mutations for both FT-A1 and FT-B1. Plants homozygous only for mutations in FT-B1 flowered later than plants homozygous only for mutations in FT-A1, which corresponded with higher transcript levels of FT-B1 relative to FT-A1 in the early stages of development. Taken together, our data indicate that FT1 plays a critical role in the regulation of flowering in Brachypodium and wheat, and that this role is associated with the simultaneous regulation of other FT-like genes. The differential effects of mutations in FT-A1 and FT-B1 on wheat heading time suggest that different allelic combinations of FT1 homoeologs could be used to adjust wheat heading time to improve adaptation to changing environments.
Chen, Ziyan; Zhu, Dong; Wu, Jisu; Cheng, Zhiwei; Yan, Xing; Deng, Xiong; Yan, Yueming
2018-05-17
In this study, we aimed to identify differentially accumulated proteins (DAPs) involved in PEG mock osmotic stress, cadmium (Cd 2+ ) stress, and their combined stress responses in Brachypodium distachyon seedling roots. The results showed that combined PEG and Cd 2+ stresses had more significant effects on Brachypodium seedling root growth, physiological traits, and ultrastructures when compared with each individual stress. Totally, 106 DAPs were identified that are responsive to individual and combined stresses in roots. These DAPs were mainly involved in energy metabolism, detoxification and stress defense and protein metabolism. Principal component analysis revealed that DAPs from Cd 2+ and combined stress treatments were grouped closer than those from osmotic stress treatment, indicating that Cd 2+ and combined stresses had more severe influences on the root proteome than osmotic stress alone. Protein-protein interaction analyses highlighted a 14-3-3 centered sub-network that synergistically responded to osmotic and Cd 2+ stresses and their combined stresses. Quantitative real-time polymerase chain reaction (qRT-PCR) analysis of 14 key DAP genes revealed that most genes showed consistency between transcriptional and translational expression patterns. A putative pathway of proteome metabolic changes in Brachypodium seedling roots under different stresses was proposed, which revealed a complicated synergetic responsive network of plant roots to adverse environments.
Chemical and radiation mutagenesis: Induction and detection by whole genome sequencing
Brachypodium distachyon has emerged as an effective model system to address fundamental questions in grass biology. With its small sequenced genome, short generation time and rapidly expanding array of genetic tools B. distachyon is an ideal system to elucidate the molecular basis of important trai...
Barbieri, M.; Marcel, T.C.; Niks, R.E.
2011-01-01
Purple false brome grass (Brachypodium distachyon) has recently emerged as a model system for temperate grasses and is also a potential model plant to investigate plant interactions with economically important pathogens such as rust fungi. We determined the host status of five Brachypodium species
Directory of Open Access Journals (Sweden)
Natalia Borowska-Zuchowska
2016-10-01
Full Text Available Nucleolar dominance is an epigenetic phenomenon associated with nuclear 35S rRNA genes and consists in selective suppression of gene loci inherited from one of the progenitors in the allopolyploid. Our understanding of the exact mechanisms that determine this process is still fragmentary, especially in case of the grass species. This study aimed to shed some light on the molecular basis of this genome-specific inactivation of 35S rDNA loci in an allotetraploid Brachypodium hybridum (2n=30, which arose from the interspecific hybridization between two diploid ancestors that were very similar to modern B. distachyon (2n=10 and B. stacei (2n=20. Using fluorescence in situ hybridization with 25S rDNA and chromosome-specific BAC clones as probes we revealed that the nucleolar dominance is present not only in meristematic root-tip cells but also in differentiated cell fraction of B. hybridum. Additionally, the intergenic spacers (IGSs from both of the putative ancestors and the allotetraploid were sequenced and analyzed. The presumptive transcription initiation sites, spacer promoters and repeated elements were identified within the IGSs. Two different length variants, 2.3 kb and 3.5 kb, of IGSs were identified in B. distachyon and B. stacei, respectively, however only the IGS that had originated from B. distachyon-like ancestor was present in the allotetraploid. The amplification pattern of B. hybridum IGSs suggests that some genetic changes occurred in inactive B. stacei-like rDNA loci during the evolution of the allotetraploid. We hypothesize that their preferential silencing is an effect of structural changes in the sequence rather than just the result of the sole inactivation at the epigenetic level.
Protein (Viridiplantae): 94306 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 47368:3137 ... 147385:3137 ... 15367:3137 ... 15368:3137 ... PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nect...arin-3-like Brachypodium distachyon MATRVGNAVVFALLLCARFL
Aronson, J; Kigel, J; Shmida, A
1993-03-01
Reproductive effort (relative allocation of biomass to diaspore production) was compared in matched pairs of Mediterranean and desert populations of three unrelated annual species, Erucaria hispanica (L.) Druce, Bromus fasciculatus C. Presl. and Brachypodium distachyon (L.) Beauv., grown under high and low levels of water availability in a common-environment experiment. Desert populations in all three species showed higher reproductive effort than corresponding Mediterranean populations, as expressed by both a reproductive index (RI= reproductive biomass/vegetative biomass), and a reproductive efficiency index (REI=number of diaspores/total plant biomass). Moreover, in E. hispanica and Brachypodium distachyon, inter-populational differences in reproductive effort were greater under water stress, the main limiting factor for plant growth in the desert. These results indicate that variability in reproductive effort in response to drought is a critical and dynamic component of life history strategies in annual species in heterogeneous, unpredictable xeric environments. When subjected to water stress the Mediterranean populations of E. hispanica and B. distachyon showed greater plasticity (e.g. had a greater reduction) in reproductive effort than the desert populations, while in Bromus fasciculatus both populations showed similar amounts of plasticity.
Systems Level Regulation of Rhythmic Growth Rate and Biomass Accumulation in Grasses
Energy Technology Data Exchange (ETDEWEB)
Kay, Steve A. [Univ. of Southern California, Los Angeles, CA (United States)
2017-10-20
Objectives: Several breakthroughs have been recently made in our understanding of plant growth and biomass accumulation. It was found that plant growth is rhythmically controlled throughout the day by the circadian clock through a complex interplay of light and phytohormone signaling pathways. While plants such as the C4 energy crop sorghum (Sorghum bicolor (L.) Moench) and possibly the C3 grass Brachypodium distachyon also exhibit daily rhythms in growth rate, the molecular details of its regulation remain to be explored. A better understanding of diurnally regulated growth behavior in grasses may lead to species-specific mechanisms highly relevant to future strategies to optimize energy crop biomass yield. Here we propose to devise a systems approach to identify, in parallel, regulatory hubs associated with rhythmic growth in C3 and C4 plants. We propose to use rhythmicity in daily growth patterns to drive the discovery of regulatory network modules controlling biomass accumulation. Description: The project is divided in three main parts: 1) Performing time-lapse imaging and growth measurement in B. distachyon and S. bicolor to determine growth rate dynamic during the day/night cycle. Identifying growth-associated genes whose expression patterns follow the observed growth dynamics using deep sequencing technology, 2) identifying regulators of these genes by screening for DNA-binding proteins interacting with the growth-associated gene promoters identified in Aim 1. Screens will be performed using a validated yeast-one hybrid strategy paired with a specifically designed B. distachyon and S. bicolor transcription factor libraries (1000 clones each), and 3) Selecting 50 potential growth regulators from the screen for downstream characterization. The selection will be made by using a sytems biology approach by calculating the connectivity between growth rate, rhythmic gene expression profiles and TF expression profile and determine which TF is likely part of a hub
Cell wall composition throughout development for the model grass Brachypodium distanchyon
Directory of Open Access Journals (Sweden)
David eRancour
2012-12-01
Full Text Available Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distanchyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distanchyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e. leaves, sheaths, stems and roots at three developmental stages of 1 12-day seedling, 2 vegetative-to-reproductive transition, and 3 mature seed-fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distanchyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exists between Brachypodium and agronomical important C3 grasses, Brachypodium distanchyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production.
Energy Technology Data Exchange (ETDEWEB)
Mockler, Todd C. [Donald Danforth Plant Science Center, Saint Louis, MO (United States)
2016-11-07
Plant growth and development, including stem elongation, flowering time, and shade-avoidance habits, are affected by wavelength composition (i.e., light quality) of the light environment. the molecular mechanisms underlying light perception and signaling pathways in plants have been best characterized in Arabidopsis thaliana where dozens of genes have been implicated in converging, complementary, and antagonistic pathways communicating light quality cues perceived by the phytochrome (red/far-red) cryptochrome (blue) and phototropin (blue) photorecptors. Light perception and signaling have been studied in grasses, including rice and sorghum but in much less detail than in Arabidopsis. During the course of the Mocker lab's DOE-funded wrok generating a gene expression atlas in Brachypodium distachyon we observed that Brachypodium plants grown in continuous monochromatic red light or continuous white light enriched in far-red light accumulated significantly more biomass and exhibited significantly greater seed yield than plants grown in monochromatic blue light or white light. This phenomenon was also observed in two other grasses, switchgrass and rice. We will systematically manipulate the expression of genes predicted to function in Brachypodium phytochrome signaling and assess the phenotypic consequences in transgenic Brachypodium plants in terms of morphology, stature, biomass accumulation, and cell wall composition. We will also interrogate direct interactions between candidate phytochrome signaling transcription factors and target promoters using a high-throughput yeast one-hybrid system. Brachypodium distachyon has emerged as a model grass species and is closely related to candidate feedstock crops for bioethanol production. Identification of genes capable of modifying growth characteristics of Brachypodium, when misexpressed, in particular increasing biomass accumulation, by modulating photoreceptor signaling will provide valuable candidates for
Pont, Caroline; Murat, Florent; Confolent, Carole; Balzergue, Sandrine; Salse, Jérôme
2011-12-02
Whole genome duplication is a common evolutionary event in plants. Bread wheat (Triticum aestivum L.) is a good model to investigate the impact of paleo- and neoduplications on the organization and function of modern plant genomes. We performed an RNA sequencing-based inference of the grain filling gene network in bread wheat and identified a set of 37,695 non-redundant sequence clusters, which is an unprecedented resolution corresponding to an estimated half of the wheat genome unigene repertoire. Using the Brachypodium distachyon genome as a reference for the Triticeae, we classified gene clusters into orthologous, paralogous, and homoeologous relationships. Based on this wheat gene evolutionary classification, older duplicated copies (dating back 50 to 70 million years) exhibit more than 80% gene loss and expression divergence while recent duplicates (dating back 1.5 to 3 million years) show only 54% gene loss and 36 to 49% expression divergence. We suggest that structural shuffling due to duplicated gene loss is a rapid process, whereas functional shuffling due to neo- and/or subfunctionalization of duplicates is a longer process, and that both shuffling mechanisms drive functional redundancy erosion. We conclude that, as a result of these mechanisms, half the gene duplicates in plants are structurally and functionally altered within 10 million years of evolution, and the diploidization process is completed after 45 to 50 million years following polyploidization.
Czech Academy of Sciences Publication Activity Database
Sehgal, S. K.; Li, W.; Rabinowicz, P. D.; Chan, A.; Šimková, Hana; Doležel, Jaroslav; Gill, B. S.
2012-01-01
Roč. 12, č. 64 (2012) ISSN 1471-2229 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : BREAD WHEAT * BRACHYPODIUM-DISTACHYON * REPETITIVE ELEMENTS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.354, year: 2012
Characterizing the effects of brassinosteroids on root development in monocot plant species
DEFF Research Database (Denmark)
de Bang, Louise
. With TILLING, two mutants of selected BR-related genes were identified in a Brachypodium distachyon mutant population. However, compared to the wild type, the mutants did not produce more biomass. The work with BR effects on plant root growth stimulated an interest for roots and root development, which...
Driever, Steven M; Simkin, Andrew J; Alotaibi, Saqer; Fisk, Stuart J; Madgwick, Pippa J; Sparks, Caroline A; Jones, Huw D; Lawson, Tracy; Parry, Martin A J; Raines, Christine A
2017-09-26
To meet the growing demand for food, substantial improvements in yields are needed. This is particularly the case for wheat, where global yield has stagnated in recent years. Increasing photosynthesis has been identified as a primary target to achieve yield improvements. To increase leaf photosynthesis in wheat, the level of the Calvin-Benson cycle enzyme sedoheptulose-1,7-biphosphatase (SBPase) has been increased through transformation and expression of a Brachypodium distachyon SBPase gene construct. Transgenic lines with increased SBPase protein levels and activity were grown under greenhouse conditions and showed enhanced leaf photosynthesis and increased total biomass and dry seed yield. This showed the potential of improving yield potential by increasing leaf photosynthesis in a crop species such as wheat. The results are discussed with regard to future strategies for further improvement of photosynthesis in wheat.This article is part of the themed issue 'Enhancing photosynthesis in crop plants: targets for improvement'. © 2017 The Authors.
Czech Academy of Sciences Publication Activity Database
Berkman, P.J.; Skarshewski, A.; Manoli, S.; Lorenc, M. T.; Stiller, J.; Smits, L.; Lai, K.; Cambell, E.; Kubaláková, Marie; Šimková, Hana; Batley, J.; Doležel, Jaroslav; Hernandez, P.; Edwards, D.
2012-01-01
Roč. 124, č. 3 (2012), s. 423-432 ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LC06004 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : POLYPLOID WHEAT * BIN MAP * BRACHYPODIUM-DISTACHYON Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.658, year: 2012
Directory of Open Access Journals (Sweden)
Valeriia Shiposha
2016-09-01
Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary
Shiposha, Valeriia; Catalán, Pilar; Olonova, Marina; Marques, Isabel
2016-01-01
Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89%) suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands
DEFF Research Database (Denmark)
Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben
2013-01-01
(Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...
Energy Technology Data Exchange (ETDEWEB)
Gordon, Sean; Reguera, Maria; Sade, Nir; Cartwright, Amy; Tobias, Christian; Thilmony, Roger; Blumwald, Eduardo; Vogel, John
2015-03-20
We are using the perennial model grass Brachypodium sylvaticum to identify combinations of transgenes that enhance tolerance to multiple, simultaneous abiotic stresses. The most successful transgene combinations will ultimately be used to create improved switchgrass (Panicum virgatum L.) cultivars. To further develop B. sylvaticum as a perennial model grass, and facilitate our planned transcriptional profiling, we are sequencing and annotating the genome. We have generated ~40x genome coverage using PacBio sequencing of the largest possible size selected libraries (18, 22, 25 kb). Our initial assembly using only long-read sequence contained 320 Mb of sequence with an N50 contig length of 315 kb and an N95 contig length of 40 kb. This assembly consists of 2,430 contigs, the largest of which was 1.6 Mb. The estimated genome size based on c-values is 340 Mb indicating that about 20 Mb of presumably repetitive DNA remains yet unassembled. Significantly, this assembly is far superior to an assembly created from paired-end short-read sequence, ~100x genome coverage. The short-read-only assembly contained only 226 Mb of sequence in 19k contigs. To aid the assembly of the scaffolds into chromosome-scale assemblies we produced an F2 mapping population and have genotyped 480 individuals using a genotype by sequence approach. One of the reasons for using B. sylvaticum as a model system is to determine if the transgenes adversely affect perenniality and winter hardiness. Toward this goal, we examined the freezing tolerance of wild type B. sylvaticum lines to determine the optimal conditions for testing the freezing tolerance of the transgenics. A survey of seven accessions noted significant natural variation in freezing tolerance. Seedling or adult Ain-1 plants, the line used for transformation, survived an 8 hour challenge down to -6 oC and 50% survived a challenge down to -9 oC. Thus, we will be able to easily determine if the transgenes compromise freezing tolerance. In the
Directory of Open Access Journals (Sweden)
Humira Sonah
Full Text Available Plant genomes are complex and contain large amounts of repetitive DNA including microsatellites that are distributed across entire genomes. Whole genome sequences of several monocot and dicot plants that are available in the public domain provide an opportunity to study the origin, distribution and evolution of microsatellites, and also facilitate the development of new molecular markers. In the present investigation, a genome-wide analysis of microsatellite distribution in monocots (Brachypodium, sorghum and rice and dicots (Arabidopsis, Medicago and Populus was performed. A total of 797,863 simple sequence repeats (SSRs were identified in the whole genome sequences of six plant species. Characterization of these SSRs revealed that mono-nucleotide repeats were the most abundant repeats, and that the frequency of repeats decreased with increase in motif length both in monocots and dicots. However, the frequency of SSRs was higher in dicots than in monocots both for nuclear and chloroplast genomes. Interestingly, GC-rich repeats were the dominant repeats only in monocots, with the majority of them being present in the coding region. These coding GC-rich repeats were found to be involved in different biological processes, predominantly binding activities. In addition, a set of 22,879 SSR markers that were validated by e-PCR were developed and mapped on different chromosomes in Brachypodium for the first time, with a frequency of 101 SSR markers per Mb. Experimental validation of 55 markers showed successful amplification of 80% SSR markers in 16 Brachypodium accessions. An online database 'BraMi' (Brachypodium microsatellite markers of these genome-wide SSR markers was developed and made available in the public domain. The observed differential patterns of SSR marker distribution would be useful for studying microsatellite evolution in a monocot-dicot system. SSR markers developed in this study would be helpful for genomic studies in Brachypodium
Energy Technology Data Exchange (ETDEWEB)
Ruiz-Colmenero, M.; Bienes, R.; Marques, M. J.
2009-07-01
A study has been carried out about the use of plant cover treatment to avoid land degradation in a hillside rainfed vineyard in Madrid under Mediterranean semiarid climate. Three treatments were tested: traditional tillage (lab) soil covered by Brachypodium distachyon (bra) with self-sowing, soil covered by Scale cereale (sec) mown in Spring. Three erosion plots per treatment were placed in the middle of the strips and 2 simulated rainfalls were carried out at each plot in autumn, before and after the tillage. (Author) 7 refs.
Brachypodium distachyon genomics for sustainable food and fuel production
Grasses are a vital source of food for humanity and are projected to be become an important source of renewable fuel. To provide food, feed and fuel for an ever expanding human population it will be necessary to improve existing grass crops (e.g. wheat, maize, rice) and domesticate perennial grasses...
Development and applications of advanced probing tools for cell wall biology
DEFF Research Database (Denmark)
Hansen, Aleksander Riise
. In this study, antigens consisting of crude mixtures of alkali extracted polymers from the grass model Brachypodium distachyon were targets for probe generation using a naïve human single domain antibody library. Epitope characterization of positive clones from phage ELISA was then further elucidated...... the function of pectin methyl esterase inhibitors and their role in plant defense against microbial degradation, and cell wall structural dynamics in relation to cell detachment from roots. The second part describes phage display as a method for developing probes against targets that are poor immunogens...
DEFF Research Database (Denmark)
Jakobsen, Iver; Smith, Sally E.; Smith, F. Andrew
2016-01-01
Capturing the full growth potential in crops under future elevated CO2 (eCO2) concentrations would be facilitated by improved understanding of eCO2 effects on uptake and use of mineral nutrients. This study investigates interactions of eCO2, soil phosphorus (P), and arbuscular mycorrhizal (AM......) symbiosis in Medicago truncatula and Brachypodium distachyon grown under the same conditions. The focus was on eCO2 effects on vegetative growth, efficiency in acquisition and use of P, and expression of phosphate transporter (PT) genes. Growth responses to eCO2 were positive at P sufficiency, but under low......-P conditions they ranged from non-significant in M. truncatula to highly significant in B. distachyon. Growth of M. truncatula was increased by AM at low P conditions at both CO2 levels and eCO2×AM interactions were sparse. Elevated CO2 had small effects on P acquisition, but enhanced conversion of tissue P...
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
DEFF Research Database (Denmark)
Jakobsen, Iver; Smith, Sally E.; Smith, F. Andrew
2016-01-01
Capturing the full growth potential in crops under future elevated CO2 (eCO2) concentrations would be facilitated by improved understanding of eCO2 effects on uptake and use of mineral nutrients. This study investigates interactions of eCO2, soil phosphorus (P), and arbuscular mycorrhizal (AM......) symbiosis in Medicago truncatula and Brachypodium distachyon grown under the same conditions. The focus was on eCO2 effects on vegetative growth, efficiency in acquisition and use of P, and expression of phosphate transporter (PT) genes. Growth responses to eCO2 were positive at P sufficiency, but under low...
Cantoro, Renata; Crocco, Carlos Daniel; Benech-Arnold, Roberto Luis; Rodríguez, María Verónica
2013-12-01
The precise adjustment of the timing of dormancy release according to final grain usage is still a challenge for many cereal crops. Grain sorghum [Sorghum bicolor (L.) Moench] shows wide intraspecific variability in dormancy level and susceptibility to pre-harvest sprouting (PHS). Both embryo sensitivity to abscisic acid (ABA) and gibberellin (GA) metabolism play an important role in the expression of dormancy of the developing sorghum grain. In previous works, it was shown that, simultaneously with a greater embryo sensitivity to ABA and higher expression of SbABA-INSENSITIVE 4 (SbABI4) and SbABA-INSENSITIVE 5 (SbABI5), dormant grains accumulate less active GA4 due to a more active GA catabolism. In this work, it is demonstrated that the ABA signalling components SbABI4 and SbABI5 interact in vitro with a fragment of the SbGA 2-OXIDASE 3 (SbGA2ox3) promoter containing an ABA-responsive complex (ABRC). Both transcription factors were able to bind the promoter, although not simultaneously, suggesting that they might compete for the same cis-acting regulatory sequences. A biological role for these interactions in the expression of dormancy of sorghum grains is proposed: either SbABI4 and/or SbABI5 activate transcription of the SbGA2ox3 gene in vivo and promote SbGA2ox3 protein accumulation; this would result in active degradation of GA4, thus preventing germination of dormant grains. A comparative analysis of the 5'-regulatory region of GA2oxs from both monocots and dicots is also presented; conservation of the ABRC in closely related GA2oxs from Brachypodium distachyon and rice suggest that these species might share the same regulatory mechanism as proposed for grain sorghum.
Protection against productivity versus erosion vineyards. Testing of vegetal covers in slope crops
International Nuclear Information System (INIS)
Marques, M. J.; Ruiz-Colmenero, M.; Garcia-Munoz, S.; Cabello, F.; Munoz-Organero, G.; Perez-Jimenez, M. A.; Bienes, R.
2009-01-01
Temporary and permanent cover crops were used in three rain fed vineyards in the Center of Spain. They were sown in the middle of the strips to assess their ability to control erosion as well as their influence on grape production. Data from the year 2008 are compared with those obtained with traditional tillage treatment. The permanent cover formed by Brachypodium distachyon showed better ability to control erosion but it produced a decrease in production in young vines. barley and rye treatments were temporary covers, mowed in spring. They also reduced the erosion compared with the tillage however they did not appear to affect the vineyard production. (Author)
Energy Technology Data Exchange (ETDEWEB)
Marques, M. J.; Ruiz-Colmenero, M.; Garcia-Munoz, S.; Cabello, F.; Munoz-Organero, G.; Perez-Jimenez, M. A.; Bienes, R.
2009-07-01
Temporary and permanent cover crops were used in three rain fed vineyards in the Center of Spain. They were sown in the middle of the strips to assess their ability to control erosion as well as their influence on grape production. Data from the year 2008 are compared with those obtained with traditional tillage treatment. The permanent cover formed by Brachypodium distachyon showed better ability to control erosion but it produced a decrease in production in young vines. barley and rye treatments were temporary covers, mowed in spring. They also reduced the erosion compared with the tillage however they did not appear to affect the vineyard production. (Author)
Directory of Open Access Journals (Sweden)
You Frank M
2010-06-01
Full Text Available Abstract Background Physical maps employing libraries of bacterial artificial chromosome (BAC clones are essential for comparative genomics and sequencing of large and repetitive genomes such as those of the hexaploid bread wheat. The diploid ancestor of the D-genome of hexaploid wheat (Triticum aestivum, Aegilops tauschii, is used as a resource for wheat genomics. The barley diploid genome also provides a good model for the Triticeae and T. aestivum since it is only slightly larger than the ancestor wheat D genome. Gene co-linearity between the grasses can be exploited by extrapolating from rice and Brachypodium distachyon to Ae. tauschii or barley, and then to wheat. Results We report the use of Ae. tauschii for the construction of the physical map of a large distal region of chromosome arm 3DS. A physical map of 25.4 Mb was constructed by anchoring BAC clones of Ae. tauschii with 85 EST on the Ae. tauschii and barley genetic maps. The 24 contigs were aligned to the rice and B. distachyon genomic sequences and a high density SNP genetic map of barley. As expected, the mapped region is highly collinear to the orthologous chromosome 1 in rice, chromosome 2 in B. distachyon and chromosome 3H in barley. However, the chromosome scale of the comparative maps presented provides new insights into grass genome organization. The disruptions of the Ae. tauschii-rice and Ae. tauschii-Brachypodium syntenies were identical. We observed chromosomal rearrangements between Ae. tauschii and barley. The comparison of Ae. tauschii physical and genetic maps showed that the recombination rate across the region dropped from 2.19 cM/Mb in the distal region to 0.09 cM/Mb in the proximal region. The size of the gaps between contigs was evaluated by comparing the recombination rate along the map with the local recombination rates calculated on single contigs. Conclusions The physical map reported here is the first physical map using fingerprinting of a complete
Jakobsen, Iver; Smith, Sally E; Smith, F Andrew; Watts-Williams, Stephanie J; Clausen, Signe S; Grønlund, Mette
2016-11-01
Capturing the full growth potential in crops under future elevated CO 2 (eCO 2 ) concentrations would be facilitated by improved understanding of eCO 2 effects on uptake and use of mineral nutrients. This study investigates interactions of eCO 2 , soil phosphorus (P), and arbuscular mycorrhizal (AM) symbiosis in Medicago truncatula and Brachypodium distachyon grown under the same conditions. The focus was on eCO 2 effects on vegetative growth, efficiency in acquisition and use of P, and expression of phosphate transporter (PT) genes. Growth responses to eCO 2 were positive at P sufficiency, but under low-P conditions they ranged from non-significant in M. truncatula to highly significant in B. distachyon Growth of M. truncatula was increased by AM at low P conditions at both CO 2 levels and eCO 2 ×AM interactions were sparse. Elevated CO 2 had small effects on P acquisition, but enhanced conversion of tissue P into biomass. Expression of PT genes was influenced by eCO 2 , but effects were inconsistent across genes and species. The ability of eCO 2 to partly mitigate P limitation-induced growth reductions in B. distachyon was associated with enhanced P use efficiency, and requirements for P fertilizers may not increase in such species in future CO 2 -rich climates. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
King, Julie; Thomas, Ann; James, Caron; King, Ian; Armstead, Ian
2013-07-03
Ryegrasses and fescues (genera, Lolium and Festuca) are species of forage and turf grasses which are used widely in agricultural and amenity situations. They are classified within the sub-family Pooideae and so are closely related to Brachypodium distachyon, wheat, barley, rye and oats. Recently, a DArT array has been developed which can be used in generating marker and mapping information for ryegrasses and fescues. This represents a potential common marker set for ryegrass and fescue researchers which can be linked through to comparative genomic information for the grasses. A F2 perennial ryegrass genetic map was developed consisting of 7 linkage groups defined by 1316 markers and deriving a total map length of 683 cM. The marker set included 866 DArT and 315 gene sequence-based markers. Comparison with previous DArT mapping studies in perennial and Italian ryegrass (L. multiflorum) identified 87 and 105 DArT markers in common, respectively, of which 94% and 87% mapped to homoeologous linkage groups. A similar comparison with meadow fescue (F. pratensis) identified only 28 DArT markers in common, of which c. 50% mapped to non-homoelogous linkage groups. In L. perenne, the genetic distance spanned by the DArT markers encompassed the majority of the regions that could be described in terms of comparative genomic relationships with rice, Brachypodium distachyon, and Sorghum bicolor. DArT markers are likely to be a useful common marker resource for ryegrasses and fescues, though the success in aligning different populations through the mapping of common markers will be influenced by degrees of population interrelatedness. The detailed mapping of DArT and gene-based markers in this study potentially allows comparative relationships to be derived in future mapping populations characterised using solely DArT markers.
Pearce, Stephen; Huttly, Alison K; Prosser, Ian M; Li, Yi-dan; Vaughan, Simon P; Gallova, Barbora; Patil, Archana; Coghill, Jane A; Dubcovsky, Jorge; Hedden, Peter; Phillips, Andrew L
2015-06-05
The gibberellin (GA) pathway plays a central role in the regulation of plant development, with the 2-oxoglutarate-dependent dioxygenases (2-ODDs: GA20ox, GA3ox, GA2ox) that catalyse the later steps in the biosynthetic pathway of particularly importance in regulating bioactive GA levels. Although GA has important impacts on crop yield and quality, our understanding of the regulation of GA biosynthesis during wheat and barley development remains limited. In this study we identified or assembled genes encoding the GA 2-ODDs of wheat, barley and Brachypodium distachyon and characterised the wheat genes by heterologous expression and transcript analysis. The wheat, barley and Brachypodium genomes each contain orthologous copies of the GA20ox, GA3ox and GA2ox genes identified in rice, with the exception of OsGA3ox1 and OsGA2ox5 which are absent in these species. Some additional paralogs of 2-ODD genes were identified: notably, a novel gene in the wheat B genome related to GA3ox2 was shown to encode a GA 1-oxidase, named as TaGA1ox-B1. This enzyme is likely to be responsible for the abundant 1β-hydroxylated GAs present in developing wheat grains. We also identified a related gene in barley, located in a syntenic position to TaGA1ox-B1, that encodes a GA 3,18-dihydroxylase which similarly accounts for the accumulation of unusual GAs in barley grains. Transcript analysis showed that some paralogs of the different classes of 2-ODD were expressed mainly in a single tissue or at specific developmental stages. In particular, TaGA20ox3, TaGA1ox1, TaGA3ox3 and TaGA2ox7 were predominantly expressed in developing grain. More detailed analysis of grain-specific gene expression showed that while the transcripts of biosynthetic genes were most abundant in the endosperm, genes encoding inactivation and signalling components were more highly expressed in the seed coat and pericarp. The comprehensive expression and functional characterisation of the multigene families encoding the 2-ODD
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-01-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232
Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno
2013-02-01
Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.
Unraveling the Plant-Soil Interactome
Lipton, M. S.; Hixson, K.; Ahkami, A. H.; HaHandkumbura, P. P.; Hess, N. J.; Fang, Y.; Fortin, D.; Stanfill, B.; Yabusaki, S.; Engbrecht, K. M.; Baker, E.; Renslow, R.; Jansson, C.
2017-12-01
Plant photosynthesis is the primary conduit of carbon fixation from the atmosphere to the terrestrial ecosystem. While more is known about plant physiology and biochemistry, the interplay between genetic and environmental factors that govern partitioning of carbon to above- and below ground plant biomass, to microbes, to the soil, and respired to the atmosphere is not well understood holistically. To address this knowledge gap there is a need to define, study, comprehend, and model the plant ecosystem as an integrated system of integrated biotic and abiotic processes and feedbacks. Local rhizosphere conditions are an important control on plant performance but are in turn affected by plant uptake and rhizodeposition processes. C3 and C4 plants have different CO2 fixation strategies and likely have differential metabolic profiles resulting in different carbon sources exuding to the rhizosphere. In this presentation, we report on an integrated capability to better understand plant-soil interactions, including modeling tools that address the spatiotemporal hydrobiogeochemistry in the rhizosphere. Comparing Brachypodium distachyon, (Brachypodium) as our C3 representative and Setaria viridis (Setaria) as our C4 representative, we designed, highly controlled single-plant experimental ecosystems based these model grasses to enable quantitative prediction of ecosystem traits and responses as a function of plant genotype and environmental variables. A metabolomics survey of 30 Brachypodium genotypes grown under control and drought conditions revealed specific metabolites that correlated with biomass production and drought tolerance. A comparison of Brachypodium and Setaria grown with control and a future predicted elevated CO2 level revealed changes in biomass accumulation and metabolite profiles between the C3 and C4 species in both leaves and roots. Finally, we are building an mechanistic modeling capability that will contribute to a better basis for modeling plant water
Directory of Open Access Journals (Sweden)
Paola Scocco
2013-06-01
Full Text Available L'articolo valuta e mette in correlazione i cambiamenti del grado di cheratinizzazione della mucosa ruminale con lo stato corporeo di ovini tenuti a pascolare per 20 giorni in un'area ad elevata copertura di paléo rupestre (Brachypodium rupestre. Il pascolo degli ovini in queste aree riduce il rischio di incendi boschivi. Tuttavia, l'assunzione di Brachypodium rupestre protratta per lunghi periodi può compromettere la salute generale degli animali. Lo scopo di questo studio è di determinare il periodo massimo di permanenza degli animali in queste aree. Ovini mantenuti su un pascolo semi-mesofilo sono stati utilizzati come gruppo di controllo. Nei giorni 1, 10 e 20 della sperimentazione, 5 animali di ogni gruppo sono stati sacrificati per la valutazione delle modificazioni del grado di cheratinizzazione dell'epitelio dell'atrio e del sacco ventrale del rumine. La valutazione dello stato corporeo, o body condition score (BCS, e il peso vivo (PV sono stati monitorati su altri 10 soggetti per gruppo. Il gruppo di controllo ha mostrato piccole variazioni del grado di cheratinizzazione del rumine che non hanno inciso negativamente sul BCS o sul PV. Il gruppo sperimentale ha mostrato un significativo incremento del grado di cheratinizzazione, già entro i primi dieci giorni, che ha portato ad un graduale abbassamento del BCS e ad un calo di peso tra il decimo e il ventesimo giorno. I dati ottenuti suggeriscono che al fine della prevenzione degli incendi boschivi gli ovini dovrebbero essere utilizzati a turno con periodi di permanenza nei pascoli ad alta copertura di Brachypodium rupestre non superiori ai 10-12 giorni.
DEFF Research Database (Denmark)
Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben
2013-01-01
Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...
Genomic dissection of nonhost resistance to wheat stem rust in Brachypodium distachyon
Wheat stem rust caused by the fungus Puccinia graminis f.sp. tritici (Pgt) is a devastating disease that has largely been controlled for decades by the deployment of resistance genes. However, new races of this pathogen have emerged that overcome many important wheat stem rust resistance genes used ...
Sequence composition and gene content of the short arm of rye (Secale cereale chromosome 1.
Directory of Open Access Journals (Sweden)
Silvia Fluch
Full Text Available BACKGROUND: The purpose of the study is to elucidate the sequence composition of the short arm of rye chromosome 1 (Secale cereale with special focus on its gene content, because this portion of the rye genome is an integrated part of several hundreds of bread wheat varieties worldwide. METHODOLOGY/PRINCIPAL FINDINGS: Multiple Displacement Amplification of 1RS DNA, obtained from flow sorted 1RS chromosomes, using 1RS ditelosomic wheat-rye addition line, and subsequent Roche 454FLX sequencing of this DNA yielded 195,313,589 bp sequence information. This quantity of sequence information resulted in 0.43× sequence coverage of the 1RS chromosome arm, permitting the identification of genes with estimated probability of 95%. A detailed analysis revealed that more than 5% of the 1RS sequence consisted of gene space, identifying at least 3,121 gene loci representing 1,882 different gene functions. Repetitive elements comprised about 72% of the 1RS sequence, Gypsy/Sabrina (13.3% being the most abundant. More than four thousand simple sequence repeat (SSR sites mostly located in gene related sequence reads were identified for possible marker development. The existence of chloroplast insertions in 1RS has been verified by identifying chimeric chloroplast-genomic sequence reads. Synteny analysis of 1RS to the full genomes of Oryza sativa and Brachypodium distachyon revealed that about half of the genes of 1RS correspond to the distal end of the short arm of rice chromosome 5 and the proximal region of the long arm of Brachypodium distachyon chromosome 2. Comparison of the gene content of 1RS to 1HS barley chromosome arm revealed high conservation of genes related to chromosome 5 of rice. CONCLUSIONS: The present study revealed the gene content and potential gene functions on this chromosome arm and demonstrated numerous sequence elements like SSRs and gene-related sequences, which can be utilised for future research as well as in breeding of wheat and rye.
Dvorak, Jan; Wang, Le; Zhu, Tingting; Jorgensen, Chad M; Deal, Karin R; Dai, Xiongtao; Dawson, Matthew W; Müller, Hans-Georg; Luo, Ming-Cheng; Ramasamy, Ramesh K; Dehghani, Hamid; Gu, Yong Q; Gill, Bikram S; Distelfeld, Assaf; Devos, Katrien M; Qi, Peng; You, Frank M; Gulick, Patrick J; McGuire, Patrick E
2018-05-16
Homology was searched with genes annotated in the Aegilops tauschii pseudomolecules against genes annotated in the pseudomolecules of tetraploid wild emmer wheat, Brachypodium distachyon, sorghum, and rice. Similar searches were initiated with genes annotated in the rice pseudomolecules. Matrices of colinear genes and rearrangements in their order were constructed. Optical Bionano genome maps were constructed and used to validate rearrangements unique to the wild emmer and Ae. tauschii genomes. Most common rearrangements were short paracentric inversions and short intrachromosomal translocations. Intrachromosomal translocations outnumbered segmental intrachromosomal duplications. The densities of paracentric inversion lengths were approximated by exponential distributions in all six genomes. Densities of colinear genes along the Ae. tauschii chromosomes were highly correlated with meiotic recombination rates but those of rearrangements were not, suggesting different causes of the erosion of gene colinearity and evolution of major chromosome rearrangements. Frequent rearrangements sharing breakpoints suggested that chromosomes have been rearranged recurrently at some sites. The distal 4 Mb of the short arms of rice chromosomes Os11 and Os12 and corresponding regions in the sorghum, B. distachyon, and Triticeae genomes contain clusters of interstitial translocations including from 1 to 7 colinear genes. The rates of acquisition of major rearrangements were greater in the wild emmer wheat and Ae. tauschii genomes than in the lineage preceding their divergence or in the B. distachyon, rice, and sorghum lineages. It is suggested that synergy between large quantities of dynamic transposable elements and annual growth habit caused the fast evolution of the Triticeae genomes. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
He, Huagang; Zhu, Shanying; Jiang, Zhengning; Ji, Yaoyong; Wang, Feng; Zhao, Renhui; Bie, Tongde
2016-04-01
The powdery mildew resistance gene Pm21 was physically and comparatively mapped by newly developed markers. Seven candidate genes were verified to be required for Pm21 -mediated resistance to wheat powdery mildew. Pm21, a gene derived from wheat wild relative Dasypyrum villosum, has been transferred into common wheat and widely utilized in wheat resistance breeding for powdery mildew. Previously, Pm21 has been located to the bin FL0.45-0.58 of 6VS by using deletion stocks. However, its fine mapping is still a hard work. In the present study, 30 gene-derived 6VS-specific markers were obtained based on the collinearity among genomes of Brachypodium distachyon, Oryza and Triticeae, and then physically and comparatively mapped in the bin FL0.45-0.58 and its nearby chromosome region. According to the maps, the bin FL0.45-0.58 carrying Pm21 was closely flanked by the markers 6VS-03 and 6VS-23, which further narrowed the orthologous regions to 1.06 Mb in Brachypodium and 1.38 Mb in rice, respectively. Among the conserved genes shared by Brachypodium and rice, four serine/threonine protein kinase genes (DvMPK1, DvMLPK, DvUPK and DvPSYR1), one protein phosphatase gene (DvPP2C) and two transcription factor genes (DvGATA and DvWHY) were confirmed to be required for Pm21-mediated resistance to wheat powdery mildew by barley stripe mosaic virus-induced gene silencing (BSMV-VIGS) and transcriptional pattern analyses. In summary, this study gives new insights into the genetic basis of the Pm21 locus and the disease resistance pathways mediated by Pm21.
The genetic transformation of monocot grasses is a resource intensive process, the quality and efficiency of which is dependent in part upon the method of DNA introduction, as well as the ability to effectively separate transformed from wildtype tissue. Agrobacterium-mediated transformation of Brac...
Range of cell-wall alterations enhance saccharification in Brachypodium distachyon mutants
DEFF Research Database (Denmark)
Marriott, Poppy E; Sibout, Richard; Lapierre, Catherine
2014-01-01
saccharification with an industrial polysaccharide-degrading enzyme mixture. From an initial screen of 2,400 M2 plants, we selected 12 lines that showed heritable improvements in saccharification, mostly with no significant reduction in plant size or stem strength. Characterization of these putative mutants...
DEFF Research Database (Denmark)
Mravec, Jozef
2017-01-01
Plant border cells are specialised cells derived from the root cap with roles in the biomechanics of root growth and in forming a barrier against pathogens. The mechanism of highly localised cell separation which is essential for their release to the environment is little understood. Here I present...... in situ analysis of Brachypodium distachyon, a model organism for grasses which possess type II primary cell walls poor in pectin content. Results suggest similarity in spatial dynamics of pectic homogalacturonan during dicot and monocot border cell release. Integration of observations from different...... species leads to the hypothesis that this process most likely does not involve degradation of cell wall material but rather employs unique cell wall structural and compositional means enabling both the rigidity of the root cap as well as detachability of given cells on its surface....
Degradation of β-Aryl Ether Bonds in Transgenic Plants
DEFF Research Database (Denmark)
Mnich, Ewelina
Lignin is one of the main building blocks of the plant cell wall. It tethers the cell wall by cross-linking with polysaccharides conferring mechanical strength to plants, aiding water transport and providing a mechanical barrier against pathogens. It is generated by the polymerization....... Compared to other plants grass cell walls contain elevated amount of ferulates which play a crucial role in cross-linking of polysaccharides and lignin. In addition ferulates are believed to be nucleation cites for the lignification. The bacterium Sphingomonas paucimobilis SYK6 has developed an enzyme...... of the cell wall. The aim of the study was to alter lignin structure by expression in plants of the enzymes from S. paucimobilis involved in ether bond degradation (LigDFG). Arabidopsis thaliana and Brachypodium distachyon transgenic lines were generated and characterized with respect to lignin structure...
Genome comparison implies the role of Wsm2 in membrane trafficking and protein degradation
Directory of Open Access Journals (Sweden)
Guorong Zhang
2018-04-01
Full Text Available Wheat streak mosaic virus (WSMV causes streak mosaic disease in wheat (Triticum aestivum L. and has been an important constraint limiting wheat production in many regions around the world. Wsm2 is the only resistance gene discovered in wheat genome and has been located in a short genomic region of its chromosome 3B. However, the sequence nature and the biological function of Wsm2 remain unknown due to the difficulty of genetic manipulation in wheat. In this study, we tested WSMV infectivity among wheat and its two closely related grass species, rice (Oryza sativa and Brachypodium distachyon. Based on the phenotypic result and previous genomic studies, we developed a novel bioinformatics pipeline for interpreting a potential biological function of Wsm2 and its ancestor locus in wheat. In the WSMV resistance tests, we found that rice has a WMSV resistance gene while Brachypodium does not, which allowed us to hypothesize the presence of a Wsm2 ortholog in rice. Our OrthoMCL analysis of protein coding genes on wheat chromosome 3B and its syntenic chromosomes in rice and Brachypodium discovered 4,035 OrthoMCL groups as preliminary candidates of Wsm2 orthologs. Given that Wsm2 is likely duplicated through an intrachromosomal illegitimate recombination and that Wsm2 is dominant, we inferred that this new WSMV-resistance gene acquired an activation domain, lost an inhibition domain, or gained high expression compared to its ancestor locus. Through comparison, we identified that 67, 16, and 10 out of 4,035 OrthoMCL orthologous groups contain a rice member with 25% shorter or longer in length, or 10 fold more expression, respectively, than those from wheat and Brachypodium. Taken together, we predicted a total of 93 good candidates for a Wsm2 ancestor locus. All of these 93 candidates are not tightly linked with Wsm2, indicative of the role of illegitimate recombination in the birth of Wsm2. Further sequence analysis suggests that the protein products of
McKeown, Meghan; Schubert, Marian; Preston, Jill C; Fjellheim, Siri
2017-09-01
Flowering time is a carefully regulated trait controlled primarily through the action of the central genetic regulator, FLOWERING LOCUS T (FT). Recently it was demonstrated that a microRNA, miR5200, targets the end of the second exon of FT under short-day photoperiods in the grass subfamily Pooideae, thus preventing FT transcripts from reaching threshold levels under non-inductive conditions. Pooideae are an interesting group in that they rapidly diversified from the tropics into the northern temperate region during a major global cooling event spanning the Eocene-Oligocene transition. We hypothesize that miR5200 photoperiod-sensitive regulation of Pooideae flowering time networks assisted their transition into northern seasonal environments. Here, we test predictions derived from this hypothesis that miR5200, originally found in bread wheat and later identified in Brachypodium distachyon, (1) was present in the genome of the Pooideae common ancestor, (2) is transcriptionally regulated by photoperiod, and (3) is negatively correlated with FT transcript abundance, indicative of miR5200 regulating FT. Our results demonstrate that miR5200 did evolve at or around the base of Pooideae, but only acquired photoperiod-regulated transcription within the Brachypodium lineage. Based on expression profiles and previous data, we posit that the progenitor of miR5200 was co-regulated with FT by an unknown mechanism. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.
Gordon, Cameron S.; Rajagopalan, Nandhakishore; Risseeuw, Eddy P.; Surpin, Marci; Ball, Fraser J.; Barber, Carla J.; Buhrow, Leann M.; Clark, Shawn M.; Page, Jonathan E.; Todd, Chris D.; Abrams, Suzanne R.; Loewen, Michele C.
2016-01-01
Abscisic acid (ABA) is a well-characterized plant hormone, known to mediate developmental aspects as well as both abiotic and biotic stress responses. Notably, the exogenous application of ABA has recently been shown to increase susceptibility to the fungal pathogen Fusarium graminearum, the causative agent of Fusarium head blight (FHB) in wheat and other cereals. However roles and mechanisms associated with ABA’s modulation of pathogen responses remain enigmatic. Here the identification of putative ABA receptors from available genomic databases for Triticum aestivum (bread wheat) and Brachypodium distachyon (a model cereal) are reported. A number of these were cloned for recombinant expression and their functionality as ABA receptors confirmed by in vitro assays against protein phosphatases Type 2Cs. Ligand selectivity profiling of one of the wheat receptors (Ta_PYL2DS_FL) highlighted unique activities compared to Arabidopsis AtPYL5. Mutagenic analysis showed Ta_PYL2DS_FL amino acid D180 as being a critical contributor to this selectivity. Subsequently, a virus induced gene silencing (VIGS) approach was used to knockdown wheat Ta_PYL4AS_A (and similar) in planta, yielding plants with increased early stage resistance to FHB progression and decreased mycotoxin accumulation. Together these results confirm the existence of a family of ABA receptors in wheat and Brachypodium and present insight into factors modulating receptor function at the molecular level. That knockdown of Ta_PYL4AS_A (and similar) leads to early stage FHB resistance highlights novel targets for investigation in the future development of disease resistant crops. PMID:27755583
Missihoun, Tagnon D; Kotchoni, Simeon O; Bartels, Dorothea
2016-01-01
Plant aldehyde dehydrogenases (ALDHs) play important roles in cell wall biosynthesis, growth, development, and tolerance to biotic and abiotic stresses. The Reduced Epidermal Fluorescence1 is encoded by the subfamily 2C of ALDHs and was shown to oxidise coniferaldehyde and sinapaldehyde to ferulic acid and sinapic acid in the phenylpropanoid pathway, respectively. This knowledge has been gained from works in the dicotyledon model species Arabidopsis thaliana then used to functionally annotate ALDH2C isoforms in other species, based on the orthology principle. However, the extent to which the ALDH isoforms differ between monocotyledons and dicotyledons has rarely been accessed side-by-side. In this study, we used a phylogenetic approach to address this question. We have analysed the ALDH genes in Brachypodium distachyon, alongside those of other sequenced monocotyledon and dicotyledon species to examine traits supporting either a convergent or divergent evolution of the ALDH2C/REF1-type proteins. We found that B. distachyon, like other grasses, contains more ALDH2C/REF1 isoforms than A. thaliana and other dicotyledon species. Some amino acid residues in ALDH2C/REF1 isoforms were found as being conserved in dicotyledons but substituted by non-equivalent residues in monocotyledons. One example of those substitutions concerns a conserved phenylalanine and a conserved tyrosine in monocotyledons and dicotyledons, respectively. Protein structure modelling suggests that the presence of tyrosine would widen the substrate-binding pocket in the dicotyledons, and thereby influence substrate specificity. We discussed the importance of these findings as new hints to investigate why ferulic acid contents and cell wall digestibility differ between the dicotyledon and monocotyledon species.
Directory of Open Access Journals (Sweden)
Tagnon D Missihoun
Full Text Available Plant aldehyde dehydrogenases (ALDHs play important roles in cell wall biosynthesis, growth, development, and tolerance to biotic and abiotic stresses. The Reduced Epidermal Fluorescence1 is encoded by the subfamily 2C of ALDHs and was shown to oxidise coniferaldehyde and sinapaldehyde to ferulic acid and sinapic acid in the phenylpropanoid pathway, respectively. This knowledge has been gained from works in the dicotyledon model species Arabidopsis thaliana then used to functionally annotate ALDH2C isoforms in other species, based on the orthology principle. However, the extent to which the ALDH isoforms differ between monocotyledons and dicotyledons has rarely been accessed side-by-side. In this study, we used a phylogenetic approach to address this question. We have analysed the ALDH genes in Brachypodium distachyon, alongside those of other sequenced monocotyledon and dicotyledon species to examine traits supporting either a convergent or divergent evolution of the ALDH2C/REF1-type proteins. We found that B. distachyon, like other grasses, contains more ALDH2C/REF1 isoforms than A. thaliana and other dicotyledon species. Some amino acid residues in ALDH2C/REF1 isoforms were found as being conserved in dicotyledons but substituted by non-equivalent residues in monocotyledons. One example of those substitutions concerns a conserved phenylalanine and a conserved tyrosine in monocotyledons and dicotyledons, respectively. Protein structure modelling suggests that the presence of tyrosine would widen the substrate-binding pocket in the dicotyledons, and thereby influence substrate specificity. We discussed the importance of these findings as new hints to investigate why ferulic acid contents and cell wall digestibility differ between the dicotyledon and monocotyledon species.
Pyle, J D; Scholthof, Karen-Beth G
2018-01-15
Panicum mosaic virus (PMV) is a helper RNA virus for satellite RNAs (satRNAs) and a satellite virus (SPMV). Here, we describe modifications that occur at the 3'-end of a satRNA of PMV, satS. Co-infections of PMV+satS result in attenuation of the disease symptoms induced by PMV alone in Brachypodium distachyon and proso millet. The 375 nt satS acquires ~100-200 nts from the 3'-end of PMV during infection and is associated with decreased abundance of the PMV RNA and capsid protein in millet. PMV-satS chimera RNAs were isolated from native infections of St. Augustinegrass and switchgrass. Phylogenetic analyses revealed that the chimeric RNAs clustered according to the host species from which they were isolated. Additionally, the chimera satRNAs acquired non-viral "linker" sequences in a host-specific manner. These results highlight the dynamic regulation of viral pathogenicity by satellites, and the selective host-dependent, sequence-based pressures for driving satRNA generation and genome compositions. Copyright © 2017 Elsevier Inc. All rights reserved.
Identification of Leaf Promoters for Use in Transgenic Wheat
Directory of Open Access Journals (Sweden)
Saqer S. Alotaibi
2018-03-01
Full Text Available Wheat yields have plateaued in recent years and given the growing global population there is a pressing need to develop higher yielding varieties to meet future demand. Genetic manipulation of photosynthesis in elite wheat varieties offers the opportunity to significantly increase yields. However, the absence of a well-defined molecular tool-box of promoters to manipulate leaf processes in wheat hinders advancements in this area. Two promoters, one driving the expression of sedoheptulose-1,7-bisphosphatase (SBPase and the other fructose-1,6-bisphosphate aldolase (FBPA from Brachypodium distachyon were identified and cloned into a vector in front of the GUS reporter gene. Both promoters were shown to be functionally active in wheat in both transient assays and in stably transformed wheat plants. Analysis of the stable transformants of wheat (cv. Cadenza showed that both promoters controlled gus expression throughout leaf development as well as in other green tissues. The availability of these promoters provides new tools for the expression of genes in transgenic wheat leaves and also paves the way for multigene manipulation of photosynthesis to improve yields.
Directory of Open Access Journals (Sweden)
Huagang He
2017-11-01
Full Text Available Pm21, originating from wheat wild relative Dasypyrum villosum, confers immunity to all known races of Blumeria graminis f. sp. tritici (Bgt and has been widely utilized in wheat breeding. However, little is known on the genetic basis of the Pm21 locus. In the present study, four seedling-susceptible D. villosum lines (DvSus-1 ∼ DvSus-4 were identified from different natural populations. Based on the collinearity among genomes of Brachypodium distachyon, Oryza, and Triticeae, a set of 25 gene-derived markers were developed declaring the polymorphisms between DvRes-1 carrying Pm21 and DvSus-1. Fine genetic mapping of Pm21 was conducted by using an extremely large F2 segregation population derived from the cross DvSus-1/DvRes-1. Then Pm21 was narrowed to a 0.01-cM genetic interval defined by the markers 6VS-08.4b and 6VS-10b. Three DNA markers, including a resistance gene analog marker, were confirmed to co-segregate with Pm21. Moreover, based on the susceptible deletion line Y18-S6 induced by ethyl methanesulfonate treatment conducted on Yangmai 18, Pm21 was physically mapped into a similar interval. Comparative analysis revealed that the orthologous regions of the interval carrying Pm21 were narrowed to a 112.5 kb genomic region harboring 18 genes in Brachypodium, and a 23.2 kb region harboring two genes in rice, respectively. This study provides a high-density integrated map of the Pm21 locus, which will contribute to map-based cloning of Pm21.
Conservation, Divergence, and Genome-Wide Distribution of PAL and POX A Gene Families in Plants.
Rawal, H C; Singh, N K; Sharma, T R
2013-01-01
Genome-wide identification and phylogenetic and syntenic comparison were performed for the genes responsible for phenylalanine ammonia lyase (PAL) and peroxidase A (POX A) enzymes in nine plant species representing very diverse groups like legumes (Glycine max and Medicago truncatula), fruits (Vitis vinifera), cereals (Sorghum bicolor, Zea mays, and Oryza sativa), trees (Populus trichocarpa), and model dicot (Arabidopsis thaliana) and monocot (Brachypodium distachyon) species. A total of 87 and 1045 genes in PAL and POX A gene families, respectively, have been identified in these species. The phylogenetic and syntenic comparison along with motif distributions shows a high degree of conservation of PAL genes, suggesting that these genes may predate monocot/eudicot divergence. The POX A family genes, present in clusters at the subtelomeric regions of chromosomes, might be evolving and expanding with higher rate than the PAL gene family. Our analysis showed that during the expansion of POX A gene family, many groups and subgroups have evolved, resulting in a high level of functional divergence among monocots and dicots. These results will act as a first step toward the understanding of monocot/eudicot evolution and functional characterization of these gene families in the future.
Energy Technology Data Exchange (ETDEWEB)
Lee, Juwoon; Kim, Dongho; Choi, Jongil; Song, Beomseok; Kim, Jaekyung; Kang, Oilhyun; Lee, Yoonjong; Kim, Jinhong; Jo, Minho
2011-04-15
{Omicron} KAERI-IBMP joint workshop on countermeasure and application researches to space environments - Sharing of state-of-the-art researches on space radiobiology using bio-satellites (BION-M1, Photon-soil) and ISS module (Bio-risk) was conducted - Sharing and discussion of state-of-the-art researches on dosimetry of space radiation and its affect on organisms were conducted. {Omicron} Making a contract on KAERI-IBMP Joint Research using Bio-risk module - Contract on KAERI-IBMP Joint Research to evaluate effect of space environment (microgravity and space radiation) on fermentative fungi (Aspergillus oryzae), Algae (Nostoc sp.), and plant seeds (rice, Arabidopsis thaliana, Brachypodium distachyon) was made in November, 2010. {Omicron} Discussion on new Joint Researches on evaluation of space radiation on organisms - Final step on Bion-M projects in terms of evaluation of physiological changes of lactic acid bacteria consumed by Mouse - Discussing new joint research on evaluation of physiological changes of primate by space radiation {Omicron} Establishment and management of the practical working group to invite a branch office of the IBMP in Korea - The system and the working group to implement cooperating researches between KAERI-IBMP on space radiation were established.
International Nuclear Information System (INIS)
Lee, Juwoon; Kim, Dongho; Choi, Jongil; Song, Beomseok; Kim, Jaekyung; Kang, Oilhyun; Lee, Yoonjong; Kim, Jinhong; Jo, Minho
2011-04-01
Ο KAERI-IBMP joint workshop on countermeasure and application researches to space environments - Sharing of state-of-the-art researches on space radiobiology using bio-satellites (BION-M1, Photon-soil) and ISS module (Bio-risk) was conducted - Sharing and discussion of state-of-the-art researches on dosimetry of space radiation and its affect on organisms were conducted. Ο Making a contract on KAERI-IBMP Joint Research using Bio-risk module - Contract on KAERI-IBMP Joint Research to evaluate effect of space environment (microgravity and space radiation) on fermentative fungi (Aspergillus oryzae), Algae (Nostoc sp.), and plant seeds (rice, Arabidopsis thaliana, Brachypodium distachyon) was made in November, 2010. Ο Discussion on new Joint Researches on evaluation of space radiation on organisms - Final step on Bion-M projects in terms of evaluation of physiological changes of lactic acid bacteria consumed by Mouse - Discussing new joint research on evaluation of physiological changes of primate by space radiation Ο Establishment and management of the practical working group to invite a branch office of the IBMP in Korea - The system and the working group to implement cooperating researches between KAERI-IBMP on space radiation were established
Conservation, Divergence, and Genome-Wide Distribution of PAL and POX A Gene Families in Plants
Directory of Open Access Journals (Sweden)
H. C. Rawal
2013-01-01
Full Text Available Genome-wide identification and phylogenetic and syntenic comparison were performed for the genes responsible for phenylalanine ammonia lyase (PAL and peroxidase A (POX A enzymes in nine plant species representing very diverse groups like legumes (Glycine max and Medicago truncatula, fruits (Vitis vinifera, cereals (Sorghum bicolor, Zea mays, and Oryza sativa, trees (Populus trichocarpa, and model dicot (Arabidopsis thaliana and monocot (Brachypodium distachyon species. A total of 87 and 1045 genes in PAL and POX A gene families, respectively, have been identified in these species. The phylogenetic and syntenic comparison along with motif distributions shows a high degree of conservation of PAL genes, suggesting that these genes may predate monocot/eudicot divergence. The POX A family genes, present in clusters at the subtelomeric regions of chromosomes, might be evolving and expanding with higher rate than the PAL gene family. Our analysis showed that during the expansion of POX A gene family, many groups and subgroups have evolved, resulting in a high level of functional divergence among monocots and dicots. These results will act as a first step toward the understanding of monocot/eudicot evolution and functional characterization of these gene families in the future.
Film grain synthesis and its application to re-graining
Schallauer, Peter; Mörzinger, Roland
2006-01-01
Digital film restoration and special effects compositing require more and more automatic procedures for movie regraining. Missing or inhomogeneous grain decreases perceived quality. For the purpose of grain synthesis an existing texture synthesis algorithm has been evaluated and optimized. We show that this algorithm can produce synthetic grain which is perceptually similar to a given grain template, which has high spatial and temporal variation and which can be applied to multi-spectral images. Furthermore a re-grain application framework is proposed, which synthesises based on an input grain template artificial grain and composites this together with the original image content. Due to its modular approach this framework supports manual as well as automatic re-graining applications. Two example applications are presented, one for re-graining an entire movie and one for fully automatic re-graining of image regions produced by restoration algorithms. Low computational cost of the proposed algorithms allows application in industrial grade software.
Dust grain charging in a wake of other grains
International Nuclear Information System (INIS)
Miloch, W. J.; Block, D.
2012-01-01
The charging of dust grain in the wake of another grains in sonic and supersonic collisionless plasma flows is studied by numerical simulations. We consider two grains aligned with the flow, as well as dust chains and multiple grain arrangements. It is found that the dust charge depends significantly on the flow speed, distance between the grains, and the grain arrangement. For two and three grains aligned, the charges on downstream grains depend linearly on the flow velocity and intergrain distance. The simulations are carried out with DiP3D, a three dimensional particle-in-cell code with both electrons and ions represented as numerical particles [W. J. Miloch et al., Phys. Plasmas 17, 103703 (2010)].
Directory of Open Access Journals (Sweden)
Ludmila Tyler
2016-07-01
Full Text Available The small, annual grass (L. Beauv., a close relative of wheat ( L. and barley ( L., is a powerful model system for cereals and bioenergy grasses. Genome-wide association studies (GWAS of natural variation can elucidate the genetic basis of complex traits but have been so far limited in by the lack of large numbers of well-characterized and sufficiently diverse accessions. Here, we report on genotyping-by-sequencing (GBS of 84 , seven , and three accessions with diverse geographic origins including Albania, Armenia, Georgia, Italy, Spain, and Turkey. Over 90,000 high-quality single-nucleotide polymorphisms (SNPs distributed across the Bd21 reference genome were identified. Our results confirm the hybrid nature of the genome, which appears as a mosaic of -like and -like sequences. Analysis of more than 50,000 SNPs for the accessions revealed three distinct, genetically defined populations. Surprisingly, these genomic profiles are associated with differences in flowering time rather than with broad geographic origin. High levels of differentiation in loci associated with floral development support the differences in flowering phenology between populations. Genome-wide association studies combining genotypic and phenotypic data also suggest the presence of one or more photoperiodism, circadian clock, and vernalization genes in loci associated with flowering time variation within populations. Our characterization elucidates genes underlying population differences, expands the germplasm resources available for , and illustrates the feasibility and limitations of GWAS in this model grass.
Grain-filling duration and grain yield relationships in wheat mutants
International Nuclear Information System (INIS)
Larik, A.S.
1987-01-01
Nine stable mutants of bread wheat along with their mother cultivars were investigated for grain-filling characteristics in relation to grain yield. Significant differences among mutants for grain-filling duration and grain-filling index were observed. Inspite of the consistent differences in grain-filling duration there was no significant association between grain-filling duration and grain yield in C-591 and Nayab mutants. Failure to detect an yield advantage due to differences in grain-filling duration in these genotypes suggests that any advantage derived from alteration of grain-filling period may have been outweighed by the coincident changes in length of the vegetative period. Other factors such as synchrony of anthesis may have limited out ability to find an association between grainfilling duration and grain yield. On the contrary, significant association between grain-filling duration and grain yield displayed by indus-66 indus-66 mutants derived from gamma rays, shows the ability of gamma rays to induce functional alternations in the pattern of gene arrangements controlling these traits. Thus, the vaability observed in these physiological traits suggests that selection for these traits could be useful in improving grain yield. (author)
International Nuclear Information System (INIS)
Leitch-Devlin, M.A.; Millar, T.J.; Williams, D.A.
1976-01-01
Infrared observations of the Orion nebula have been interpreted by Rowan-Robinson (1975) to imply the existence of 'giant' grains, radius approximately 10 -2 cm, throughout a volume about a parsec in diameter. Although Rowan-Robinson's model of the nebula has been criticized and the presence of such grains in Orion is disputed, the proposition is accepted, that they exist, and in this paper situations in which giant grains could arise are examined. It is found that, while a giant-grain component to the interstellar grain density may exist, it is difficult to understand how giant grains arise to the extent apparently required by the Orion nebula model. (Auth.)
Carpel size, grain filling, and morphology determine individual grain weight in wheat.
Xie, Quan; Mayes, Sean; Sparkes, Debbie L
2015-11-01
Individual grain weight is a major yield component in wheat. To provide a comprehensive understanding of grain weight determination, the carpel size at anthesis, grain dry matter accumulation, grain water uptake and loss, grain morphological expansion, and final grain weight at different positions within spikelets were investigated in a recombinant inbred line mapping population of bread wheat (Triticum aestivum L.)×spelt (Triticum spelta L.). Carpel size, grain dry matter and water accumulation, and grain dimensions interacted strongly with each other. Furthermore, larger carpels, a faster grain filling rate, earlier and longer grain filling, more grain water, faster grain water absorption and loss rates, and larger grain dimensions were associated with higher grain weight. Frequent quantitative trait locus (QTL) coincidences between these traits were observed, particularly those on chromosomes 2A, 3B, 4A, 5A, 5DL, and 7B, each of which harboured 16-49 QTLs associated with >12 traits. Analysis of the allelic effects of coincident QTLs confirmed their physiological relationships, indicating that the complex but orderly grain filling processes result mainly from pleiotropy or the tight linkages of functionally related genes. After grain filling, distal grains within spikelets were smaller than basal grains, primarily due to later grain filling and a slower initial grain filling rate, followed by synchronous maturation among different grains. Distal grain weight was improved by increased assimilate availability from anthesis. These findings provide deeper insight into grain weight determination in wheat, and the high level of QTL coincidences allows simultaneous improvement of multiple grain filling traits in breeding. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Prevalence of IgE antibodies to grain and grain dust in grain elevator workers.
Lewis, D M; Romeo, P A; Olenchock, S A
1986-01-01
IgE-mediated allergic reactions have been postulated to contribute to respiratory reactions seen in workers exposed to grain dusts. In an attempt better to define the prevalence of IgE antibodies in workers exposed to grain dusts, we performed the radioallergosorbent test (RAST) on worker sera using both commercial allergens prepared from grain and worksite allergens prepared from grain dust samples collected at the worksite. We found that the two types of reagents identified different populations with respect to the specificity of IgE antibodies present. The RAST assay performed using worksite allergens correlated well with skin test procedures. These results may allow us to gain better understanding of allergy associated with grain dust exposure, and document the utility of the RAST assay in assessment of occupational allergies. PMID:3709478
Prevalence of IgE antibodies to grain and grain dust in grain elevator workers
Energy Technology Data Exchange (ETDEWEB)
Lewis, D.M.; Romeo, P.A.; Olenchock, S.A.
1986-04-01
IgE-mediated allergic reactions have been postulated to contribute to respiratory reactions seen in workers exposed to grain dusts. In an attempt better to define the prevalence of IgE antibodies in workers exposed to grain dusts, we performed the radioallergosorbent test (RAST) on worker sera using both commercial allergens prepared from grain and worksite allergens prepared from grain dust samples collected at the worksite. We found that the two types of reagents identified different populations with respect to the specificity of IgE antibodies present. The RAST assay performed using worksite allergens correlated well with skin test procedures. These results may allow us to gain better understanding of allergy associated with grain dust exposure, and document the utility of the RAST assay in assessment of occupational allergies.
Prevalence of IgE antibodies to grain and grain dust in grain elevator workers
International Nuclear Information System (INIS)
Lewis, D.M.; Romeo, P.A.; Olenchock, S.A.
1986-01-01
IgE-mediated allergic reactions have been postulated to contribute to respiratory reactions seen in workers exposed to grain dusts. In an attempt better to define the prevalence of IgE antibodies in workers exposed to grain dusts, we performed the radioallergosorbent test (RAST) on worker sera using both commercial allergens prepared from grain and worksite allergens prepared from grain dust samples collected at the worksite. We found that the two types of reagents identified different populations with respect to the specificity of IgE antibodies present. The RAST assay performed using worksite allergens correlated well with skin test procedures. These results may allow us to gain better understanding of allergy associated with grain dust exposure, and document the utility of the RAST assay in assessment of occupational allergies
Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
Shaar-Moshe, Lidor; Hübner, Sariel; Peleg, Zvi
2015-05-03
Drought is the major environmental stress threatening crop-plant productivity worldwide. Identification of new genes and metabolic pathways involved in plant adaptation to progressive drought stress at the reproductive stage is of great interest for agricultural research. We developed a novel Cross-Species meta-Analysis of progressive Drought stress at the reproductive stage (CSA:Drought) to identify key drought adaptive genes and mechanisms and to test their evolutionary conservation. Empirically defined filtering criteria were used to facilitate a robust integration of 17 deposited microarray experiments (148 arrays) of Arabidopsis, rice, wheat and barley. By prioritizing consistency over intensity, our approach was able to identify 225 differentially expressed genes shared across studies and taxa. Gene ontology enrichment and pathway analyses classified the shared genes into functional categories involved predominantly in metabolic processes (e.g. amino acid and carbohydrate metabolism), regulatory function (e.g. protein degradation and transcription) and response to stimulus. We further investigated drought related cis-acting elements in the shared gene promoters, and the evolutionary conservation of shared genes. The universal nature of the identified drought-adaptive genes was further validated in a fifth species, Brachypodium distachyon that was not included in the meta-analysis. qPCR analysis of 27, randomly selected, shared orthologs showed similar expression pattern as was found by the CSA:Drought.In accordance, morpho-physiological characterization of progressive drought stress, in B. distachyon, highlighted the key role of osmotic adjustment as evolutionary conserved drought-adaptive mechanism. Our CSA:Drought strategy highlights major drought-adaptive genes and metabolic pathways that were only partially, if at all, reported in the original studies included in the meta-analysis. These genes include a group of unclassified genes that could be involved
Genotypic variability enhances the reproducibility of an ecological study.
Milcu, Alexandru; Puga-Freitas, Ruben; Ellison, Aaron M; Blouin, Manuel; Scheu, Stefan; Freschet, Grégoire T; Rose, Laura; Barot, Sebastien; Cesarz, Simone; Eisenhauer, Nico; Girin, Thomas; Assandri, Davide; Bonkowski, Michael; Buchmann, Nina; Butenschoen, Olaf; Devidal, Sebastien; Gleixner, Gerd; Gessler, Arthur; Gigon, Agnès; Greiner, Anna; Grignani, Carlo; Hansart, Amandine; Kayler, Zachary; Lange, Markus; Lata, Jean-Christophe; Le Galliard, Jean-François; Lukac, Martin; Mannerheim, Neringa; Müller, Marina E H; Pando, Anne; Rotter, Paula; Scherer-Lorenzen, Michael; Seyhun, Rahme; Urban-Mead, Katherine; Weigelt, Alexandra; Zavattaro, Laura; Roy, Jacques
2018-02-01
Many scientific disciplines are currently experiencing a 'reproducibility crisis' because numerous scientific findings cannot be repeated consistently. A novel but controversial hypothesis postulates that stringent levels of environmental and biotic standardization in experimental studies reduce reproducibility by amplifying the impacts of laboratory-specific environmental factors not accounted for in study designs. A corollary to this hypothesis is that a deliberate introduction of controlled systematic variability (CSV) in experimental designs may lead to increased reproducibility. To test this hypothesis, we had 14 European laboratories run a simple microcosm experiment using grass (Brachypodium distachyon L.) monocultures and grass and legume (Medicago truncatula Gaertn.) mixtures. Each laboratory introduced environmental and genotypic CSV within and among replicated microcosms established in either growth chambers (with stringent control of environmental conditions) or glasshouses (with more variable environmental conditions). The introduction of genotypic CSV led to 18% lower among-laboratory variability in growth chambers, indicating increased reproducibility, but had no significant effect in glasshouses where reproducibility was generally lower. Environmental CSV had little effect on reproducibility. Although there are multiple causes for the 'reproducibility crisis', deliberately including genetic variability may be a simple solution for increasing the reproducibility of ecological studies performed under stringently controlled environmental conditions.
Cuadrado, Angeles; Golczyk, Hieronim; Jouve, Nicolás
2009-01-01
We report a new technique-nondenaturing FISH (ND-FISH)-for the rapid detection of plant telomeres without the need for prior denaturation of the chromosomes. In its development, two modified, synthetic oligonucleotides, 21 nt in length, fluorescently labelled at their 5' and 3' ends and complementary to either the cytidine-rich (C(3)TA(3)) or guanosine-rich (T(3)AG(3)) telomeric DNA strands, were used as probes. The high binding affinity of these probes and the short hybridization time required allows the visualization of plant telomeres in less than an hour. In tests, both probes gave strong signals visualized as double spots at both chromosome ends; this was true of both the mitotic and meiotic chromosomes of barley, wheat, rye, maize, Brachypodium distachyon and Rhoeo spathacea. They were also able to detect telomere motifs at certain intercalary sites in the chromosomes of R. spathacea. To investigate the nature of the target structures detected, the chromosomes were treated with RNase A and single strand-specific nuclease S1 before ND-FISH experiments. Signal formation was resistant to standard enzymatic treatment, but sensitive when much higher enzyme concentrations were used. The results are discussed in relation to current knowledge of telomere structure.
Tran, Mai L; McCarthy, Thomas W; Sun, Hao; Wu, Shu-Zon; Norris, Joanna H; Bezanilla, Magdalena; Vidali, Luis; Anderson, Charles T; Roberts, Alison W
2018-01-15
Results from live cell imaging of fluorescently tagged Cellulose Synthase (CESA) proteins in Cellulose Synthesis Complexes (CSCs) have enhanced our understanding of cellulose biosynthesis, including the mechanisms of action of cellulose synthesis inhibitors. However, this method has been applied only in Arabidopsis thaliana and Brachypodium distachyon thus far. Results from freeze fracture electron microscopy of protonemal filaments of the moss Funaria hygrometrica indicate that a cellulose synthesis inhibitor, 2,6-dichlorobenzonitrile (DCB), fragments CSCs and clears them from the plasma membrane. This differs from Arabidopsis, in which DCB causes CSC accumulation in the plasma membrane and a different cellulose synthesis inhibitor, isoxaben, clears CSCs from the plasma membrane. In this study, live cell imaging of the moss Physcomitrella patens indicated that DCB and isoxaben have little effect on protonemal growth rates, and that only DCB causes tip rupture. Live cell imaging of mEGFP-PpCESA5 and mEGFP-PpCESA8 showed that DCB and isoxaben substantially reduced CSC movement, but had no measureable effect on CSC density in the plasma membrane. These results suggest that DCB and isoxaben have similar effects on CSC movement in P. patens and Arabidopsis, but have different effects on CSC intracellular trafficking, cell growth and cell integrity in these divergent plant lineages.
Abnormal grain growth: a non-equilibrium thermodynamic model for multi-grain binary systems
International Nuclear Information System (INIS)
Svoboda, J; Fischer, F D
2014-01-01
Abnormal grain growth as the abrupt growth of a group of the largest grains in a multi-grain system is treated within the context of unequal retardation of grain growth due to the segregation of solute atoms from the bulk of the grains into the grain boundaries. During grain boundary migration, the segregated solute atoms are dragged under a small driving force or left behind the migrating grain boundary under a large driving force. Thus, the solute atoms in the grain boundaries of large grains, exhibiting a large driving force, can be released from the grain boundary. The mobility of these grain boundaries becomes significantly higher and abnormal grain growth is spontaneously provoked. The mean-field model presented here assumes that each grain is described by its grain radius and by its individual segregation parameter. The thermodynamic extremal principle is engaged to obtain explicit evolution equations for the radius and segregation parameter of each grain. Simulations of grain growth kinetics for various conditions of segregation with the same initial setting (100 000 grains with a given radius distribution) are presented. Depending on the diffusion coefficients of the solute in the grain boundaries, abnormal grain growth may be strongly or marginally pronounced. Solute segregation and drag can also significantly contribute to the stabilization of the grain structure. Qualitative agreement with several experimental results is reported. (paper)
A grain-boundary diffusion model of dynamic grain growth during superplastic deformation
International Nuclear Information System (INIS)
Kim, Byung-Nam; Hiraga, Keijiro; Sakka, Yoshio; Ahn, Byung-Wook
1999-01-01
Dynamic grain growth during superplastic deformation is modelled on the basis of a grain-boundary diffusion mechanism. On the grain boundary where a static and a dynamic potential difference coexist, matter transport along the boundary is assumed to contribute to dynamic grain growth through depositing the matter on the grain surface located opposite to the direction of grain-boundary migration. The amount of the diffusive matter during deformation is calculated for an aggregate of spherical grains and is converted to the increment of mean boundary migration velocity. The obtained relationship between the strain rate and the dynamic grain growth rate is shown to be independent of deformation mechanisms, provided that the grain growth is controlled by grain-boundary diffusion. The strain dependence, strain-rate dependence and temperature dependence of grain growth predicted from this model are consistent with those observed in superplastic ZrO 2 -dispersed Al 2 O 3
Carpel size, grain filling, and morphology determine individual grain weight in wheat
Xie, Quan; Mayes, Sean; Sparkes, Debbie L.
2015-01-01
Individual grain weight is a major yield component in wheat. To provide a comprehensive understanding of grain weight determination, the carpel size at anthesis, grain dry matter accumulation, grain water uptake and loss, grain morphological expansion, and final grain weight at different positions within spikelets were investigated in a recombinant inbred line mapping population of bread wheat (Triticum aestivum L.)?spelt (Triticum spelta L.). Carpel size, grain dry matter and water accumulat...
Chen, Shisheng; Guo, Yan; Briggs, Jordan; Dubach, Felix; Chao, Shiaoman; Zhang, Wenjun; Rouse, Matthew N; Dubcovsky, Jorge
2018-03-01
The new stem rust resistance gene Sr60 was fine-mapped to the distal region of chromosome arm 5A m S, and the TTKSK-effective gene SrTm5 could be a new allele of Sr22. The emergence and spread of new virulent races of the wheat stem rust pathogen (Puccinia graminis f. sp. tritici; Pgt), including the Ug99 race group, is a serious threat to global wheat production. In this study, we mapped and characterized two stem rust resistance genes from diploid wheat Triticum monococcum accession PI 306540. We mapped SrTm5, a previously postulated gene effective to Ug99, on chromosome arm 7A m L, completely linked to Sr22. SrTm5 displayed a different race specificity compared to Sr22 indicating that they are distinct. Sequencing of the Sr22 homolog in PI 306540 revealed a novel haplotype. Characterization of the segregating populations with Pgt race QFCSC revealed an additional resistance gene on chromosome arm 5A m S that was assigned the official name Sr60. This gene was also effective against races QTHJC and SCCSC but not against TTKSK (a Ug99 group race). Using two large mapping populations (4046 gametes), we mapped Sr60 within a 0.44 cM interval flanked by sequenced-based markers GH724575 and CJ942731. These two markers delimit a 54.6-kb region in Brachypodium distachyon chromosome 4 and a 430-kb region in the Chinese Spring reference genome. Both regions include a leucine-rich repeat protein kinase (LRRK123.1) that represents a potential candidate gene. Three CC-NBS-LRR genes were found in the colinear Brachypodium region but not in the wheat genome. We are currently developing a Bacterial Artificial Chromosome library of PI 306540 to determine which of these candidate genes are present in the T. monococcum genome and to complete the cloning of Sr60.
Molecular Physiology of Root System Architecture in Model Grasses
Hixson, K.; Ahkami, A. H.; Anderton, C.; Veličković, D.; Myers, G. L.; Chrisler, W.; Lindenmaier, R.; Fang, Y.; Yabusaki, S.; Rosnow, J. J.; Farris, Y.; Khan, N. E.; Bernstein, H. C.; Jansson, C.
2017-12-01
Unraveling the molecular and physiological mechanisms involved in responses of Root System Architecture (RSA) to abiotic stresses and shifts in microbiome structure is critical to understand and engineer plant-microbe-soil interactions in the rhizosphere. In this study, accessions of Brachypodium distachyon Bd21 (C3 model grass) and Setaria viridis A10.1 (C4 model grass) were grown in phytotron chambers under current and elevated CO2 levels. Detailed growth stage-based phenotypic analysis revealed different above- and below-ground morphological and physiological responses in C3 and C4 grasses to enhanced CO2 levels. Based on our preliminary results and by screening values of total biomass, water use efficiency, root to shoot ratio, RSA parameters and net assimilation rates, we postulated a three-phase physiological mechanism, i.e. RootPlus, BiomassPlus and YieldPlus phases, for grass growth under elevated CO2 conditions. Moreover, this comprehensive set of morphological and process-based observations are currently in use to develop, test, and calibrate biophysical whole-plant models and in particular to simulate leaf-level photosynthesis at various developmental stages of C3 and C4 using the model BioCro. To further link the observed phenotypic traits at the organismal level to tissue and molecular levels, and to spatially resolve the origin and fate of key metabolites involved in primary carbohydrate metabolism in different root sections, we complement root phenotypic observations with spatial metabolomics data using mass spectrometry imaging (MSI) methods. Focusing on plant-microbe interactions in the rhizosphere, six bacterial strains with plant growth promoting features are currently in use in both gel-based and soil systems to screen root growth and development in Brachypodium. Using confocal microscopy, GFP-tagged bacterial systems are utilized to study the initiation of different root types of RSA, including primary root (PR), coleoptile node axile root (CNR
Grain dissection as a grain size reducing mechanism during ice microdynamics
Steinbach, Florian; Kuiper, Ernst N.; Eichler, Jan; Bons, Paul D.; Drury, Martin R.; Griera, Albert; Pennock, Gill M.; Weikusat, Ilka
2017-04-01
Ice sheets are valuable paleo-climate archives, but can lose their integrity by ice flow. An understanding of the microdynamic mechanisms controlling the flow of ice is essential when assessing climatic and environmental developments related to ice sheets and glaciers. For instance, the development of a consistent mechanistic grain size law would support larger scale ice flow models. Recent research made significant progress in numerically modelling deformation and recrystallisation mechanisms in the polycrystalline ice and ice-air aggregate (Llorens et al., 2016a,b; Steinbach et al., 2016). The numerical setup assumed grain size reduction is achieved by the progressive transformation of subgrain boundaries into new high angle grain boundaries splitting an existing grain. This mechanism is usually termed polygonisation. Analogue experiments suggested, that strain induced grain boundary migration can cause bulges to migrate through the whole of a grain separating one region of the grain from another (Jessell, 1986; Urai, 1987). This mechanism of grain dissection could provide an alternative grain size reducing mechanism, but has not yet been observed during ice microdynamics. In this contribution, we present results using an updated numerical approach allowing for grain dissection. The approach is based on coupling the full field theory crystal visco-plasticity code (VPFFT) of Lebensohn (2001) to the multi-process modelling platform Elle (Bons et al., 2008). VPFFT predicts the mechanical fields resulting from short strain increments, dynamic recrystallisation process are implemented in Elle. The novel approach includes improvements to allow for grain dissection, which was topologically impossible during earlier simulations. The simulations are supported by microstructural observations from NEEM (North Greenland Eemian Ice Drilling) ice core. Mappings of c-axis orientations using the automatic fabric analyser and full crystallographic orientations using electron
Grain-size sorting and slope failure in experimental subaqueous grain flows
Kleinhans, M.G.; Asch, Th.W.J. van
2005-01-01
Grain-size sorting in subaqueous grain flows of a continuous range of grain sizes is studied experimentally with three mixtures. The observed pattern is a combination of stratification and gradual segregation. The stratification is caused by kinematic sieving in the grain flow. The segregation is
A comparison of grain boundary evolution during grain growth in fcc metals
International Nuclear Information System (INIS)
Brons, J.G.; Thompson, G.B.
2013-01-01
Grain growth of Cu and Ni thin films, subjected to in situ annealing within a transmission electron microscope, has been quantified using a precession-enhanced electron diffraction technique. The orientation of each grain and its misorientation with respect to its neighboring grains were calculated. The Cu underwent grain growth that maintained a monomodal grain size distribution, with its low-angle grain boundaries being consumed, and the Ni exhibited grain size distributions in stages, from monomodal to bimodal to monomodal. The onset of Ni’s abnormal grain growth was accompanied by a sharp increase in the Σ3 and Σ9 boundary fractions, which is attributed to simulation predictions of their increased mobility. These Σ3 and Σ9 fractions then dropped to their room temperature values during the third stage of grain growth. In addition to the Σ3 and Σ9 boundaries, the Σ5 and Σ7 boundaries also underwent an increase in total boundary fraction with increasing temperature in both metals
Mechanism of secondary recrystallization of Goss grains in grain-oriented electrical steel
Hayakawa, Yasuyuki
2017-12-01
Since its invention by Goss in 1934, grain-oriented (GO) electrical steel has been widely used as a core material in transformers. GO exhibits a grain size of over several millimeters attained by secondary recrystallization during high-temperature final batch annealing. In addition to the unusually large grain size, the crystal direction in the rolling direction is aligned with , which is the easy magnetization axis of α-iron. Secondary recrystallization is the phenomenon in which a certain very small number of {110} (Goss) grains grow selectively (about one in 106 primary grains) at the expense of many other primary recrystallized grains. The question of why the Goss orientation is exclusively selected during secondary recrystallization has long been a main research subject in this field. The general criterion for secondary recrystallization is a small and uniform primary grain size, which is achieved through the inhibition of normal grain growth by fine precipitates called inhibitors. This paper describes several conceivable mechanisms of secondary recrystallization of Goss grains mainly based on the selective growth model.
Grain-boundary engineering applied to grain growth in a high temperature material
International Nuclear Information System (INIS)
Huda, Z.
1993-01-01
Crystallography of grain boundaries are determined for a high temperature material, before and after grain growth processes, so as to study the induction of special properties useful for application in components of a gas-turbine engine. The philosophy of grain-boundary engineering is applied to grain growth in APK-6, a powder formed nickel-base superalloy so as to establish the possible structure/property relationships. The alloy in the as received condition is shown to possess a strong texture and contained coincident site lattices (CSL) boundaries with most boundaries having sigma values in the range of 3 > sigma > 25. A normal grain-growth heat treatment result in a good population of low angle grain boundaries, and drastically reduces the proportion of CSL boundaries. A strong [011] annealing texture is observed after an intermediate grain growth; most grain boundaries, here, tend to be high angle indicating a possibility of possessing special properties. (author)
Phloem Transport of Arsenic Species from Flag Leaf to Grain During Grain Filling
Energy Technology Data Exchange (ETDEWEB)
A Carey; G Norton; C Deacon; K Scheckel; E Lombi; T Punshon; M Guerinot; A Lanzirotti; M Newville; et al.
2011-12-31
Strategies to reduce arsenic (As) in rice grain, below concentrations that represent a serious human health concern, require that the mechanisms of As accumulation within grain be established. Therefore, retranslocation of As species from flag leaves into filling rice grain was investigated. Arsenic species were delivered through cut flag leaves during grain fill. Spatial unloading within grains was investigated using synchrotron X-ray fluorescence (SXRF) microtomography. Additionally, the effect of germanic acid (a silicic acid analog) on grain As accumulation in arsenite-treated panicles was examined. Dimethylarsinic acid (DMA) and monomethylarsonic acid (MMA) were extremely efficiently retranslocated from flag leaves to rice grain; arsenate was poorly retranslocated, and was rapidly reduced to arsenite within flag leaves; arsenite displayed no retranslocation. Within grains, DMA rapidly dispersed while MMA and inorganic As remained close to the entry point. Germanic acid addition did not affect grain As in arsenite-treated panicles. Three-dimensional SXRF microtomography gave further information on arsenite localization in the ovular vascular trace (OVT) of rice grains. These results demonstrate that inorganic As is poorly remobilized, while organic species are readily remobilized, from leaves to grain. Stem translocation of inorganic As may not rely solely on silicic acid transporters.
Phloem transport of arsenic species from flag leaf to grain during grain filling
Energy Technology Data Exchange (ETDEWEB)
Carey, Anne-Marie; Norton, Gareth J.; Deacon, Claire; Scheckel, Kirk G.; Lombi, Enzo; Punshon, Tracy; Guerinot, Mary Lou; Lanzirotti, Antonio; Newville, Matt; Choi, Yongseong; Price, Adam H.; Meharg, Andrew A. (EPA); (U. South Australia); (Aberdeen); (UC); (Dartmouth)
2011-09-20
Strategies to reduce arsenic (As) in rice grain, below concentrations that represent a serious human health concern, require that the mechanisms of As accumulation within grain be established. Therefore, retranslocation of As species from flag leaves into filling rice grain was investigated. Arsenic species were delivered through cut flag leaves during grain fill. Spatial unloading within grains was investigated using synchrotron X-ray fluorescence (SXRF) microtomography. Additionally, the effect of germanic acid (a silicic acid analog) on grain As accumulation in arsenite-treated panicles was examined. Dimethylarsinic acid (DMA) and monomethylarsonic acid (MMA) were extremely efficiently retranslocated from flag leaves to rice grain; arsenate was poorly retranslocated, and was rapidly reduced to arsenite within flag leaves; arsenite displayed no retranslocation. Within grains, DMA rapidly dispersed while MMA and inorganic As remained close to the entry point. Germanic acid addition did not affect grain As in arsenite-treated panicles. Three-dimensional SXRF microtomography gave further information on arsenite localization in the ovular vascular trace (OVT) of rice grains. These results demonstrate that inorganic As is poorly remobilized, while organic species are readily remobilized, from leaves to grain. Stem translocation of inorganic As may not rely solely on silicic acid transporters.
Ionizing radiation for insect control in grain and grain products
International Nuclear Information System (INIS)
Tilton, E.W.; Brower, J.H.
1987-01-01
A technical review summarizes and discusses information on various aspects of the use of ionizing radiation for the control of insect infestation in grains and grain products. Topics include: the effects of ionizing radiation on insects infesting stored-grain products; the 2 main types of irradiators (electron accelerators; radioisotopes (e.g.: Co-60; Cs-137); dosimetry systems and methodology; variations in radiation resistance by stored-product pests; the proper selection of radiation dose; the effects of combining various treatments (temperature, infrared/microwave radiation, hypoxia, chemicals) with ionizing radiation; sublethal radiation for controlling bulk grain insects; the feeding capacity of irradiated insects; the susceptibility of insecticide-resistant insects to ionizing radiation; and the possible resistance of insects to ionizing radiation. Practical aspects of removing insects from irradiated grain also are discussed
International Nuclear Information System (INIS)
Zhang, Yang; Tucker, Garritt J.; Trelewicz, Jason R.
2017-01-01
The mechanisms of stress-assisted grain growth are explored using molecular dynamics simulations of nanoindentation in nanocrystalline Ni and Ni-1 at.% P as a function of grain size and deformation temperature. Grain coalescence is primarily confined to the high stress region beneath the simulated indentation zone in nanocrystalline Ni with a grain size of 3 nm. Grain orientation and atomic displacement vector mapping demonstrates that coalescence transpires through grain rotation and grain boundary migration, which are manifested in the grain interior and grain boundary components of the average microrotation. A doubling of the grain size to 6 nm and addition of 1 at.% P eliminates stress-assisted grain growth in Ni. In the absence of grain coalescence, deformation is accommodated by grain boundary-mediated dislocation plasticity and thermally activated in pure nanocrystalline Ni. By adding solute to the grain boundaries, the temperature-dependent deformation behavior observed in both the lattice and grain boundaries inverts, indicating that the individual processes of dislocation and grain boundary plasticity will exhibit different activity based on boundary chemistry and deformation temperature.
Hormonal changes in the grains of rice subjected to water stress during grain filling.
Yang, J; Zhang, J; Wang, Z; Zhu, Q; Wang, W
2001-09-01
Lodging-resistant rice (Oryza sativa) cultivars usually show slow grain filling when nitrogen is applied in large amounts. This study investigated the possibility that a hormonal change may mediate the effect of water deficit that enhances whole plant senescence and speeds up grain filling. Two rice cultivars showing high lodging resistance and slow grain filling were field grown and applied with either normal or high amount nitrogen (HN) at heading. Well-watered and water-stressed (WS) treatments were imposed 9 days post anthesis to maturity. Results showed that WS increased partitioning of fixed (14)CO(2) into grains, accelerated the grain filling rate but shortened the grain filling period, whereas the HN did the opposite way. Cytokinin (zeatin + zeatin riboside) and indole-3-acetic acid contents in the grains transiently increased at early filling stage and WS treatments hastened their declines at the late grain filling stage. Gibberellins (GAs; GA(1) + GA(4)) in the grains were also high at early grain filling but HN enhanced, whereas WS substantially reduced, its accumulation. Opposite to GAs, abscisic acid (ABA) in the grains was low at early grain filling but WS remarkably enhanced its accumulation. The peak values of ABA were significantly correlated with the maximum grain filling rates (r = 0.92**, P water stress during grain filling, especially a decrease in GAs and an increase in ABA, enhances the remobilization of prestored carbon to the grains and accelerates the grain filling rate.
Grain dynamics and inter-grain coupling in dusty plasma Coulomb crystals
International Nuclear Information System (INIS)
Rahman, H.U.; Mohideen, U.; Smith, M.A.; Rosenberg, M.; Mendis, D.A.
2001-01-01
We review our results on the lattice structure and the lattice dynamics of dusty plasma Coulomb crystals formed in rectangular conductive grooves. The basic structure appears to be made of mutually repulsive columns of grains confined by the walls of the groove. The columns are oriented along the direction of the electrode sheath electric field. Inter-grain coupling as a function of plasma temperature and density were investigated by measurement of these parameters. A simple phenomenological model wherein the inter-grain spacing along the column results from an attractive electric field induced dipole-dipole force balanced by a repulsive monopole Coulomb force is consistent with observed features of the Coulomb crystal. In addition, here we present some preliminary measurements of the vibration and rotation dynamics of the individual grains in the Coulomb crystal. The thermal energy of the dust grain thus calculated is much less than the inter-grain Coulomb potential energy as required for the formation of stable structures. Also the observed rotational frequency is consistent with the assumption of thermal equilibrium between the dust grains and the neutral gas. (orig.)
Directory of Open Access Journals (Sweden)
Tomislav Pogačić
2013-03-01
Full Text Available Kefir grains represent the unique microbial community consisting of bacteria, yeasts, and sometimes filamentous moulds creating complex symbiotic community. The complexity of their physical and microbial structures is the reason that the kefir grains are still not unequivocally elucidated. Microbiota of kefir grains has been studied by many microbiological and molecular approaches. The development of metagenomics, based on the identification without cultivation, is opening new possibilities for identification of previously nonisolated and non-identified microbial species from the kefir grains. Considering recent studies, there are over 50 microbial species associated with kefir grains. The aim of this review is to summarise the microbiota composition of kefir grains. Moreover, because of technological and microbiological significance of the kefir grains, the paper provides an insight into the microbiological and molecular methods applied to study microbial biodiversity of kefir grains.
Messenger, S.; Walker, R. M.
2012-01-01
Interplanetary dust particles (IDPs) collected in the Earth s stratosphere contain high abundances of submicrometer amorphous silicates known as GEMS grains. From their birth as condensates in the outflows of oxygen-rich evolved stars, processing in interstellar space, and incorporation into disks around new stars, amorphous silicates predominate in most astrophysical environments. Amorphous silicates were a major building block of our Solar System and are prominent in infrared spectra of comets. Anhydrous interplanetary dust particles (IDPs) thought to derive from comets contain abundant amorphous silicates known as GEMS (glass with embedded metal and sulfides) grains. GEMS grains have been proposed to be isotopically and chemically homogenized interstellar amorphous silicate dust. We evaluated this hypothesis through coordinated chemical and isotopic analyses of GEMS grains in a suite of IDPs to constrain their origins. GEMS grains show order of magnitude variations in Mg, Fe, Ca, and S abundances. GEMS grains do not match the average element abundances inferred for ISM dust containing on average, too little Mg, Fe, and Ca, and too much S. GEMS grains have complementary compositions to the crystalline components in IDPs suggesting that they formed from the same reservoir. We did not observe any unequivocal microstructural or chemical evidence that GEMS grains experienced prolonged exposure to radiation. We identified four GEMS grains having O isotopic compositions that point to origins in red giant branch or asymptotic giant branch stars and supernovae. Based on their O isotopic compositions, we estimate that 1-6% of GEMS grains are surviving circumstellar grains. The remaining 94-99% of GEMS grains have O isotopic compositions that are indistinguishable from terrestrial materials and carbonaceous chondrites. These isotopically solar GEMS grains either formed in the Solar System or were completely homogenized in the interstellar medium (ISM). However, the
The effects of irradiation on grain coat color and grain texture in winter wheat
International Nuclear Information System (INIS)
Miao Bingliang; Liu Xueyu
1989-01-01
Dry seeds of the variety ''Yangmai 5'' with red grain coat, semihard grain texture, and the variety ''Ningmai 3'' with red grain coat, soft grain texture were irradiated with Y-rays at various doses.The effect on M1 grain coat color was different between two varieties, the higher doses made grain coat color of ''Yangmai 5'' redder, but had hardly effect on ''Ningmai 3''.The effect on M1 grain texture showed that the grain texture became softer with doses increased.It was found that there were 0.6% of positive ( red to white ) grain coat color mutants and 2.0% of negative(hard to soft) grain texture mutants in M2 of ''Yangmai 5'', and there were 0.7% of negative ( white to red ) grain coat color mutants and 3.6% of positive ( soft to hard ) grain texture mutants in M2 of ''Ningmai 3''. It seemed that the positive mutants selected in M3 were stable in M4. The results showed that γ-rays can be used to improve the grain coat color andgrain texture of wheat varieties
DEFF Research Database (Denmark)
Clausen, Signe Sandbech
PT proteins were expressed in cells where direct PTs are believed to perform their function, as well as in the vascular tissue. In NM plants, BdPT4 was localized to the plasma membrane whereas BdPT8 accumulated in the endoplasmic reticulum (ER) in the secretory pathway. A similar expression pattern...... was observed in non-arbusculated cells of AM plants. In arbusculated cells, BdPT8 was detected in the ER while BdPT4 was localized to the plasma membrane and the periarbuscular membrane (PAM) surrounding the arbuscular trunk and thick branches, which further supported a role of both BdPTs in direct Pi uptake......Phosphorus (P) is an essential plant nutrient in agricultural production but the P rock reserves used for production of fertilizers are currently being depleted. One approach to reduce the demand on P fertilizers is to optimize the phosphate (Pi) uptake and utilization efficiency of crop plants...
Grain boundary and grain interior conduction in γ'-Bi2MoO6
International Nuclear Information System (INIS)
Vera, C.M.C.; Aragon, R.
2005-01-01
Impedance spectroscopy of fine grained ( 2 MoO 6 samples, in the frequency range of 0.1 Hz-250 kHz, relevant to sensor applications, up to 800 deg. C, has been used to characterize grain boundary and grain interior contributions to conduction. Above 500 deg. C, the grain boundary contribution is no longer rate limiting and conduction is dominated by the grain interior component. The corresponding activation energies are 0.98 eV for grain boundary and 0.73 eV for grain interior components. The weak dependence of conductivity on oxygen partial pressure below 500 deg. C can be attributed to electrode-electrolyte interface phenomena, whereas the robust response to ethanol is commensurate with changes in intrinsic ionic conductivity
Grain Entrapment Pressure on the Torso: Can You Breathe while Buried in Grain?
Moore, Kevin G; Jones, Carol L
2017-04-26
The pressure applied to the chest and back of a simulated grain entrapment victim was measured. Pressure sensors were attached to the chest and back of a manikin that was buried in grain in the vertical position. Measurements were made in four grain types at four grain depths ranging from the top of the manikin's shoulders to 0.61 m (24 in.) over the head. The pressure ranged from 1.6 to 4.0 kPa (0.23 to 0.57 psi). Based on available physiological information, this amount of pressure is unlikely to limit the respiration of an otherwise healthy adult male victim. However, other factors, such as the victim's age, gender, and body position in the grain, may influence respiration. The aspiration of grain appears to be the most likely asphyxiation risk during grain bin entrapment. Entering a grain storage bin is inherently dangerous, and Occupational Safety and Health Administration (OSHA) guidelines for permit-required confined spaces and grain handling facilities must be followed. Due to the risk of grain aspiration during engulfment, the development of safety equipment that could help protect the airway of a victim should be investigated. Copyright© by the American Society of Agricultural Engineers.
Harris, Troy G.; Minor, John
This text for a secondary- or postecondary-level course in grain handling and storage contains ten chapters. Chapter titles are (1) Introduction to Grain Handling and Storage, (2) Elevator Safety, (3) Grain Grading and Seed Identification, (4) Moisture Control, (5) Insect and Rodent Control, (6) Grain Inventory Control, (7) Elevator Maintenance,…
Rendleman, Matt; Legacy, James
This publication provides an introduction to grain grading and handling for adult students in vocational and technical education programs. Organized in five chapters, the booklet provides a brief overview of the jobs performed at a grain elevator and of the techniques used to grade grain. The first chapter introduces the grain industry and…
Concurrent grain boundary motion and grain rotation under an applied stress
International Nuclear Information System (INIS)
Gorkaya, Tatiana; Molodov, Konstantin D.; Molodov, Dmitri A.; Gottstein, Guenter
2011-01-01
Simultaneous shear coupling and grain rotation were observed experimentally during grain boundary migration in high-purity Al bicrystals subjected to an external mechanical stress at elevated temperatures. This behavior is interpreted in terms of the structure of the investigated planar 18.2 o non-tilt grain boundary with a 20 o twist component. For characterization of the grain rotation after annealing under stress the bicrystal surface topography across the boundary was measured by atomic force microscopy. The temperature dependence of the boundary migration rate was measured and the migration activation energy determined.
Methods of assessing grain-size distribution during grain growth
DEFF Research Database (Denmark)
Tweed, Cherry J.; Hansen, Niels; Ralph, Brian
1985-01-01
This paper considers methods of obtaining grain-size distributions and ways of describing them. In order to collect statistically useful amounts of data, an automatic image analyzer is used, and the resulting data are subjected to a series of tests that evaluate the differences between two related...... distributions (before and after grain growth). The distributions are measured from two-dimensional sections, and both the data and the corresponding true three-dimensional grain-size distributions (obtained by stereological analysis) are collected. The techniques described here are illustrated by reference...
Grain boundary structure and properties
International Nuclear Information System (INIS)
Balluffi, R.W.
1979-01-01
An attempt is made to distinguish those fundamental aspects of grain boundaries which should be relevant to the problem of the time dependent fracture of high temperature structural materials. These include the basic phenomena which are thought to be associated with cavitation and cracking at grain boundaries during service and with the more general microstructural changes which occur during both processing and service. A very brief discussion of the current state of our knowledge of these fundamentals is given. Included are the following: (1) structure of ideal perfect boundaries; (2) defect structure of grain boundaries; (3) diffusion at grain boundaries; (4) grain boundaries as sources/sinks for point defects; (5) grain boundary migration; (6) dislocation phenomena at grain boundaries; (7) atomic bonding and cohesion at grain boundaries; (8) non-equilibrium properties of grain boundaries; and (9) techniques for studying grain boundaries
Directory of Open Access Journals (Sweden)
Furong Liu
Full Text Available Small GTP-binding proteins function as regulators of specific intercellular fundamental biological processes. In this study, a small GTP-binding protein Rab7 gene, designated as TaRab7, was identified and characterized from a cDNA library of wheat leaves infected with Puccinia striiformis f. sp. tritici (Pst the wheat stripe rust pathogen. The gene was predicted to encode a protein of 206 amino acids, with a molecular mass of 23.13 KDa and an isoeletric point (pI of 5.13. Further analysis revealed the presence of a conserved signature that is characteristic of Rab7, and phylogenetic analysis demonstrated that TaRab7 has the highest similarity to a small GTP binding protein gene (BdRab7-like from Brachypodium distachyon. Quantitative real-time PCR assays revealed that the expression of TaRab7 was higher in the early stage of the incompatible interactions between wheat and Pst than in the compatible interaction, and the transcription level of TaRab7 was also highly induced by environmental stress stimuli. Furthermore, knocking down TaRab7 expression by virus induced gene silencing enhanced the susceptibility of wheat cv. Suwon 11 to an avirulent race CYR23. These results imply that TaRab7 plays an important role in the early stage of wheat-stripe rust fungus interaction and in stress tolerance.
The 'PhenoBox', a flexible, automated, open-source plant phenotyping solution.
Czedik-Eysenberg, Angelika; Seitner, Sebastian; Güldener, Ulrich; Koemeda, Stefanie; Jez, Jakub; Colombini, Martin; Djamei, Armin
2018-04-05
There is a need for flexible and affordable plant phenotyping solutions for basic research and plant breeding. We demonstrate our open source plant imaging and processing solution ('PhenoBox'/'PhenoPipe') and provide construction plans, source code and documentation to rebuild the system. Use of the PhenoBox is exemplified by studying infection of the model grass Brachypodium distachyon by the head smut fungus Ustilago bromivora, comparing phenotypic responses of maize to infection with a solopathogenic Ustilago maydis (corn smut) strain and effector deletion strains, and studying salt stress response in Nicotiana benthamiana. In U. bromivora-infected grass, phenotypic differences between infected and uninfected plants were detectable weeks before qualitative head smut symptoms. Based on this, we could predict the infection outcome for individual plants with high accuracy. Using a PhenoPipe module for calculation of multi-dimensional distances from phenotyping data, we observe a time after infection-dependent impact of U. maydis effector deletion strains on phenotypic response in maize. The PhenoBox/PhenoPipe system is able to detect established salt stress responses in N. benthamiana. We have developed an affordable, automated, open source imaging and data processing solution that can be adapted to various phenotyping applications in plant biology and beyond. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
Energy Technology Data Exchange (ETDEWEB)
Hoyle, F.; Wickramasinghe, N.C.
1980-11-01
Interstellar extinction of starlight was observed and plotted as a function of inverse wavelength. Agreement with the calculated effects of the particle distribution is shown. The main kinds of grain distinguished are: (1) graphite spheres of radius 0.02 microns, making up 10% of the total grain mass (2) small dielectric spheres of radius 0.04 microns making up 25% and (3) hollow dielectric cylinders containing metallic iron, with diameters of 2/3 microns making up 45%. The remaining 20% consists of other metals, metal oxides, and polysiloxanes. Absorption factor evidence suggests that the main dielectric component of the grains is organic material.
Reproductive performance of reindeer fed all-grain and hay-grain rations
Directory of Open Access Journals (Sweden)
J. M. Blanchard
1986-06-01
Full Text Available Reproductive performance of grain-fed reindeer {Rangifer tarandus was evaluated over a 2-year period. Groups of pregnant reindeer were fed one of three rations, (1 100% whole-grain barley, (2 98.9% whole-grain barley and 1.2% mineral and trace element supplement, and (3 70% whole-grain barley and 30% finely-chopped bluegrass hay. Reindeer fed unsupplemented whole-barley failed to produce a single live calf. The addition of mineral and trace element supplement to the ration did not result in any significant improvement in reproductive performance. Eighty-five percent of the reindeer consuming unsupplemented and supplemented all-barley rations became pregnant; however, 76% of the pregnancies resulted in stillborn calves. One-hundred percent of the cows maintained on the grain/hay ration produced live calves. We speculate that reproductive failure in reindeer cows maintained on all-grain rations is most likely a result of a diet induced disfunction in maternal rumen and/or carbohydrate metabolism rather than a micro-nutrient deficiency. More research is neeeded to determine which metabolic pathways are affected.
Why do interstellar grains exist
International Nuclear Information System (INIS)
Seab, C.G.; Hollenbach, D.J.; Mckee, C.F.; Tielens, A.G.G.M.
1986-01-01
There exists a discrepancy between calculated destruction rates of grains in the interstellar medium and postulated sources of new grains. This problem was examined by modelling the global life cycle of grains in the galaxy. The model includes: grain destruction due to supernovae shock waves; grain injection from cool stars, planetary nebulae, star formation, novae, and supernovae; grain growth by accretion in dark clouds; and a mixing scheme between phases of the interstellar medium. Grain growth in molecular clouds is considered as a mechanism or increasing the formation rate. To decrease the shock destruction rate, several new physical processes, such as partial vaporization effects in grain-grain collisions, breakdown of the small Larmor radius approximation for betatron acceleration, and relaxation of the steady-state shock assumption are included
International Nuclear Information System (INIS)
Bai, Qin; Zhao, Qing; Xia, Shuang; Wang, Baoshun; Zhou, Bangxin; Su, Cheng
2017-01-01
Grain boundary engineering (GBE) of nickel-based alloy 825 tubes was carried out with different cold drawing deformations by using a draw-bench on a factory production line and subsequent annealing at various temperatures. The microstructure evolution of alloy 825 during thermal-mechanical processing (TMP) was characterized by means of the electron backscatter diffraction (EBSD) technique to study the TMP effects on the grain boundary network and the evolution of grain boundary character distributions during high temperature annealing. The results showed that the proportion of ∑ 3 n coincidence site lattice (CSL) boundaries of alloy 825 tubes could be increased to > 75% by the TMP of 5% cold drawing and subsequent annealing at 1050 °C for 10 min. The microstructures of the partially recrystallized samples and the fully recrystallized samples suggested that the proportion of low ∑ CSL grain boundaries depended on the annealing time. The frequency of low ∑ CSL grain boundaries increases rapidly with increasing annealing time associating with the formation of large-size highly-twinned grains-cluster microstructure during recrystallization. However, upon further increasing annealing time, the frequency of low ∑ CSL grain boundaries decreased markedly during grain growth. So it is concluded that grain boundary engineering is achieved through recrystallization rather than grain growth. - Highlights: •The grain boundary engineering (GBE) is applicable to 825 tubes. •GBE is achieved through recrystallization rather than grain growth. •The low ∑ CSL grain boundaries in 825 tubes can be increased to > 75%.
Pushing the boundaries of resistance: insights from Brachypodium-rust interactions
Figueroa, Melania; Castell-Miller, Claudia V.; Li, Feng; Hulbert, Scot H.; Bradeen, James M.
2015-01-01
The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat, and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with i...
A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice.
Hu, Jiang; Wang, Yuexing; Fang, Yunxia; Zeng, Longjun; Xu, Jie; Yu, Haiping; Shi, Zhenyuan; Pan, Jiangjie; Zhang, Dong; Kang, Shujing; Zhu, Li; Dong, Guojun; Guo, Longbiao; Zeng, Dali; Zhang, Guangheng; Xie, Lihong; Xiong, Guosheng; Li, Jiayang; Qian, Qian
2015-10-05
Grain size determines grain weight and affects grain quality. Several major quantitative trait loci (QTLs) regulating grain size have been cloned; however, our understanding of the underlying mechanism that regulates the size of rice grains remains fragmentary. Here, we report the cloning and characterization of a dominant QTL, grain size on chromosome 2 (GS2), which encodes Growth-Regulating Factor 4 (OsGRF4), a transcriptional regulator. GS2 localizes to the nucleus and may act as a transcription activator. A rare mutation of GS2 affecting the binding site of a microRNA, OsmiR396c, causes elevated expression of GS2/OsGRF4. The increase in GS2 expression leads to larger cells and increased numbers of cells, which thus enhances grain weight and yield. The introduction of this rare allele of GS2/OsGRF4 into rice cultivars could significantly enhance grain weight and increase grain yield, with possible applications in breeding high-yield rice varieties. Copyright © 2015 The Author. Published by Elsevier Inc. All rights reserved.
Effects of grain size and grain boundaries on defect production in nanocrystalline 3C-SiC
International Nuclear Information System (INIS)
Swaminathan, N.; Kamenski, Paul J.; Morgan, Dane; Szlufarska, Izabela
2010-01-01
Cascade simulations in single crystal and nanocrystalline SiC have been conducted in order to determine the role of grain boundaries and grain size on defect production during primary radiation damage. Cascades are performed with 4 and 10 keV silicon as the primary knock-on atom (PKA). Total defect production is found to increase with decreasing grain size, and this effect is shown to be due to increased production in grain boundaries and changing grain boundary volume fraction. In order to consider in-grain defect production, a new mapping methodology is developed to properly normalize in-grain defect production rates for nanocrystalline materials. It is shown that the presence of grain boundaries does not affect the total normalized in-grain defect production significantly (the changes are lower than ∼20%) for the PKA energies considered. Defect production in the single grain containing the PKA is also studied and found to increase for smaller grain sizes. In particular, for smaller grain sizes the defect production decreases with increasing distance from the grain boundary while for larger grain sizes the presence of the grain boundaries has negligible effect on defect production. The results suggest that experimentally observed changes in radiation resistance of nanocrystalline materials may be due to long-term damage evolution rather than changes in defect production rates from primary damage.
Chan-Yeung, M.; Ashley, M. J.; Grzybowski, S.
1978-01-01
Grain dust is composed of a large number of materials, including various types of grain and their disintegration products, silica, fungi, insects and mites. The clinical syndromes described in relation to exposure to grain dust are chronic bronchitis, grain dust asthma, extrinsic allergic alveolitis, grain fever and silo-filler's lung. Rhinitis and conjunctivitis are also common in grain workers. While the concentration and the quality of dust influence the frequency and the type of clinical syndrome in grain workers, host factors are also important. Of the latter, smoking is the most important factor influencing the frequency of chronic bronchitis. The role of atopy and of bronchial hyperreactivity in grain dust asthma has yet to be assessed. Several well designed studies are currently being carried out in North America not only to delineate the frequency of the respiratory abnormalities, the pathogenetic mechanisms and the host factors, but also to establish a meaningful threshold limit concentration for grain dust. Images p1272-a PMID:348288
Grain centre mapping - 3DXRD measurements of average grain characteristics
DEFF Research Database (Denmark)
Oddershede, Jette; Schmidt, Søren; Lyckegaard, Allan
2014-01-01
characteristics of each grain (such as their centre-of-mass positions, volumes, phases, orientations and/or elastic strain tensor components), while the exact locations of the grain boundaries are unknown. In the present chapter a detailed description of the setup and software for both grain centre mapping...... and the closely related boxscan method is given. Both validation experiments and applications for in situ studies of microstructural changes during plastic deformation and crack growth are given. Finally an outlook with special emphasis on coupling the measured results with modelling is given....
Grain Boundary Segregation in Metals
Lejcek, Pavel
2010-01-01
Grain boundaries are important structural components of polycrystalline materials used in the vast majority of technical applications. Because grain boundaries form a continuous network throughout such materials, their properties may limit their practical use. One of the serious phenomena which evoke these limitations is the grain boundary segregation of impurities. It results in the loss of grain boundary cohesion and consequently, in brittle fracture of the materials. The current book deals with fundamentals of grain boundary segregation in metallic materials and its relationship to the grain boundary structure, classification and other materials properties.
International Nuclear Information System (INIS)
Dimitrov, O.
1975-01-01
Well-established aspects of grain-boundary migration are first briefly reviewed (influences of driving force, temperature, orientation and foreign atoms). Recent developments of the experimental methods and results are then examined, by considering the various driving of resistive forces acting on grain boundaries. Finally, the evolution in the theoretical models of grain-boundary motion is described, on the one hand for ideally pure metals and, on the other hand, in the presence of solute impurity atoms [fr
Phloem Transport Of Arsenic Species From Flag Leaf To Grain During Grain Filling
Strategies to reduce arsenic (As) in rice grain, below concentrations that represent a serious human health concern, require that the mechanisms of As accumulation within grain be established. Therefore, retranslocation of As species from flag leaves into filling rice grain was ...
Grain boundary motion and grain rotation in aluminum bicrystals: recent experiments and simulations
International Nuclear Information System (INIS)
Molodov, D A; Barrales-Mora, L A; Brandenburg, J-E
2015-01-01
The results of experimental and computational efforts over recent years to study the motion of geometrically different grain boundaries and grain rotation under various driving forces are briefly reviewed. Novel in-situ measuring techniques based on orientation contrast imaging and applied simulation techniques are described. The experimental results obtained on specially grown aluminum bicrystals are presented and discussed. Particularly, the faceting and migration behavior of low angle grain boundaries under the curvature force is addressed. In contrast to the pure tilt boundaries, which remained flat/faceted and immobile during annealing at elevated temperatures, mixed tilt-twist boundaries readily assumed a curved shape and steadily moved under the capillary force. Computational analysis revealed that this behavior is due to the inclinational anisotropy of grain boundary energy, which in turn depends on boundary geometry. The shape evolution and shrinkage kinetics of cylindrical grains with different tilt and mixed boundaries were studied by molecular dynamics simulations. The mobility of low angle <100> boundaries with misorientation angles higher than 10°, obtained by both the experiments and simulations, was found not to differ from that of the high angle boundaries, but decreases essentially with further decrease of misorientation. The shape evolution of the embedded grains in simulations was found to relate directly to results of the energy computations. Further simulation results revealed that the shrinkage of grains with pure tilt boundaries is accompanied by grain rotation. In contrast, grains with the tilt-twist boundaries composed of dislocations with the mixed edge-screw character do not rotate during their shrinkage. Stress driven boundary migration in aluminium bicrystals was observed to be coupled to a tangential translation of the grains. The activation enthalpy of high angle boundary migration was found to vary non-monotonically with
2010-12-08
... DEPARTMENT OF AGRICULTURE Grain Inspection, Packers and Stockyards Administration 7 CFR Part 802 [Docket GIPSA-2010-FGIS-0012] RIN 0580-AB19 Official Performance and Procedural Requirements for Grain Weighing Equipment and Related Grain Handling Systems AGENCY: Grain Inspection, Packers and Stockyards...
2013-06-04
... 1625-AA00 Safety Zone; Grain-Shipment and Grain-Shipment Assist Vessels, Columbia and Willamette Rivers... Guard is establishing a temporary safety zone around all inbound and outbound grain-shipment and grain-shipment assist vessels involved in commerce with the Columbia Grain facility on the Willamette River in...
2013-09-18
... 1625-AA00 Safety Zone; Grain-Shipment and Grain-Shipment Assist Vessels, Columbia and Willamette Rivers... temporary safety zone around all inbound and outbound grain-shipment and grain-shipment assist vessels involved in commerce with the Columbia Grain facility on the Willamette River in Portland, OR, the United...
Grain destruction in interstellar shocks
International Nuclear Information System (INIS)
Seab, C.G.; Shull, J.M.
1984-01-01
One of the principal methods for removing grains from the Interstellar Medium is to destroy them in shock waves. Previous theoretical studies of shock destruction have generally assumed only a single size and type of grain; most do not account for the effect of the grain destruction on the structure of the shock. Earlier calculations have been improved in three ways: first, by using a ''complete'' grain model including a distribution of sizes and types of grains; second, by using a self-consistent shock structure that incorporates the changing elemental depletions as the grains are destroyed; and third, by calculating the shock-processed ultraviolet extinction curves for comparison with observations. (author)
Ni, Yingli; Zheng, Mengjing; Yang, Dongqing; Jin, Min; Chen, Jin; Wang, Zhenlin; Yin, Yanping
2016-01-01
In winter wheat, grain development is asynchronous. The grain number and grain weight vary significantly at different spikelet and grain positions among wheat cultivars grown at different plant densities. In this study, two winter wheat (Triticum aestivum L.) cultivars, ‘Wennong6’ and ‘Jimai20’, were grown under four different plant densities for two seasons, in order to study the effect of plant density on the grain number and grain weight at different spikelet and grain positions. The results showed that the effects of spikelet and grain positions on grain weight varied with the grain number of spikelets. In both cultivars, the single-grain weight of the basal and middle two-grain spikelets was higher at the 2nd grain position than that at the 1st grain position, while the opposite occurred in the top two-grain spikelets. In the three-grain spikelets, the distribution of the single-grain weight was different between cultivars. In the four-grain spikelets of Wennong6, the single-grain weight was the highest at the 2nd grain position, followed by the 1st, 3rd, and 4th grain positions. Regardless of the spikelet and grain positions, the single-grain weight was the highest at the 1st and 2nd grain positions and the lowest at the 3rd and 4th grain positions. Overall, plant density affected the yield by controlling the seed-setting characteristics of the tiller spike. Therefore, wheat yield can be increased by decreasing the sterile basal and top spikelets and enhancing the grain weight at the 3rd and 4th grain positions, while maintaining it at the 1st and 2nd grain positions on the spikelet. PMID:27171343
Modelling of grain refinement driven by negative grain boundary energy
Czech Academy of Sciences Publication Activity Database
Fischer, F. D.; Zickler, G. A.; Svoboda, Jiří
2017-01-01
Roč. 97, č. 23 (2017), s. 1963-1977 ISSN 1478-6435 R&D Projects: GA ČR(CZ) GA15-06390S Institutional support: RVO:68081723 Keywords : grain refinement * grain nucleation * distribution concept * jump on distribution function Subject RIV: BJ - Thermodynamics OBOR OECD: Thermodynamics Impact factor: 1.505, year: 2016
Grain Interactions in Crystal Plasticity
International Nuclear Information System (INIS)
Boyle, K.P.; Curtin, W.A.
2005-01-01
The plastic response of a sheet metal is governed by the collective response of the underlying grains. Intragranular plasticity depends on intrinsic variables such as crystallographic orientation and on extrinsic variables such as grain interactions; however, the role of the latter is not well understood. A finite element crystal plasticity formulation is used to investigate the importance of grain interactions on intragranular plastic deformation in initially untextured polycrystalline aggregates. A statistical analysis reveals that grain interactions are of equal (or more) importance for determining the average intragranular deviations from the applied strain as compared to the orientation of the grain itself. Furthermore, the influence of the surrounding grains is found to extend past nearest neighbor interactions. It is concluded that the stochastic nature of the mesoscale environment must be considered for a proper understanding of the plastic response of sheet metals at the grain-scale
Stabilisation of the grain market by the flexible use of grain for bioethanol
Helming, J.F.M.; Pronk, A.; Woltjer, I.
2010-01-01
This report reviews whether the grain market and grain price can be stabilised by the variation of the use of grain in the EU-27's production of bioethanol. The time horizon of this study is 2020, whereby account is taken of the minimum 10% obligation for biofuel use in the EU-27. An economic
Inter-grain coupling and grain charge in dusty plasma Coulomb crystals
International Nuclear Information System (INIS)
Smith, M. A.; Goodrich, J.; Mohideen, U.; Rahman, H. U.; Rosenberg, M.; Mendis, D. A.
1998-01-01
We have studied the lattice structure and grain charge of dusty plasma Coulomb crystals formed in rectangular conductive grooves as a function of plasma temperature and density. The crystal appears to be made of mutually repulsive columns of grains confined by the walls of the groove. The columns are oriented along the direction of the electrode sheath electric field. A simple phenomenological model wherein the inter-grain spacing results from an attractive electric field induced dipole-dipole force balanced by a repulsive monopole Coulomb force is consistent with observed features of the Coulomb crystal
Gurses, Ercan
2011-12-01
In this work, a viscoplastic constitutive model for nanocrystalline metals is presented. The model is based on competing grain boundary and grain interior deformation mechanisms. In particular, inelastic deformations caused by grain boundary diffusion, grain boundary sliding and dislocation activities are considered. Effects of pressure on the grain boundary diffusion and sliding mechanisms are taken into account. Furthermore, the influence of grain size distribution on macroscopic response is studied. The model is shown to capture the fundamental mechanical characteristics of nanocrystalline metals. These include grain size dependence of the strength, i.e., both the traditional and the inverse Hall-Petch effects, the tension-compression asymmetry and the enhanced rate sensitivity. © 2011 Elsevier B.V. All rights reserved.
DEVELOPMENT OF GRAIN MARKET IN UKRAINE
Directory of Open Access Journals (Sweden)
Aleksandr Maslak
2015-11-01
Full Text Available The subject of the research is a set of theoretical, methodological and practical fundamentals of organizational and economic functioning are integrated agricultural formations in the grain market of Ukraine. The methodological basis of research is the complex analysis of economic processes in the grain market in Ukraine and the world. During research we used such methods as method of systematization and comparison, statistic, economic, balance, constructive, target-oriented, and the methods of induction and deduction, analogy and comparison. Main aim of this article is the analysis of the situation on the grain market in Ukraine, defining the role of integrated agricultural formations in this market, improving the organizational-economic mechanism of its functioning, identifies ways of improving the competitiveness of Ukraine among world exporters of grain. Using results of the studies we examined trends grain market in Ukraine; influence of businesses in grain production; analysis of constraints to improve production efficiency of grain; defined domestic (internal needs of grain in Ukraine; assessed the status and expediency transformation infrastructure of the grain market of Ukraine; defined priority directions of development of the grain market in Ukraine. As a result of the preparation of articles, it is obtained the following conclusions: Ukraine is the world's largest producers and exporters of grain, the production of integrated agricultural units to a third of the total grain; technical condition of farm does not meet the needs of production; the domestic market is unable to provide the existing demand for grain production, contributing to export growth; Ukraine has a number of problems due to increased grain production, namely the shortage of storage capacity for the storage of grain, limited performance transshipment of grain in port elevators and imperfection and depreciation of transport systems; solving the existing problems is
Photoelectric charging of dust grains
International Nuclear Information System (INIS)
Ignatov, A. M.
2009-01-01
Photoemission from the surface of a dust grain in vacuum is considered. It is shown that the cutoff in the energy spectrum of emitted electrons leads to the formation of a steady-state electron cloud. The equation describing the distribution of the electric potential in the vicinity of a dust grain is solved numerically. The dust grain charge is found as a function of the grain size.
McSaveney, M. J.
2015-12-01
The transport mechanism of rapid long-runout rock avalanches was a hotly debated topic when I came on the scene in 1967. So how come it is still debated today? My explanation is that it is the expected outcome of peer review, poor comprehension, and technological advances outpacing intellectual advances. Why think about the problem when we can model it! So let us think about the problem. Shreve thought that rock avalanches fell upon and trapped a layer of air. What physics was he thinking about? It is how feathers and tissue papers fall. When my rock avalanches fly, they fly like unlubricated bricks using the physics of projectiles and ballistics. But the main transport mechanism is not flight. The dominant impression from watching a rock avalanche in motion is of fluid flow, as Heim described it in 1882. A rock avalanche is a very large grain flow. Bagnold studied dispersive grain flows, but why should one assume that rock avalanches are dispersive grain flows as many do. The more common grain flow type is a dense grain flow and rock avalanches are dense grain flows in which the weight can and does generate very high stresses at grain contacts. Brittle rock deforms elastically up to its compressive strength, whereupon it breaks, releasing elastic strain as transient elastic strain (seismic energy to a seismologist, acoustic energy to a physicist). Melosh and others have shown that acoustic energy can fluidize a grain mass. There is no exotic physics behind grain flow at high stress. When grains break, the released elastic strain has to go somewhere, and it goes somewhere principally by transmission though grain contacts. Depending on the state of stress at the grain contact, the contact will pass the stress or will slip at conventional values of Coulomb friction. Enough thinking! A physical model of the entire process is too big for any laboratory. So whose numerical model will do it?
Impact fracture experiments simulating interstellar grain-grain collisions
Freund, Friedemann; Chang, Sherwood; Dickinson, J. Thomas
1990-01-01
Oxide and silicate grains condensing during the early phases of the formation of the solar system or in the outflow of stars are exposed to high partial pressures of the low-z elements H, C, N and O and their simple gaseous compounds. Though refractory minerals are nominally anhydrous and non-carbonate, if they crystallize in the presence of H2O, N2 and CO or CO2 gases, they dissolve traces of the gaseous components. The question arises: How does the presence of dissolved gases or gas components manifest itself when grain-grain collisions occur. What are the gases emitted when grains are shattered during a collision event. Researchers report on fracture experiments in ultrahigh vacuum (UHV, approximately less than 10 to the -8th power mbar) designed to measure (by means of a quadrupole mass spectrometer, QMS, with microns to ms time resolution) the emission of gases and vapors during and after impact (up to 1.5 sec). Two terrestrial materials were chosen which represent structural and compositional extremes: olivine (San Carlos, AZ), a densely packed Mg-Fe(2+) silicate from the upper mantle, available as 6 to 12 mm single crystals, and obsidian (Oregon), a structurally open, alkaline-SiO2-rich volcanic glass. In the olivine crystals OH- groups have been identified spectroscopically, as well as H2 molecules. Obsidian is a water-rich glass containing OH- besides H2O molecules. Olivine from the mantle often contains CO2, either as CO2-rich fluid in fluid inclusions or structurally dissolved or both. By analogy to synthetic glasses CO2 in the obsidian may be present in form of CO2 molecules in voids of molecular dimensions, or as carbonate anions, CO3(2-). No organic molecules have been detected spectroscopically in either material. Results indicate that refractory oxide/silicates which contain dissolved traces of the H2O and CO/CO2 components but no spectroscopically detectable traces of organics may release complex H-C-O (possibly H-C-N-O) molecules upon fracture
Tomislav Pogačić; Sanja Šinko; Šimun Zamberlin; Dubravka Samaržija
2013-01-01
Kefir grains represent the unique microbial community consisting of bacteria, yeasts, and sometimes filamentous moulds creating complex symbiotic community. The complexity of their physical and microbial structures is the reason that the kefir grains are still not unequivocally elucidated. Microbiota of kefir grains has been studied by many microbiological and molecular approaches. The development of metagenomics, based on the identification without cultivation, is opening new possibilities f...
Misra, R D K; Nune, C; Pesacreta, T C; Somani, M C; Karjalainen, L P
2013-01-01
The rapid adsorption of proteins is the starting and primary biological response that occurs when a biomedical device is implanted in the physiological system. The biological response, however, depends on the surface characteristics of the device. Considering the significant interest in nano-/ultrafine surfaces and nanostructured coatings, we describe here, the interplay between grain structure and protein adsorption (bovine serum albumin: BSA) on osteoblasts functions by comparing nanograined/ultrafine-grained (NG/UFG) and coarse-grained (CG: grain size in the micrometer range) substrates by investigating cell-substrate interactions. The protein adsorption on NG/UFG surface was beneficial in favorably modulating biological functions including cell attachment, proliferation, and viability, whereas the effect was less pronounced on protein adsorbed CG surface. Additionally, immunofluorescence studies demonstrated stronger vinculin signals associated with actin stress fibers in the outer regions of the cells and cellular extensions on protein adsorbed NG/UFG surface. The functional response followed the sequence: NG/UFG(BSA) > NG/UFG > CG(BSA) > CG. The differences in the cellular response on bare and protein adsorbed NG/UFG and CG surfaces are attributed to cumulative contribution of grain structure and degree of hydrophilicity. The study underscores the potential advantages of protein adsorption on artificial biomedical devices to enhance the bioactivity and regulate biological functions. Copyright © 2012 Wiley Periodicals, Inc.
McMackin, Elaine; Dean, Moira; Woodside, Jayne V; McKinley, Michelle C
2013-04-01
To explore current awareness and perceptions of whole grain foods and perceived barriers and facilitators of whole grain consumption. Focus groups were conducted to investigate consumer attitudes to whole grains. Discussions were transcribed verbatim and analysed thematically. Discussions were held throughout Northern Ireland with adults who were at least partly responsible for food shopping. Seven focus groups were held (n 43; thirty-three females, ten males). All participants were aware of the term 'whole grain' and had a basic level of awareness of their health benefits. Prominent barriers and facilitators of whole grain intake were related to perceptions of the sensory properties (most dominant factor) of whole grains; knowledge of how to locate, identify and use whole grains; and awareness of the health benefits, perceived cost and family influences. Parents of young children appeared to be altruistically motivated with many stating they wanted to ensure their children consumed whole grains in order to establish good eating habits. Participants were generally aware of the term 'whole grain'; however, even against a background of increased availability and promotion of whole grain foods, many key barriers to whole grain consumption were still evident. Alongside general education efforts, opportunities and challenges exist for the food industry to develop novel, but affordable, food products that are able to deliver whole grains in a wide variety of forms, including whole grains 'in disguise' for those who are most resistant to change.
Grain boundary and grain interior conduction in {gamma}'-Bi{sub 2}MoO{sub 6}
Energy Technology Data Exchange (ETDEWEB)
Vera, C.M.C. [Laboratorio de Peliculas Delgadas, Facultad de Ingenieria, Universidad de Buenos Aires, Paseo Colon 850, 1063 Buenos Aires (Argentina)]. E-mail: cvera@fi.uba.ar; Aragon, R. [Laboratorio de Peliculas Delgadas, Facultad de Ingenieria, Universidad de Buenos Aires, Paseo Colon 850, 1063 Buenos Aires (Argentina); CINSO, CONICET, CITEFA, Lasalle 4397, Villa Martelli, Buenos Aires (Argentina)
2005-07-25
Impedance spectroscopy of fine grained (<10 {mu}m) {gamma}'-Bi{sub 2}MoO{sub 6} samples, in the frequency range of 0.1 Hz-250 kHz, relevant to sensor applications, up to 800 deg. C, has been used to characterize grain boundary and grain interior contributions to conduction. Above 500 deg. C, the grain boundary contribution is no longer rate limiting and conduction is dominated by the grain interior component. The corresponding activation energies are 0.98 eV for grain boundary and 0.73 eV for grain interior components. The weak dependence of conductivity on oxygen partial pressure below 500 deg. C can be attributed to electrode-electrolyte interface phenomena, whereas the robust response to ethanol is commensurate with changes in intrinsic ionic conductivity.
Energy Technology Data Exchange (ETDEWEB)
Hoang, Thiem [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, ON M5S 3H8 (Canada); Lazarian, A. [Department of Astronomy, University of Wisconsin-Madison (United States)
2016-11-10
The radiative torque (RAT) alignment of interstellar grains with ordinary paramagnetic susceptibilities has been supported by earlier studies. The alignment of such grains depends on the so-called RAT parameter q {sup max}, which is determined by the grain shape. In this paper, we elaborate on our model of RAT alignment for grains with enhanced magnetic susceptibility due to iron inclusions, such that RAT alignment is magnetically enhanced, which we term the MRAT mechanism. Such grains can be aligned with high angular momentum at the so-called high- J attractor points, achieving a high degree of alignment. Using our analytical model of RATs, we derive the critical value of the magnetic relaxation parameter δ {sub m} to produce high- J attractor points as functions of q {sup max} and the anisotropic radiation angle relative to the magnetic field ψ . We find that if about 10% of the total iron abundance present in silicate grains is forming iron clusters, this is sufficient to produce high- J attractor points for all reasonable values of q {sup max}. To calculate the degree of grain alignment, we carry out numerical simulations of MRAT alignment by including stochastic excitations from gas collisions and magnetic fluctuations. We show that large grains can achieve perfect alignment when the high- J attractor point is present, regardless of the values of q {sup max}. Our obtained results pave the way for the physical modeling of polarized thermal dust emission as well as magnetic dipole emission. We also find that millimeter-sized grains in accretion disks may be aligned with the magnetic field if they are incorporated with iron nanoparticles.
Selection of common bean lines with high grain yield and high grain calcium and iron concentrations
Directory of Open Access Journals (Sweden)
Nerinéia Dalfollo Ribeiro
2014-02-01
Full Text Available Genetic improvement of common bean nutritional quality has advantages in marketing and can contribute to society as a food source. The objective of this study was to evaluate the genetic variability for grain yield, calcium and iron concentrations in grains of inbred common bean lines obtained by different breeding methods. For this, 136 F7 inbred lines were obtained using the Pedigree method and 136 F7 inbred lines were obtained using the Single-Seed Descent (SSD method. The lines showed genetic variability for grain yield, and concentrations of calcium and iron independently of the method of advancing segregating populations. The Pedigree method allows obtaining a greater number of lines with high grain yield. Selection using the SSD method allows the identification of a larger number of lines with high concentrations of calcium and iron in grains. Weak negative correlations were found between grain yield and calcium concentration (r = -0.0994 and grain yield and iron concentration (r = -0.3926. Several lines show genetic superiority for grain yield and concentrations of calcium and iron in grains and their selection can result in new common bean cultivars with high nutritional quality.
Kansas Agents Study Grain Marketing
Schoeff, Robert W.
1973-01-01
Author is an extension specialist in feed and grain marketing for Kansas State University. He describes a tour set up to educate members of the Kansas Grain and Feed Dealers' Association in the area of grain marketing and exporting. (GB)
International Nuclear Information System (INIS)
Lou, C.
2002-01-01
An advection-diffusion model has been set up to describe normal grain growth. In this model grains are divided into different groups according to their topological classes (number of sides of a grain). Topological transformations are modelled by advective and diffusive flows governed by advective and diffusive coefficients respectively, which are assumed to be proportional to topological classes. The ordinary differential equations governing self-similar time-independent grain size distribution can be derived analytically from continuity equations. It is proved that the time-independent distributions obtained by solving the ordinary differential equations have the same form as the time-dependent distributions obtained by solving the continuity equations. The advection-diffusion model is extended to describe the stagnation of normal grain growth in thin films. Grain boundary grooving prevents grain boundaries from moving, and the correlation between neighbouring grains accelerates the stagnation of normal grain growth. After introducing grain boundary grooving and the correlation between neighbouring grains into the model, the grain size distribution is close to a lognormal distribution, which is usually found in experiments. A vertex computer simulation of normal grain growth has also been carried out to make a cross comparison with the advection-diffusion model. The result from the simulation did not verify the assumption that the advective and diffusive coefficients are proportional to topological classes. Instead, we have observed that topological transformations usually occur on certain topological classes. This suggests that the advection-diffusion model can be improved by making a more realistic assumption on topological transformations. (author)
Genetics and physiology of cell wall polysaccharides in the model C4 grass, Setaria viridis spp.
Ermawar, Riksfardini A; Collins, Helen M; Byrt, Caitlin S; Henderson, Marilyn; O'Donovan, Lisa A; Shirley, Neil J; Schwerdt, Julian G; Lahnstein, Jelle; Fincher, Geoffrey B; Burton, Rachel A
2015-10-02
Setaria viridis has emerged as a model species for the larger C4 grasses. Here the cellulose synthase (CesA) superfamily has been defined, with an emphasis on the amounts and distribution of (1,3;1,4)-β-glucan, a cell wall polysaccharide that is characteristic of the grasses and is of considerable value for human health. Orthologous relationship of the CesA and Poales-specific cellulose synthase-like (Csl) genes among Setaria italica (Si), Sorghum bicolor (Sb), Oryza sativa (Os), Brachypodium distachyon (Bradi) and Hordeum vulgare (Hv) were compared using bioinformatics analysis. Transcription profiling of Csl gene families, which are involved in (1,3;1,4)-β-glucan synthesis, was performed using real-time quantitative PCR (Q-PCR). The amount of (1,3;1,4)-β-glucan was measured using a modified Megazyme assay. The fine structures of the (1,3;1,4)-β-glucan, as denoted by the ratio of cellotriosyl to cellotetraosyl residues (DP3:DP4 ratio) was assessed by chromatography (HPLC and HPAEC-PAD). The distribution and deposition of the MLG was examined using the specific antibody BG-1 and captured using fluorescence and transmission electron microscopy (TEM). The cellulose synthase gene superfamily contains 13 CesA and 35 Csl genes in Setaria. Transcript profiling of CslF, CslH and CslJ gene families across a vegetative tissue series indicated that SvCslF6 transcripts were the most abundant relative to all other Csl transcripts. The amounts of (1,3;1,4)-β-glucan in Setaria vegetative tissues ranged from 0.2% to 2.9% w/w with much smaller amounts in developing grain (0.003% to 0.013% w/w). In general, the amount of (1,3;1,4)-β-glucan was greater in younger than in older tissues. The DP3:DP4 ratios varied between tissue types and across developmental stages, and ranged from 2.4 to 3.0:1. The DP3:DP4 ratios in developing grain ranged from 2.5 to 2.8:1. Micrographs revealing the distribution of (1,3;1,4)-β-glucan in walls of different cell types and the data were
Origins of amorphous interstellar grains
International Nuclear Information System (INIS)
Hasegawa, H.
1984-01-01
The existence of amorphous interstellar grains has been suggested from infrared observations. Some carbon stars show the far infrared emission with a lambda -1 wavelength dependence. Far infrared emission supposed to be due to silicate grains often show the lambda -1 wavelength dependence. Mid infrared spectra around 10 μm have broad structure. These may be due to the amorphous silicate grains. The condition that the condensed grains from the cosmic gas are amorphous is discussed. (author)
Tracer concentration contours in grain lattice and grain boundary diffusion
International Nuclear Information System (INIS)
Kim, Y. S.; Olander, D. R.
1997-01-01
Grain boundary diffusion plays a significant role in fission gas release, which is one of the crucial processes dominating nuclear fuel performance. Gaseous fission products such as Xe and Kr generated during nuclear fission have to diffuse in the grain lattice and the boundary inside fuel pellets before they reach the open spaces in a fuel rod. These processes can be studied by 'tracer diffusion' techniques, by which grain boundary diffusivity can be estimated and directly used for low burn-up fission gas release analysis. However, only a few models accounting for the both processes are available and mostly handle them numerically due to mathematical complexity. Also the numerical solution has limitations in a practical use. In this paper, an approximate analytical solution in case of stationary grain boundary in a polycrystalline solid is developed for the tracer diffusion techniques. This closed-form solution is compared to available exact and numerical solutions and it turns out that it makes computation not only greatly easier but also more accurate than previous models. It can be applied to theoretical modelings for low burn-up fission gas release phenomena and experimental analyses as well, especially for PIE (post irradiation examination). (author)
Ferroelectric domain continuity over grain boundaries
DEFF Research Database (Denmark)
Mantri, Sukriti; Oddershede, Jette; Damjanovic, Dragan
2017-01-01
Formation and mobility of domain walls in ferroelectric materials is responsible for many of their electrical and mechanical properties. Domain wall continuity across grain boundaries has been observed since the 1950's and is speculated to affect the grain boundary-domain interactions, thereby...... impacting macroscopic ferroelectric properties in polycrystalline systems. However detailed studies of such correlated domain structures across grain boundaries are limited. In this work, we have developed the mathematical requirements for domain wall plane matching at grain boundaries of any given...... orientation. We have also incorporated the effect of grain boundary ferroelectric polarization charge created when any two domains meet at the grain boundary plane. The probability of domain wall continuity for three specific grain misorientations is studied. Use of this knowledge to optimize processing...
International Nuclear Information System (INIS)
Guo, Chunwen; Li, Junjie; Yu, Honglei; Wang, Zhijun; Lin, Xin; Wang, Jincheng
2017-01-01
We present an investigation of secondary and tertiary branching behavior in diverging grain boundaries (GBs) between two columnar dendritic grains with different crystallographic orientations, both by two-dimensional phase-field simulations and thin-sample experiments. The stochasticity of the GB trajectories and the statistically averaged GB orientations were analyzed in detail. The side-branching dynamics and subsequent branch competition behaviors found in the simulations agreed well with the experimental results. When the orientations of two grains are given, the experimental results indicated that the average GB orientation was independent of the pulling velocity in the dendritic growth regime. The simulation and experimental results, as well as the results reported in the literature exhibit a uniform relation between the percentage of the whole gap region occupied by the favorably oriented grain and the difference in the absolute values of the secondary arm growth directions of the two competitive grains. By describing such a uniform relation with a simple fitting equation, we proposed a simple analytical model for the GB orientation at diverging GBs, which gives a more accurate description of GB orientation selection than the existing models.
The effect of grain refinement and silicon content on grain formation in hypoeutectic Al-Si alloys
Energy Technology Data Exchange (ETDEWEB)
Lee, Y.C.; Dahle, A.K.; StJohn, D.H.; Hutt, J.E.C. [Queensland Univ., Brisbane (Australia). Dept. of Mining, Minerals and Mater. Eng.
1999-01-15
The effect of increasing the amount of added grain refiner on grain size and morphology has been investigated for a range of hypoeutectic Al-Si alloys. The results show a transition in grain size at a silicon concentration of about 3 wt% in unrefined alloys; the grain size decreasing with silicon content before the transition, and increasing beyond the transition point. A change in morphology also occurs with increased silicon content. The addition of grain refiner leads to greater refinement for silicon contents below the transition point than for those contents above the transition point, while the transition point seems to remain unchanged. The slope of the grain size versus silicon content curve after the transition seems to be unaffected by the degree of grain refinement. The results are related to the competitive processes of nucleation and constitutional effects during growth and their impact on nucleation kinetics. (orig.) 13 refs.
Wychowaniec, J.; Griffiths, I.; Gay, A.; Mughal, A.
2013-01-01
We report on simple shaking experiments to measure the compaction of a column of Firth oat grain. Such grains are elongated anisotropic particles with a bimodal polydispersity. In these experiments, the particle configurations start from an initially disordered, low-packing-fraction state and under vertical shaking evolve to a dense state with evidence of nematic-like structure at the surface of the confining tube. This is accompanied by an increase in the packing fraction of the grain.
International Nuclear Information System (INIS)
Wang, J.Y.; Wang, X.W.; Rifkin, J.; Li, D.X.
2001-12-01
Using the molecular dynamics simulation method, the microstructure of distortion region near curved amorphous-like grain boundary in nano-NiAl alloy is studied. The results showed that due to the internal elastic force of high energy grain boundary, distortion layer exists between grain and grain boundary. The lattice expansion and structure factor decreasing are observed in this region. Stacking fault in sample with grain size 3.8nm is clearly observed across the distortion region at the site very close to grain. The influences of different grain sizes on average distortion degree and volume fractions of distortion region, grain and grain boundary are also discussed. (author)
2010-01-01
... Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice. (See also Â... Milled Rice Principles Governing Application of Standards § 868.310 Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice...
Pressure effect on grain boundary diffusion
International Nuclear Information System (INIS)
Smirnova, E.S.; Chuvil'deev, V.N.
1997-01-01
The influence of hydrostatic pressure on grain boundary diffusion and grain boundary migration in metallic materials is theoretically investigated. The model is suggested that permits describing changes in activation energy of grain boundary self-diffusion and diffusion permeability of grain boundaries under hydrostatic pressure. The model is based on the ideas about island-type structure of grain boundaries as well as linear relationship of variations in grain boundary free volume to hydrostatic pressure value. Comparison of theoretical data with experimental ones for a number of metals and alloys (α-Zr, Sn-Ge, Cu-In with Co, In, Al as diffusing elements) shows a qualitative agreement
Halstensen, Anne Straumfors; Nordby, Karl-Christian; Elen, Oleif; Eduard, Wijnand
2004-01-01
Ochratoxin A (OTA) is a nephrotoxin frequently contaminating grains. OTA inhalation during grain handling may therefore represent a health risk to farmers, and was the subject of this study. Airborne and settled grain dust was collected during grain work on 84 Norwegian farms. Climate and agricultural practices on each farm were registered. Penicillium spp., Aspergillus spp. and OTA in settled dust were measured. Settled dust contained median 4 microg OTA/kg dust (range 2-128), correlating with Penicillium spp. (median 40 cfu/mg; range 0-32000, rs =0.33; p grain species, districts and agricultural practices. Penicillium levels, but not OTA levels, were higher in storage than in threshing dust (p=0.003), and increased with storage time (rs =0.51, p dust during threshing and median 7 mg/m3 (range 1-110) dust during storage work, equalling median 3.7 pg/m3 (range 0.6-200) and median 40 pg/m3 (range 2-14000) OTA, respectively (p grain work was low, although varying by more than 1,000-fold. However, the farmers may occasionally be highly exposed, particularly during handling of stored grain.
DEFF Research Database (Denmark)
Wu, G.L.; Godfrey, A.; Winther, Grethe
2011-01-01
Columnar grained Ni is used as a model material allowing simultaneous non-surface investigations of the evolution of crystallographic orientations and deformation microstructures within individual grains as a function of rolling strain up to ε=0.7. Electron channelling contrast and electron...... backscattered diffraction are used to visualise microstructures and crystallographic orientations. It is found that both the microstructural and the textural development depend strongly on the initial grain orientation. A grain size effect is observed on the deformation-induced orientation scatter within...
International Nuclear Information System (INIS)
Wan, X.L.; Wei, R.; Wu, K.M.
2010-01-01
The microstructure of acicular ferrite and its formation for the grain refinement of coarse-grained region of heat-affected zone of high strength low-alloy bainite steels were studied using three-dimensional reconstruction technique. Crystallographic grain size was analyzed by means of electron backscatter diffraction. It was revealed that the microstructure in the coarse-grained region of the heat-affected zone consisted of predominantly bainite packets and a small proportion of acicular ferrite. Acicular ferrite was of lath or plate-like rather than needle or rod-like morphology. Tempering of the coarse-grained region of heat-affected zone showed that the acicular ferrite was more stable than the bainite, indicating that the acicular ferrite was formed prior to bainite. The acicular ferrite laths or plates divided the prior austenite grains into smaller and separate regions, and confining the bainite transformed at lower temperatures in the smaller regions and hence leading to the grain refinement in the coarse-grained region of the heat-affected zone.
Energy Technology Data Exchange (ETDEWEB)
Wan, X.L.; Wei, R. [Institute of Advanced Steels and Welding Technology, Hubei Provincial Key Laboratory for Systems Science on Metallurgical Processing, Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan 430081 (China); Wu, K.M., E-mail: wukaiming@wust.edu.cn [Institute of Advanced Steels and Welding Technology, Hubei Provincial Key Laboratory for Systems Science on Metallurgical Processing, Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan 430081 (China)
2010-07-15
The microstructure of acicular ferrite and its formation for the grain refinement of coarse-grained region of heat-affected zone of high strength low-alloy bainite steels were studied using three-dimensional reconstruction technique. Crystallographic grain size was analyzed by means of electron backscatter diffraction. It was revealed that the microstructure in the coarse-grained region of the heat-affected zone consisted of predominantly bainite packets and a small proportion of acicular ferrite. Acicular ferrite was of lath or plate-like rather than needle or rod-like morphology. Tempering of the coarse-grained region of heat-affected zone showed that the acicular ferrite was more stable than the bainite, indicating that the acicular ferrite was formed prior to bainite. The acicular ferrite laths or plates divided the prior austenite grains into smaller and separate regions, and confining the bainite transformed at lower temperatures in the smaller regions and hence leading to the grain refinement in the coarse-grained region of the heat-affected zone.
Evolution of interstellar grains
International Nuclear Information System (INIS)
Greenberg, J.M.
1984-01-01
The principal aim of this chapter is to derive the properties of interstellar grains as a probe of local physical conditions and as a basis for predicting such properties as related to infrared emissivity and radiative transfer which can affect the evolution of dense clouds. The first sections will develop the criteria for grain models based directly on observations of gas and dust. A summary of the chemical evolution of grains and gas in diffuse and dense clouds follows. (author)
Gurses, Ercan; El Sayed, Tamer S.
2011-01-01
In this work, a viscoplastic constitutive model for nanocrystalline metals is presented. The model is based on competing grain boundary and grain interior deformation mechanisms. In particular, inelastic deformations caused by grain boundary
Nuth, Joseph
An experimentally-based model of grain formation in oxygen-rich circumstellar outflows that includes vapor-solid nucleation, grain growth, thermal annealing and grain aggregation in sufficient detail to predict the spectral energy distribution (SED) of the shells for comparison with observations of a wide range of stellar sources still lacks critical data. In order to gather this data we propose to conduct a series of laboratory experiments using our proven experimental system and microgravity condensation, growth and grain aggregation experiments on sounding rockets with a flight-proven payload provided by Dr. Yuki Kimura of Hokkaido University. We have proposed that solids from a hydrogen-rich, supersaturated, Fe-Mg-SiO vapor condense at metastable eutectic points in this ternary phase diagram. Because the FeOMgO system is totally miscible (has no eutectic or metastable eutectic compositions), this predicts that condensates will be pure Mg-silicate or Fe-silicate grains and that no primary condensate will be a mixed Fe-Mg-silicate. We have shown that this observation leads to a logical explanation as to why pure magnesium olivine and enstatite minerals are detected in circumstellar winds rather than the mixed Mg-Fe-silicate grains that might otherwise be expected (Rietmeijer, Nuth & Karner, 1999). This simplifying hypothesis has been built into our models of circumstellar condensation and growth. However, these experimental results require confirmation and testing since they should apply to other, quite similar condensable systems. We propose to test this hypothesis by condensing solids from the Fe-Mg-AlO ternary vapor system. Since FeO-MgO miscibility also applies to this system, the primary condensates from such a vapor should consist of pure amorphous Fe-aluminates and Mg-aluminates. No mixed Fe-Mg-spinels should be detected as primary condensates if this hypothesis is correct, just as none were detected for the FeO-MgO-SiO system. Confirmation of this
A study was executed to determine the potential of storing farmers stock peanuts and shelled peanuts for crushing in hermetically sealed grain bags. The objectives of the study were to evaluate equipment for loading and unloading the grain bags, the capacity of the grain bags, and the changes in qu...
Li, Yong; Cui, Zhengyong; Ni, Yingli; Zheng, Mengjing; Yang, Dongqing; Jin, Min; Chen, Jin; Wang, Zhenlin; Yin, Yanping
2016-01-01
In winter wheat, grain development is asynchronous. The grain number and grain weight vary significantly at different spikelet and grain positions among wheat cultivars grown at different plant densities. In this study, two winter wheat (Triticum aestivum L.) cultivars, 'Wennong6' and 'Jimai20', were grown under four different plant densities for two seasons, in order to study the effect of plant density on the grain number and grain weight at different spikelet and grain positions. The resul...
Segregation of solute elements at grain boundaries in an ultrafine grained Al-Zn-Mg-Cu alloy
International Nuclear Information System (INIS)
Sha, Gang; Yao, Lan; Liao, Xiaozhou; Ringer, Simon P.; Chao Duan, Zhi; Langdon, Terence G.
2011-01-01
The solute segregation at grain boundaries (GBs) of an ultrafine grained (UFG) Al-Zn-Mg-Cu alloy processed by equal-channel angular pressing (ECAP) at 200 o C was characterised using three-dimensional atom probe. Mg and Cu segregate strongly to the grain boundaries. In contrast, Zn does not always show clear segregation and may even show depletion near the grain boundaries. Trace element Si selectively segregates at some GBs. An increase in the number of ECAP passes leads to a decrease in the grain size but an increase in solute segregation at the boundaries. The significant segregation of alloying elements at the boundaries of ultrafine-grained alloys implies that less solutes will be available in the matrix for precipitation with a decrease in the average grain size. -- Research Highlights: → Atom probe tomography has been employed successfully to reveal unique segregation of solutes at ultrafine grained material. → Mg and Cu elements segregated strongly at the grain boundary of an ultrafine grained Al-Zn-Mg-Cu alloy processed by 4-pass and 8-pass ECAP at 200 o C. Zn frequently depleted at GBs with a Zn depletion region of 7-15 nm in width on one or both sides of the GBs. Only a small fraction (3/13) of GBs were observed with a low level of Zn segregation where the combined Mg and Cu excess is over 3.1 atom/nm 2 . Si appeared selectively segregated at some of the GBs. → The increase in number of ECAP passes from 4 to 8 correlated with the increase in mean level segregation of Mg and Cu for both solute excess and peak concentration. → The change of plane normal of a grain boundary within 30 o only leads to a slight change in the solute segregation level.
Grain growth studies on nanocrystalline Ni powder
International Nuclear Information System (INIS)
Rane, G.K.; Welzel, U.; Mittemeijer, E.J.
2012-01-01
The microstructure of nanocrystalline Ni powder produced by ball-milling and its thermal stability were investigated by applying different methods of X-ray diffraction line-profile analysis: single-line analysis, whole powder-pattern modelling and the (modified) Warren–Averbach method were employed. The kinetics of grain growth were investigated by both ex-situ and in-situ X-ray diffraction measurements. With increasing milling time, the grain-size reduction is accompanied by a considerable narrowing of the size distribution and an increase in the microstrain. Upon annealing, initial, rapid grain growth occurs, accompanied by the (almost complete) annihilation of microstrain. For longer annealing times, the grain-growth kinetics depend on the initial microstructure: a smaller microstrain with a broad grain-size distribution leads to linear grain growth, followed by parabolic grain growth, whereas a larger microstrain with a narrow grain-size distribution leads to incessant linear grain growth. These effects have been shown to be incompatible with grain-boundary curvature driven growth. The observed kinetics are ascribed to the role of excess free volume at the grain boundaries of nanocrystalline material and the prevalence of an “abnormal grain-growth” mechanism.
Grain-to-grain variations in NbC particle size distributions in an austenitic stainless steel
International Nuclear Information System (INIS)
Barlow, C.Y.; Ralph, B.; Silverman, B.; Jones, A.R.
1979-01-01
Quantitative information has been obtained concerning the size distributions of NbC precipitate particles in different grains in a deformed and aged austenitic stainless steel specimen. The precipitate size distributions obtained differ from one grain to another. The average disparity measured between the mean precipitate sizes was a function of the distance between the grains compared. The results obtained are considered in terms of differences in precipitation behaviour due to variations in the levels of plastic strain in constituent grains of the deformed specimen. (author)
Grain refinement of zinc-aluminium alloys
International Nuclear Information System (INIS)
Zaid, A.I.O.
2006-01-01
It is now well-established that the structure of the zinc-aluminum die casting alloys can be modified by the binary Al-Ti or the ternary Al-Ti-B master alloys. in this paper, grain refinement of zinc-aluminum alloys by rare earth materials is reviewed and discussed. The importance of grain refining of these alloys and parameters affecting it are presented and discussed. These include parameters related to the Zn-Al alloys cast, parameters related to the grain refining elements or alloys and parameters related to the process. The effect of addition of other alloying elements e.g. Zr either alone or in the presence of the main grain refiners Ti or Ti + B on the grain refining efficiency is also reviewed and discussed. Furthermore, based on the grain refinement and the parameters affecting it, a criterion for selection of the optimum grain refiner is suggested. Finally, the recent research work on the effect of grain refiners on the mechanical behaviour, impact strength, wear resistance, and fatigue life of these alloys are presented and discussed. (author)
Experimental Study of Dust Grain Charging
Spann, James F; Venturini, Catherine C.; Comfort, Richard H.; Mian, Abbas M.
1999-01-01
The results of an experimental study of the charging mechanisms of micron size dust grains are presented. Individual dust grains are electrodynamically suspended and exposed to an electron beam of known energy and flux, and to far ultraviolet radiation of known wavelength and intensity. Changes in the charge-to-mass ratio of the grain are directly measured as a function of incident beam (electron and/or photon), grain size and composition. Comparisons of our results to theoretical models that predict the grain response are presented.
Yu, Tao; Li, Geng; Liu, Peng; Dong, Shuting; Zhang, Jiwang; Zhao, Bin
2017-06-01
In maize, inferior grains (IG) located on the upper part of the ear have poor grain filling process compared to superior grains (SG) located on the middle and lower parts of the ear. This difference limits satisfactory yield and quality; however, the underlying molecular mechanisms remain unknown. Here, using the isobaric tag for relative and absolute quantification (iTRAQ) technology, the proteomes of IG and SG during early and middle grain filling stages were investigated. In total, 4720 proteins were identified in maize grain and 305 differentially accumulated proteins (DiAPs) were detected between IG and SG. These DiAPs were involved in diverse cellular and metabolic processes with preferred distribution in protein synthesis/destination and metabolism. Compared to SG, DiAPs related to cell growth/division and starch synthesis were lag-accumulated and down-regulated in IG, respectively, resulting in smaller sink sizes and lower sink activities in IG. Meanwhile, impediment of the glycolysis pathway in IG may lead to reduce energy supply and building materials for substance synthesis. Additionally, reactive oxygen species (ROS) homeostasis and the defense system were disturbed in IG, which might lead to reduce protection against various environmental stresses. The present study provides new information on the proteomic differences between IG and SG, and explains possible molecular mechanisms for poor grain filling in IG. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Alignment of dust grains in ionized regions
Anderson, Nels; Watson, William D.
1993-01-01
The rate at which charged dust grains in a plasma are torqued by passing ions and electrons is calculated. When photo-emission of electrons is not important, attraction of ions by the grain monopole potential increases the rate at which the grains' spins are dealigned by nearly an order of magnitude. Consequently, the energy density of the magnetic field required to align grains in an H II region may be increased by about an order of magnitude. In contrast, electric dipole and quadrupole moments are unlikely to produce large dealignment rates for grains of modest length-to-width ratio. Nonetheless, for positively charged grains these higher-order moments likely prevent monopole repulsion of ions from reducing the dealignment rate far below that for neutral grains. The presence of positive grain charge therefore does not greatly facilitate grain alignment in an H II region.
Concepts on Low Temperature Mechanical Grain Growth
Energy Technology Data Exchange (ETDEWEB)
Sharon, John Anthony [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Metallurgy and Materials Joining Dept.; Boyce, Brad Lee [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Metallurgy and Materials Joining Dept.
2013-11-01
In metals, as grain size is reduced below 100nm, conventional dislocation plasticity is suppressed resulting in improvements in strength, hardness, and wears resistance. Existing and emerging components use fine grained metals for these beneficial attributes. However, these benefits can be lost in service if the grains undergo growth during the component’s lifespan. While grain growth is traditionally viewed as a purely thermal process that requires elevated temperature exposure, recent evidence shows that some metals, especially those with nanocrystalline grain structure, can undergo grain growth even at room temperature or below due to mechanical loading. This report has been assembled to survey the key concepts regarding how mechanical loads can drive grain coarsening at room temperature and below. Topics outlined include the atomic level mechanisms that facilitate grain growth, grain boundary mobility, and the impact of boundary structure, loading scheme, and temperature.
Zhang, Shuang
2012-01-01
Based on farmers' supply behavior theory and price expectations theory, this paper establishes grain farmers' supply response model of two major grain varieties (early indica rice and mixed wheat) in the major producing areas, to test whether the minimum grain purchase price policy can have price-oriented effect on grain production and supply in the major producing areas. Empirical analysis shows that the minimum purchase price published annually by the government has significant positive imp...
Directory of Open Access Journals (Sweden)
D. A. Shaimerdenova
2018-01-01
Full Text Available Soft wheat is one of the most important crops, grown in more than 130 countries. To date, one-fifth of the world's wheat, or about 150 million tons a year, is sold on international markets. In the world trade traditionally dominated by the US, Australia, Canada and Argentina. Kazakhstan, being on the 15th place in the production of wheat grain, is among the first ten exporters - in 2017 the country exported about 8 million tons to the amount of 1.5 billion dollars. USA, then, as potential export opportunities are much higher, as evidenced by annual carryover stocks at 3 million tons. According to experts, considerable differences in the classification of wheat grain used in Kazakhstan and in other countries participating in the grain market and the methods for assessing the technological dignity indicators (TDs laid down in the classifications are a significant obstacle to increasing the export potential of wheat grains. In view of this, an analysis was made of grain classifications of wheat grains used in the most important grain producing countries, TD indicators were determined, methods for their evaluation, and differences were revealed. It is established that in countries that are stable in the quantitative and qualitative characteristics of grain, an insignificant list of TD indicators is adopted, while they characterize the physical quality and state of the grain, which may indicate a general suitability for grinding. It is determined that in Russia and Kazakhstan, in determining the contamination, such an indicator as dockage is not taken into account. Comparative tests of different methods of sampling and determination of contamination have been carried out, and correlation coefficients have been established between indicators of contamination determined by different methods.
Abnormal grain growth: a non-equilibrium thermodynamic model for multi-grain binary systems
Czech Academy of Sciences Publication Activity Database
Svoboda, Jiří; Fischer, F. D.
2014-01-01
Roč. 22, č. 1 (2014), Art . No. 015013 ISSN 0965-0393 Institutional support: RVO:68081723 Keywords : grain boundary segregation * abnormal grain growth * theory * modelling * solute drag Subject RIV: BJ - Thermodynamics Impact factor: 2.167, year: 2014
Suprathermal grains: on intergalactic magnetic fields
International Nuclear Information System (INIS)
Dasgupta, A.K.
1979-01-01
Charged dust grains of radii a approximately equal to 3 x 10 -6 to approximately 3 x 10 -5 cm may be driven out of the galaxy due to radiation pressure of starlight. Once clear of the main gas-dust layer, dust grains may then escape into intergalactic space. Such grains are virtually indestructible-being evaporated only during formation. The dust grains, once injected into the intergalactic medium, may acquire suprathermal energy, thus 'suprathermal grains' in collision with magnetized cloud by the Fermi process. In order to attain relativistic energy, suprathermal grains have to move in and out ('scattering') of the magnetic field of the medium. It is now well established that high energy cosmic rays are of the order 10 20 eV or more. It has been speculated that these high energy (> = 10 18 eV) cosmic ray particles are charged dust grains, of intergalactic origin. This is possible only if there exists a magnetic field in the intergalactic medium. (Auth.)
International Nuclear Information System (INIS)
Robertson, I.M.; Lee, T.C.; Subramanian, R.; Birnbaum, H.K.
1992-01-01
This paper reports on the conditions established in disordered FCC systems for predicting the slip system that will be activated by a grain boundary to relieve a local stress concentration that have been applied to the ordered FCC alloy Ni 3 Al. The slip transfer behavior in hypo-stoichiometric Ni 3 Al with (0.2 at. %B) and without boron was directly observed by performing the deformation experiments in situ in the transmission electron microscope. In the boron-free and boron-doped alloys, lattice dislocations were incorporated in the grain boundary, but did not show evidence of dissociation to grain boundary dislocations or of movement in the grain boundary plane. The stress concentration associated with the dislocation pileup at the grain boundary are relieved by the emission of dislocations from the grain boundary in the boron-doped alloy. The slip system initiated in the adjoining grain obeyed the conditions established for disordered FCC systems. In the boron-free alloy, the primary stress relief mechanism was grain-boundary cracking, although dislocation emission from the grain boundary also occurred and accompanied intergranular crack advance
Computer simulation of grain growth in HAZ
Gao, Jinhua
Two different models for Monte Carlo simulation of normal grain growth in metals and alloys were developed. Each simulation model was based on a different approach to couple the Monte Carlo simulation time to real time-temperature. These models demonstrated the applicability of Monte Carlo simulation to grain growth in materials processing. A grain boundary migration (GBM) model coupled the Monte Carlo simulation to a first principle grain boundary migration model. The simulation results, by applying this model to isothermal grain growth in zone-refined tin, showed good agreement with experimental results. An experimental data based (EDB) model coupled the Monte Carlo simulation with grain growth kinetics obtained from the experiment. The results of the application of the EDB model to the grain growth during continuous heating of a beta titanium alloy correlated well with experimental data. In order to acquire the grain growth kinetics from the experiment, a new mathematical method was developed and utilized to analyze the experimental data on isothermal grain growth. Grain growth in the HAZ of 0.2% Cu-Al alloy was successfully simulated using the EDB model combined with grain growth kinetics obtained from the experiment and measured thermal cycles from the welding process. The simulated grain size distribution in the HAZ was in good agreement with experimental results. The pinning effect of second phase particles on grain growth was also simulated in this work. The simulation results confirmed that by introducing the variable R, degree of contact between grain boundaries and second phase particles, the Zener pinning model can be modified as${D/ r} = {K/{Rf}}$where D is the pinned grain size, r the mean size of second phase particles, K a constant, f the area fraction (or the volume fraction in 3-D) of second phase.
MATHEMATICAL MODEL OF GRAIN MICRONIZATION
Directory of Open Access Journals (Sweden)
V. A. Afanas’ev
2014-01-01
Full Text Available Summary. During micronisation grain moisture evaporates mainly in decreasing drying rate period. Grain layer located on the surface of the conveyor micronisers will be regarded as horizontal plate. Due to the fact that the micronisation process the surface of the grain evaporates little moisture (within 2-7 % is assumed constant plate thickness. Because in the process of micronization grain structure is changing, in order to achieve an exact solution of the equations necessary to take into account changes thermophysical, optical and others. Equation of heat transfer is necessary to add a term that is responsible for the infrared heating. Because of the small thickness of the grain, neglecting the processes occurring at the edge of the grain, that is actually consider the problem of an infinite plate. To check the adequacy of the mathematical model of the process of micronisation of wheat grain moisture content must be comparable to the function of time, obtained by solving the system of equations with the measured experimental data of experience. Numerical solution of a system of equations for the period of decreasing drying rate is feasible with the help of the Maple 14, substituting the values of the constants in the system. Calculation of the average relative error does not exceed 7- 10 %, and shows a good agreement between the calculated data and the experimental values.
Genetic dissection of grain size and grain number trade-offs in CIMMYT wheat germplasm.
Griffiths, Simon; Wingen, Luzie; Pietragalla, Julian; Garcia, Guillermo; Hasan, Ahmed; Miralles, Daniel; Calderini, Daniel F; Ankleshwaria, Jignaben Bipinchandra; Waite, Michelle Leverington; Simmonds, James; Snape, John; Reynolds, Matthew
2015-01-01
Grain weight (GW) and number per unit area of land (GN) are the primary components of grain yield in wheat. In segregating populations both yield components often show a negative correlation among themselves. Here we use a recombinant doubled haploid population of 105 individuals developed from the CIMMYT varieties Weebill and Bacanora to understand the relative contribution of these components to grain yield and their interaction with each other. Weebill was chosen for its high GW and Bacanora for high GN. The population was phenotyped in Mexico, Argentina, Chile and the UK. Two loci influencing grain yield were indicated on 1B and 7B after QTL analysis. Weebill contributed the increasing alleles. The 1B effect, which is probably caused by to the 1BL.1RS rye introgression in Bacanora, was a result of increased GN, whereas, the 7B QTL controls GW. We concluded that increased in GW from Weebill 7B allele is not accompanied by a significant reduction in grain number. The extent of the GW and GN trade-off is reduced. This makes this locus an attractive target for marker assisted selection to develop high yielding bold grain varieties like Weebill. AMMI analysis was used to show that the 7B Weebill allele appears to contribute to yield stability.
Spinodal decomposition in fine grained materials
Indian Academy of Sciences (India)
Unknown
ηηi has a value of unity inside the ith grain, decreases smoothly through the grain boundary region to zero out- side the grain. For a symmetric alloy of composition, c = 0⋅⋅5, our results show that microstructural evolution depends largely on the difference in the grain boundary energies, γγgb, of A-rich (αα) and B-rich (ββ) ...
Radiation disinfestation of grain
Energy Technology Data Exchange (ETDEWEB)
NONE
1962-10-15
A panel was convened by the International Atomic Energy Agency to consider ways of applying radiation to grain handling and insect control, and to make recommendations on the advisability and nature of any future action in this field. Among other subjects, the panel discussed the use of electron accelerators and gamma radiation for grain disinfestation as well as problems of radiation entomology and wholesomeness of irradiated grain. After reviewing the present state of knowledge regarding radiation disinfestation of grain, the experts agreed that pilot plant operations be initiated as soon as practicable in order to evaluate the use of irradiation plants under practical conditions in their entomological, engineering and economic aspects. They recommended that research effort be directed towards solving certain fundamental problems related to the proposed pilot plant projects; such as rapid methods for differentiation between sterile insects and normal ones; study of the metabolism of irradiated immature stages of insects in relation to the heating of treated grain; research into possible induction of radiation resistance; irradiation susceptibility of insects which show resistance to conventional insecticides; and study of methods of sensitizing insects to irradiation damage. It was also pointed out that the distribution of irradiated food for human consumption was controlled in most countries under present legislative procedures, and no country had yet approved radiation treatment of cereals. The experts recommended that countries in a position to submit evidence to their appropriate authorities regarding the wholesomeness of irradiated cereals should be encouraged to do so as soon as possible. Regarding the engineering aspects of irradiation pilot plant projects, the experts noted that the process could be automated and operated safely. Electron accelerators and cobalt sources could be used for all the throughput rates utilized in most conventional grain
Radiation disinfestation of grain
International Nuclear Information System (INIS)
1962-01-01
A panel was convened by the International Atomic Energy Agency to consider ways of applying radiation to grain handling and insect control, and to make recommendations on the advisability and nature of any future action in this field. Among other subjects, the panel discussed the use of electron accelerators and gamma radiation for grain disinfestation as well as problems of radiation entomology and wholesomeness of irradiated grain. After reviewing the present state of knowledge regarding radiation disinfestation of grain, the experts agreed that pilot plant operations be initiated as soon as practicable in order to evaluate the use of irradiation plants under practical conditions in their entomological, engineering and economic aspects. They recommended that research effort be directed towards solving certain fundamental problems related to the proposed pilot plant projects; such as rapid methods for differentiation between sterile insects and normal ones; study of the metabolism of irradiated immature stages of insects in relation to the heating of treated grain; research into possible induction of radiation resistance; irradiation susceptibility of insects which show resistance to conventional insecticides; and study of methods of sensitizing insects to irradiation damage. It was also pointed out that the distribution of irradiated food for human consumption was controlled in most countries under present legislative procedures, and no country had yet approved radiation treatment of cereals. The experts recommended that countries in a position to submit evidence to their appropriate authorities regarding the wholesomeness of irradiated cereals should be encouraged to do so as soon as possible. Regarding the engineering aspects of irradiation pilot plant projects, the experts noted that the process could be automated and operated safely. Electron accelerators and cobalt sources could be used for all the throughput rates utilized in most conventional grain
Grain boundary segregation and intergranular failure
International Nuclear Information System (INIS)
White, C.L.
1980-01-01
Trace elements and impurities often segregate strongly to grain boundaries in metals and alloys. Concentrations of these elements at grain boundaries are often 10 3 to 10 5 times as great as their overall concentration in the alloy. Because of such segregation, certain trace elements can exert a disproportionate influence on material properties. One frequently observed consequence of trace element segregation to grain boundaries is the occurrence of grain boundary failure and low ductility. Less well known are incidences of improved ductility and inhibition of grain boundary fracture resulting from trace element segregation to grain boundaries in certain systems. An overview of trace element segregation and intergranular failure in a variety of alloy systems as well as preliminary results from studies on Al 3% Li will be presented
Grain refinement of aluminum and its alloys
International Nuclear Information System (INIS)
Zaid, A.I.O.
2001-01-01
Grain refinement of aluminum and its alloys by the binary Al-Ti and Ternary Al-Ti-B master alloys is reviewed and discussed. The importance of grain refining to the cast industry and the parameters affecting it are presented and discussed. These include parameters related to the cast, parameters related to the grain refining alloy and parameters related to the process. The different mechanisms, suggested in the literature for the process of grain refining are presented and discussed, from which it is found that although the mechanism of refining by the binary Al-Ti is well established the mechanism of grain refining by the ternary Al-Ti-B is still a controversial matter and some research work is still needed in this area. The effect of the addition of other alloying elements in the presence of the grain refiner on the grain refining efficiency is also reviewed and discussed. It is found that some elements e.g. V, Mo, C improves the grain refining efficiency, whereas other elements e.g. Cr, Zr, Ta poisons the grain refinement. Based on the parameters affecting the grain refinement and its mechanism, a criterion for selection of the optimum grain refiner is forwarded and discussed. (author)
International Nuclear Information System (INIS)
Gale, M.D.; Flintham, J.E.
1984-01-01
The Tom Thumb dwarfing gene, Rht3, like the related genes Rht1 and Rht2 from Norin 10, has pleiotropic effects on individual ear yields, and grain protein concentrations. An experiment was conducted in which tiller number per plant and grain number per spike were restricted to ascertain whether reduced grain size and protein content are primary or secondary competitive effects in near-isogenic lines. The potential for grain growth was shown to be identical in Rht3 and rht genotypes when grain set was restricted, indicating that the primary effect of the gene is to increase spikelet fertility. Nitrogen accumulation within the grain was also affected by inter-grain competition but decreased nitrogen yields per plant indicated that reduced protein levels are, in part, a primary effect of the gene. Analysis of individual grain yields within Rht3 and rht spikes showed that the gene affected developmental 'dominance' relationships within the spike. (author)
Duan, Penggen; Rao, Yuchun; Zeng, Dali; Yang, Yaolong; Xu, Ran; Zhang, Baolan; Dong, Guojun; Qian, Qian; Li, Yunhai
2014-02-01
Although grain size is one of the most important components of grain yield, little information is known about the mechanisms that determine final grain size in crops. Here we characterize rice small grain1 (smg1) mutants, which exhibit small and light grains, dense and erect panicles and comparatively slightly shorter plants. The short grain and panicle phenotypes of smg1 mutants are caused by a defect in cell proliferation. The smg1 mutations were identified, using a map-based cloning approach, in mitogen-activated protein kinase kinase 4 (OsMKK4). Relatively higher expression of OsMKK4/SMG1 was detected in younger organs than in older ones, consistent with its role in cell proliferation. Green fluorescent protein (GFP)-OsMKK4/SMG1 fusion proteins appear to be distributed ubiquitously in plant cells. Further results revealed that OsMKK4 influenced brassinosteroid (BR) responses and the expression of BR-related genes. Thus, our findings have identified OsMKK4 as a factor for grain size, and suggest a possible link between the MAPK pathways and BRs in grain growth. © 2013 The Authors The Plant Journal © 2013 John Wiley & Sons Ltd.
Autonomous grain combine control system
Hoskinson, Reed L.; Kenney, Kevin L.; Lucas, James R.; Prickel, Marvin A.
2013-06-25
A system for controlling a grain combine having a rotor/cylinder, a sieve, a fan, a concave, a feeder, a header, an engine, and a control system. The feeder of the grain combine is engaged and the header is lowered. A separator loss target, engine load target, and a sieve loss target are selected. Grain is harvested with the lowered header passing the grain through the engaged feeder. Separator loss, sieve loss, engine load and ground speed of the grain combine are continuously monitored during the harvesting. If the monitored separator loss exceeds the selected separator loss target, the speed of the rotor/cylinder, the concave setting, the engine load target, or a combination thereof is adjusted. If the monitored sieve loss exceeds the selected sieve loss target, the speed of the fan, the size of the sieve openings, or the engine load target is adjusted.
The valuation of commercial grain silos
African Journals Online (AJOL)
The valuation of grain silos is a complex exercise when one considers all the variables that affect their ... their grains, larger grain-processing companies, traders, importers or exporters that have ..... 2015: personal interview). The percentages ...
Exposure to grain dust and microbial components in the Norwegian grain and compound feed industry.
Halstensen, Anne Straumfors; Heldal, Kari Kulvik; Wouters, Inge M; Skogstad, Marit; Ellingsen, Dag G; Eduard, Wijnand
2013-11-01
The aim of this study was to extensively characterize grain workers' personal exposure during work in Norwegian grain elevators and compound feed mills, to identify differences in exposures between the workplaces and seasons, and to study the correlations between different microbial components. Samples of airborne dust (n = 166) were collected by full-shift personal sampling during work in 20 grain elevators and compound feed mills during one autumn season and two winter seasons. The personal exposure to grain dust, endotoxins, β-1→3-glucans, bacteria, and fungal spores was quantified. Correlations between dust and microbial components and differences between workplaces and seasons were investigated. Determinants of endotoxin and β-1→3-glucan exposure were evaluated by linear mixed-effect regression modeling. The workers were exposed to an overall geometric mean of 1.0mg m(-3) inhalable grain dust [geometric standard deviation (GSD) = 3.7], 628 endotoxin units m(-3) (GSD = 5.9), 7.4 µg m(-3) of β-1→3-glucan (GSD = 5.6), 21 × 10(4) bacteria m(-3) (GSD = 7.9) and 3.6 × 10(4) fungal spores m(-3) (GSD = 3.4). The grain dust exposure levels were similar across workplaces and seasons, but the microbial content of the grain dust varied substantially between workplaces. Exposure levels of all microbial components were significantly higher in grain elevators compared with all other workplaces. The grain dust exposure was significantly correlated (Pearson's r) with endotoxin (rp = 0.65), β-1→3-glucan (rp = 0.72), bacteria (rp = 0.44) and fungal spore (rp = 0.48) exposure, whereas the explained variances were strongly dependent on the workplace. Bacteria, grain dust, and workplace were important determinants for endotoxin exposure, whereas fungal spores, grain dust, and workplace were important determinants for β-1→3-glucan exposure. Although the workers were exposed to a relatively low mean dust level, the microbial exposure was high. Furthermore, the
International Nuclear Information System (INIS)
Smedley, R.K.; Duller, G.A.T.; Roberts, H.M.
2015-01-01
Post-IR IRSL (pIRIR) signals from K-feldspar grains measured at elevated temperatures are increasingly being used for dating sediments. Unfortunately the pIRIR signal from K-feldspars bleaches more slowly than other signals (e.g. OSL from quartz) upon exposure to daylight, leading to concerns about residual signals remaining at deposition. However, earlier studies have not assessed whether the pIRIR signal bleaches at the same rate in all feldspar grains. In this study laboratory bleaching experiments have been conducted and for the first time the results show that the rate at which the pIRIR signal from individual K-feldspar grains bleach varies. To determine whether grain-to-grain variability in bleaching rate has a dominant control on equivalent dose (D e ) distributions determined using single grains, analysis was undertaken on three samples with independent age control from different depositional environments (two aeolian and one glaciofluvial). The D e value determined from each grain was compared with the rate at which the pIRIR 225 signal from the grain bleaches. The bleaching rate of each grain was assessed by giving a 52 Gy dose and measuring the residual D e after bleaching for an hour in a solar simulator. There is no clear relationship between the rate at which the pIRIR 225 signal of an individual grain bleaches and the magnitude of its D e . It is concluded that variability in the bleaching rate of the pIRIR 225 signal from one grain to another does not appear to be a dominant control on single grain D e distributions. - Highlights: • The bleaching rate of the pIRIR signal from single K-feldspar grains was assessed. • The pIRIR 225 signal bleaches more rapidly than the pIRIR 290 signal. • pIRIR 225 and pIRIR 290 signals reach the same level after 4–20 h of bleaching. • The bleaching rate of the pIRIR signal varies from one grain to another. • Variable pIRIR bleaching rates do not control single-grain D e distributions
Grain formation in cool stellar envelopes
International Nuclear Information System (INIS)
Deguchi, S.
1980-01-01
The nucleation and growth of dust grains in the stellar envelope are investigated for the case of oxygen-rich stars, where the mass loss occurs as a result of the radiation pressure on the dust grains. The number density of grains, the final grain sizes, and the final amount of metals remaining in gaseous states are calculated based on the grain-nucleation theory proposed by Yamamoto and Hasegawa and Draine and Salpeter. It is shown that, even if we base our calculations on the Lothe-Pound nucleation rate equation instead of the classical, homogeneous nucleation rate equation, the proposed theory gives a number density of grains quite similar to that based on the classical rate equation. The approximate solution of the flow, in this paper, brings physical insight to the problem of how the formation of grains couples the flow passing the sonic point. The metals in the outer envelope remain in gaseous state by the amount of 1--10% of the initial content for the mass-loss rate of 10 -5 M/sub sun/ yr -1 and by less than 1% for the massloss are less than 3 x 10 -6 M/sub sun/ yr -1 . Species of metals condensed onto the grains are also discussed
Deformation strain inhomogeneity in columnar grain nickel
DEFF Research Database (Denmark)
Wu, G.L.; Godfrey, A.; Juul Jensen, D.
2005-01-01
A method is presented for determination of the local deformation strain of individual grains in the bulk of a columnar grain sample. The method, based on measurement of the change in grain area of each grain, is applied to 12% cold rolled nickel. Large variations are observed in the local strain...... associated with each grain. (c) 2005 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved....
Randomly grain growth in metallic materials
Energy Technology Data Exchange (ETDEWEB)
Ramirez, A. [Instituto Politecnico Nacional, (SEPI-ESIME), Unidad Profesional Ticoman, Av. Ticoman 600, Del. G.A.M., C.P. 07340 Distrito Federal, Mexico (Mexico); Instituto Politecnico Nacional, (SEPI-ESIQIE), Unidad Profesional Zacatenco, Edif. 6 y Edif. Z planta baja C.P.07300, Distrito Federal, Mexico (Mexico)], E-mail: adaramil@yahoo.com.mx; Chavez, F. [Instituto Politecnico Nacional, (SEPI-ESIQIE), Unidad Profesional Zacatenco, Edif. 6 y Edif. Z planta baja C.P.07300, Distrito Federal, Mexico (Mexico); Demedices, L. [Instituto Politecnico Nacional, (SEPI-ESIME), Unidad Profesional Ticoman, Av. Ticoman 600, Del. G.A.M., C.P. 07340 Distrito Federal, Mexico (Mexico); Instituto Politecnico Nacional, (SEPI-ESIQIE), Unidad Profesional Zacatenco, Edif. 6 y Edif. Z planta baja C.P.07300, Distrito Federal, Mexico (Mexico); Cruz, A.; Macias, M. [Instituto Politecnico Nacional, (SEPI-ESIQIE), Unidad Profesional Zacatenco, Edif. 6 y Edif. Z planta baja C.P.07300, Distrito Federal, Mexico (Mexico)
2009-10-30
Computational modeling of grain structures is a very important topic in materials science. In this work, the development of the computational algorithms for a mathematical model to predict grain nucleation and grain growth is presented. The model place a number of nucleated points randomly in a liquid pool according with the solid and liquid fractions (X{sub sol} and X{sub liq}) of metal solute and the local temperature distribution (SS{sub I,J}). Then these points grows isotropically until obtain a grain structure with straight interfaces. Different grain morphologies such as columnar and equiaxed can be obtained as a function of the temperature distributions and growth directions.
Randomly grain growth in metallic materials
International Nuclear Information System (INIS)
Ramirez, A.; Chavez, F.; Demedices, L.; Cruz, A.; Macias, M.
2009-01-01
Computational modeling of grain structures is a very important topic in materials science. In this work, the development of the computational algorithms for a mathematical model to predict grain nucleation and grain growth is presented. The model place a number of nucleated points randomly in a liquid pool according with the solid and liquid fractions (X sol and X liq ) of metal solute and the local temperature distribution (SS I,J ). Then these points grows isotropically until obtain a grain structure with straight interfaces. Different grain morphologies such as columnar and equiaxed can be obtained as a function of the temperature distributions and growth directions.
Energy Technology Data Exchange (ETDEWEB)
Bittner, F., E-mail: f.bittner@ifw-dresden.de [IFW Dresden, Institute for Metallic Materials, PO Box 270116, 01171 Dresden (Germany); Technische Universität Dresden, Institute of Materials Science, 01062 Dresden (Germany); Woodcock, T.G. [IFW Dresden, Institute for Metallic Materials, PO Box 270116, 01171 Dresden (Germany); Schultz, L. [IFW Dresden, Institute for Metallic Materials, PO Box 270116, 01171 Dresden (Germany); Technische Universität Dresden, Institute of Materials Science, 01062 Dresden (Germany); Schwöbel, C. [Technische Universität Darmstadt, Materialwissenschaft, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Gutfleisch, O. [Technische Universität Darmstadt, Materialwissenschaft, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer ISC, Projektgruppe für Werkstoffkreisläufe und Ressourcenstrategie IWKS, Rodenbacher Chaussee 4, 63457 Hanau (Germany); Zickler, G.A.; Fidler, J. [Technische Universität Wien, Institute of Solid State Physics, Wiedner Hauptstr. 8-10, 1040 Wien (Austria); Üstüner, K.; Katter, M. [Vacuumschmelze GmbH & Co. KG, 63412 Hanau (Germany)
2017-03-15
Fine-grained, heavy rare earth free Nd-Fe-B sintered magnets were prepared from He jet milled powders with an average particle size of 1.5 µm by low temperature sintering at 920 °C or 980 °C. A coercivity of >1600 kA/m was achieved for an average grain size of 1.68 µm. Transmission electron microscopy showed that the distribution and composition of intergranular and grain boundary junction phases was similar to that in conventionally processed magnets. Microstructural analysis on different length scales revealed the occurrence of abnormal grain growth, which is unexpected for sintering temperatures below 1000 °C. A larger area fraction of abnormal grains was observed in the sample sintered at 920 °C compared to that sintered at 980 °C. Microtexture investigation showed a better crystallographic alignment of the abnormal grains compared to the fine-grained matrix, which is explained by a size dependent alignment of the powder particles during magnetic field alignment prior to sintering. Slightly larger particles in the initial powder show a better alignment and will act as nucleation sites for abnormal grain growth. Magneto-optical Kerr investigations confirmed the lower switching field of the abnormal grains compared to the fine-grained matrix. The demagnetisation curve of the sample sintered at 920 °C showed reduced rectangularity and this was attributed to a cooperative effect of the larger fraction of abnormal grains with low switching field and, as a minor effect, a reduced degree of crystallographic texture in this sample compared to the material sintered at 980 °C, which did not show the reduced rectangularity of the demagnetisation curve. - Highlights: • He Jet milling to reduce Nd-Fe-B grain size and to enhance coercivity. • Normal and abnormal grain growth observed for low temperature sintering. • Well oriented abnormal grown grains explained by size dependent field alignment. • Poor rectangularity is caused by low nucleation field of
International Nuclear Information System (INIS)
Bittner, F.; Woodcock, T.G.; Schultz, L.; Schwöbel, C.; Gutfleisch, O.; Zickler, G.A.; Fidler, J.; Üstüner, K.; Katter, M.
2017-01-01
Fine-grained, heavy rare earth free Nd-Fe-B sintered magnets were prepared from He jet milled powders with an average particle size of 1.5 µm by low temperature sintering at 920 °C or 980 °C. A coercivity of >1600 kA/m was achieved for an average grain size of 1.68 µm. Transmission electron microscopy showed that the distribution and composition of intergranular and grain boundary junction phases was similar to that in conventionally processed magnets. Microstructural analysis on different length scales revealed the occurrence of abnormal grain growth, which is unexpected for sintering temperatures below 1000 °C. A larger area fraction of abnormal grains was observed in the sample sintered at 920 °C compared to that sintered at 980 °C. Microtexture investigation showed a better crystallographic alignment of the abnormal grains compared to the fine-grained matrix, which is explained by a size dependent alignment of the powder particles during magnetic field alignment prior to sintering. Slightly larger particles in the initial powder show a better alignment and will act as nucleation sites for abnormal grain growth. Magneto-optical Kerr investigations confirmed the lower switching field of the abnormal grains compared to the fine-grained matrix. The demagnetisation curve of the sample sintered at 920 °C showed reduced rectangularity and this was attributed to a cooperative effect of the larger fraction of abnormal grains with low switching field and, as a minor effect, a reduced degree of crystallographic texture in this sample compared to the material sintered at 980 °C, which did not show the reduced rectangularity of the demagnetisation curve. - Highlights: • He Jet milling to reduce Nd-Fe-B grain size and to enhance coercivity. • Normal and abnormal grain growth observed for low temperature sintering. • Well oriented abnormal grown grains explained by size dependent field alignment. • Poor rectangularity is caused by low nucleation field of
Physical properties of five grain dust types.
Parnell, C B; Jones, D D; Rutherford, R D; Goforth, K J
1986-01-01
Physical properties of grain dust derived from five grain types (soybean, rice, corn, wheat, and sorghum) were measured and reported. The grain dusts were obtained from dust collection systems of terminal grain handling facilities and were assumed to be representative of grain dust generated during the handling process. The physical properties reported were as follows: particle size distributions and surface area measurements using a Coulter Counter Model TAII; percent dust fractions less tha...
Efficient radiative transfer in dust grain mixtures
Wolf, S.
2002-01-01
The influence of a dust grain mixture consisting of spherical dust grains with different radii and/or chemical composition on the resulting temperature structure and spectral energy distribution of a circumstellar shell is investigated. The comparison with the results based on an approximation of dust grain parameters representing the mean optical properties of the corresponding dust grain mixture reveal that (1) the temperature dispersion of a real dust grain mixture decreases substantially ...
International Nuclear Information System (INIS)
Ahmed, K.; Tonks, M.; Zhang, Y.; Biner, B.
2016-01-01
A detailed phase field model for the effect of pore drag on grain growth kinetics was implemented in MARMOT. The model takes into consideration both the curvature-driven grain boundary motion and pore migration by surface diffusion. As such, the model accounts for the interaction between pore and grain boundary kinetics, which tends to retard the grain growth process. Our 2D and 3D simulations demonstrate that the model capture all possible pore-grain boundary interactions proposed in theoretical models. For high enough surface mobility, the pores move along with the migrating boundary as a quasi-rigid-body, albeit hindering its migration rate compared to the pore-free case. For less mobile pores, the migrating boundary can separate from the pores. For the pore-controlled grain growth kinetics, the model predicts a strong dependence of the growth rate on the number of pores, pore size, and surface diffusivity in agreement with theroretical models. An evolution equation for the grain size that includes these parameters was derived and showed to agree well with numerical solution. It shows a smooth transition from boundary-controlled kinetics to pore-controlled kinetics as the surface diffusivity decreases or the number of pores or their size increases. This equation can be utilized in BISON to give accurate estimate for the grain size evolution. This will be accomplished in the near future. The effect of solute drag and anisotropy of grain boundary on grain growth will be investigated in future studies.
Physics of dust grains in hot gas
International Nuclear Information System (INIS)
Draine, B.T.; Salpeter, E.E.
1979-01-01
Charging of dust grains in hot (10 4 --10 9 K) plasma is studied, including photoelectron and secondary electron emission, field emission, and transmission of electrons and ions through the grain; resulting grain potentials are (for T > or approx. = 10 5 K) considerably smaller in magnitude than found by Burke and Silk. Even so, large electrostatic stresses can cause ion field emission and rapid destruction of small grains in very hot gas. Rapid rotation can also disrupt small grains, but damping (by microwave emission) usually limits the centrifugal stress to acceptable values for plasma densities n/sub H/ -3 . Sputtering rates are estimated for grains in hot gas, based upon a semiempirical fit to experimental data. Predicted sputtering rates for possible grain constituents are similar to estimates by Barlow, but in some cases differ significantly. Useful approximation formulae are given for the drag forces acting on a grain with arbitrary Mach number
Managing for Multifunctionality in Perennial Grain Crops
Ryan, Matthew R; Crews, Timothy E; Culman, Steven W; DeHaan, Lee R; Hayes, Richard C; Jungers, Jacob M; Bakker, Matthew G
2018-01-01
Abstract Plant breeders are increasing yields and improving agronomic traits in several perennial grain crops, the first of which is now being incorporated into commercial food products. Integration strategies and management guidelines are needed to optimize production of these new crops, which differ substantially from both annual grain crops and perennial forages. To offset relatively low grain yields, perennial grain cropping systems should be multifunctional. Growing perennial grains for several years to regenerate soil health before rotating to annual crops and growing perennial grains on sloped land and ecologically sensitive areas to reduce soil erosion and nutrient losses are two strategies that can provide ecosystem services and support multifunctionality. Several perennial cereals can be used to produce both grain and forage, and these dual-purpose crops can be intercropped with legumes for additional benefits. Highly diverse perennial grain polycultures can further enhance ecosystem services, but increased management complexity might limit their adoption. PMID:29662249
CSIR Research Space (South Africa)
Nabarro, FRN
1998-11-13
Full Text Available of length b (1+ epsilon) is parallel to sigma, embedded in a grain in which the lattice vector b (1+ epsilon) is transverse to sigma. If the embedded grain grows at the expense of its matrix, the source of the stress will do work, and therefore the presence...
DEFF Research Database (Denmark)
Neal, Andrew L; Geraki, Kalotina; Borg, Søren
2013-01-01
of modified complexation of both metals in transgenic grain overexpressing wheat ferritin. For zinc, there is a consistent doubling of the number of complexing phosphorus atoms. Although there is some EXAFS evidence for iron phytate in ferritin-expressing grain, there is also evidence of a structure lacking......We have used synchrotron-based X-ray fluorescence and absorption techniques to establish both metal distribution and complexation in mature wheat grains. In planta, extended X-ray absorption fine structure (EXAFS) spectroscopy reveals iron phytate and zinc phytate structures in aleurone cells...... of ferritin-expressing grains is quite different from that in wild-type grain. This may explain why the raised levels of minerals transported to the developing grain accumulate within the crease region of the transgenic grain....
Directory of Open Access Journals (Sweden)
Florian Steinbach
2017-09-01
Full Text Available The flow of ice depends on the properties of the aggregate of individual ice crystals, such as grain size or lattice orientation distributions. Therefore, an understanding of the processes controlling ice micro-dynamics is needed to ultimately develop a physically based macroscopic ice flow law. We investigated the relevance of the process of grain dissection as a grain-size-modifying process in natural ice. For that purpose, we performed numerical multi-process microstructure modeling and analyzed microstructure and crystallographic orientation maps from natural deep ice-core samples from the North Greenland Eemian Ice Drilling (NEEM project. Full crystallographic orientations measured by electron backscatter diffraction (EBSD have been used together with c-axis orientations using an optical technique (Fabric Analyser. Grain dissection is a feature of strain-induced grain boundary migration. During grain dissection, grain boundaries bulge into a neighboring grain in an area of high dislocation energy and merge with the opposite grain boundary. This splits the high dislocation-energy grain into two parts, effectively decreasing the local grain size. Currently, grain size reduction in ice is thought to be achieved by either the progressive transformation from dislocation walls into new high-angle grain boundaries, called subgrain rotation or polygonisation, or bulging nucleation that is assisted by subgrain rotation. Both our time-resolved numerical modeling and NEEM ice core samples show that grain dissection is a common mechanism during ice deformation and can provide an efficient process to reduce grain sizes and counter-act dynamic grain-growth in addition to polygonisation or bulging nucleation. Thus, our results show that solely strain-induced boundary migration, in absence of subgrain rotation, can reduce grain sizes in polar ice, in particular if strain energy gradients are high. We describe the microstructural characteristics that can be
Steinbach, Florian; Kuiper, Ernst-Jan N.; Eichler, Jan; Bons, Paul D.; Drury, Martyn R.; Griera, Albert; Pennock, Gill M.; Weikusat, Ilka
2017-09-01
The flow of ice depends on the properties of the aggregate of individual ice crystals, such as grain size or lattice orientation distributions. Therefore, an understanding of the processes controlling ice micro-dynamics is needed to ultimately develop a physically based macroscopic ice flow law. We investigated the relevance of the process of grain dissection as a grain-size-modifying process in natural ice. For that purpose, we performed numerical multi-process microstructure modelling and analysed microstructure and crystallographic orientation maps from natural deep ice-core samples from the North Greenland Eemian Ice Drilling (NEEM) project. Full crystallographic orientations measured by electron backscatter diffraction (EBSD) have been used together with c-axis orientations using an optical technique (Fabric Analyser). Grain dissection is a feature of strain-induced grain boundary migration. During grain dissection, grain boundaries bulge into a neighbouring grain in an area of high dislocation energy and merge with the opposite grain boundary. This splits the high dislocation-energy grain into two parts, effectively decreasing the local grain size. Currently, grain size reduction in ice is thought to be achieved by either the progressive transformation from dislocation walls into new high-angle grain boundaries, called subgrain rotation or polygonisation, or bulging nucleation that is assisted by subgrain rotation. Both our time-resolved numerical modelling and NEEM ice core samples show that grain dissection is a common mechanism during ice deformation and can provide an efficient process to reduce grain sizes and counter-act dynamic grain-growth in addition to polygonisation or bulging nucleation. Thus, our results show that solely strain-induced boundary migration, in absence of subgrain rotation, can reduce grain sizes in polar ice, in particular if strain energy gradients are high. We describe the microstructural characteristics that can be used to
Bioactive compounds in whole grain wheat
Mateo Anson, N.
2010-01-01
Bread can be healthier! Consuming whole-grain foods can prevent cardiovascular diseases, type-2 diabetes and metabolic syndrome. This is due to bioactive compounds in whole grain, such as antioxidants and anti-inflammatory compounds. We found that the different fractions of a wheat grain vary much
Grain processes in massive star formation
International Nuclear Information System (INIS)
Wolfire, M.G.; Cassinelli, J.P.
1986-01-01
Observational evidence suggests that stars greater than 100 M(solar) exist in the Galaxy and Large Magellanic Cloud (LMC), however classical star formation theory predicts stellar mass limits of only approx. 60 M(solar). A protostellar accretion flow consists of inflowing gas and dust. Grains are destroyed as they are near the central protostar creating a dust shell or cocoon. Radiation pressure acting on the grain can halt the inflow of material thereby limiting the amount of mass accumulated by the protostar. We first consider rather general constraints on the initial grain to gas ratio and mass accretion rates that permit inflow. We further constrain these results by constructing a numerical model. Radiative deceleration of grains and grain destruction processes are explicitly accounted for in an iterative solution of the radiation-hydrodynamic equations. Findings seem to suggest that star formation by spherical accretion requires rather extreme preconditioning of the grain and gas environment
Huang, Ke; Wang, Dekai; Duan, Penggen; Zhang, Baolan; Xu, Ran; Li, Na; Li, Yunhai
2017-09-01
Grain size and shape are two crucial traits that influence grain yield and grain appearance in rice. Although several factors that affect grain size have been described in rice, the molecular mechanisms underlying the determination of grain size and shape are still elusive. In this study we report that WIDE AND THICK GRAIN 1 (WTG1) functions as an important factor determining grain size and shape in rice. The wtg1-1 mutant exhibits wide, thick, short and heavy grains and also shows an increased number of grains per panicle. WTG1 determines grain size and shape mainly by influencing cell expansion. WTG1 encodes an otubain-like protease, which shares similarity with human OTUB1. Biochemical analyses indicate that WTG1 is a functional deubiquitinating enzyme, and the mutant protein (wtg1-1) loses this deubiquitinating activity. WTG1 is expressed in developing grains and panicles, and the GFP-WTG1 fusion protein is present in the nucleus and cytoplasm. Overexpression of WTG1 results in narrow, thin, long grains due to narrow and long cells, further supporting the role of WTG1 in determining grain size and shape. Thus, our findings identify the otubain-like protease WTG1 to be an important factor that determines grain size and shape, suggesting that WTG1 has the potential to improve grain size and shape in rice. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Sustainable production of grain crops for biofuels
Grain crops of the Gramineae are grown for their edible, starchy seeds. Their grain is used directly for human food, livestock feed, and as raw material for many industries, including biofuels. Using grain crops for non-food uses affects the amount of food available to the world. Grain-based biofuel...
Effects of grain-producing cover crops on rice grain yield in Cabo Delgado, Mozambique
Directory of Open Access Journals (Sweden)
Adriano Stephan Nascente
Full Text Available ABSTRACT Besides providing benefits to the environment such as soil protection, release of nutrients, soil moisture maintenance, and weed control, cover crops can increase food production for grain production. The aim of this study was to evaluate the production of biomass and grain cover crops (and its respective effects on soil chemical and physical attributes, yield components, and grain yield of rice in Mozambique. The study was conducted in two sites located in the province of Cabo Delgado, in Mozambique. The experimental design was a randomized block in a 2 × 6 factorial, with four repetitions. Treatments were carried out in two locations (Cuaia and Nambaua with six cover crops: Millet (Pennisetum glaucum L.; namarra bean (Lablab purpureus (L. Sweet, velvet beans (Mucuna pruriens L., oloco beans (Vigna radiata (L. R. Wilczek, cowpea (Vigna unguiculata L., and fallow. Cover crops provided similar changes in chemical and physical properties of the soil. Lablab purpureus, Vigna unguiculata, and Mucuna pruriens produced the highest dry matter biomass. Vigna unguiculada produced the highest amount of grains. Rice grain yields were similar under all cover crops and higher in Cuaia than Nambaua.
Storlazzi, Curt; Norris, Benjamin; Rosenberger, Kurt
2015-01-01
Sediment has been shown to be a major stressor to coral reefs globally. Although many researchers have tested the impact of sedimentation on coral reef ecosystems in both the laboratory and the field and some have measured the impact of suspended sediment on the photosynthetic response of corals, there has yet to be a detailed investigation on how properties of the sediment itself can affect light availability for photosynthesis. We show that finer-grained and darker-colored sediment at higher suspended-sediment concentrations attenuates photosynthetically active radiation (PAR) significantly more than coarser, lighter-colored sediment at lower concentrations and provide PAR attenuation coefficients for various grain sizes, colors, and suspended-sediment concentrations that are needed for biophysical modeling. Because finer-grained sediment particles settle more slowly and are more susceptible to resuspension, they remain in the water column longer, thus causing greater net impact by reducing light essential for photosynthesis over a greater duration. This indicates that coral reef monitoring studies investigating sediment impacts should concentrate on measuring fine-grained lateritic and volcanic soils, as opposed to coarser-grained siliceous and carbonate sediment. Similarly, coastal restoration efforts and engineering solutions addressing long-term coral reef ecosystem health should focus on preferentially retaining those fine-grained soils rather than coarse silt and sand particles.
Whole grain gluten-free egg-free pasta
The USDA food guide recommends that at least ½ of all the grains eaten should be whole grains. The FDA allows food Health Claim labels for food containing 51% whole grains and 11 g of dietary fiber. This is the only report demonstrating innovative whole grain gluten free, egg free (no chemicals adde...
Energy Technology Data Exchange (ETDEWEB)
Challa, V.S.A. [Laboratory for Excellence in Advanced Steel Research, Department of Metallurgical, Materials Engineering, and Biomedical Engineering, University of Texas at El Paso, El Paso, TX 79968 (United States); Misra, R.D.K., E-mail: dmisra2@utep.edu [Laboratory for Excellence in Advanced Steel Research, Department of Metallurgical, Materials Engineering, and Biomedical Engineering, University of Texas at El Paso, El Paso, TX 79968 (United States); Somani, M.C. [Center for Advanced Steels Research, The University of Oulu, P.O. Box 4200, 90014 Oulu (Finland); Wang, Z.D. [State Key Laboratory for Rolling and Automation, Northeastern University, 3-11 Wenhua Road, Shenyang 110819 (China)
2016-04-20
Nanograined/ultrafine-grained (NG/UFG) materials characterized by high strength-high ductility combination are excellent vehicles to obtain an unambiguous understanding of deformation mechanisms vis-à-vis their coarse-grained counterparts. In this context, the innovative concept of phase reversion-induced NG/UFG structure enabled achieving high strength besides comparable ductility, for instance, in metastable austenitic stainless steels. In the phase reversion process, severe deformation of austenite at room temperature (typically ~60–80%) transforms face-centered cubic austenite (γ) to body centered cubic martensite (α′). Upon annealing, martensite reverts to austenite leading to extensive grain refinement. The objective of the present study to fundamentally understand the deformation mechanisms in NG/UFG structure in relation to that of the coarse-grained (CG) structure was accomplished by combining depth-sensing nanoscale experiments on an Fe-16Cr-10Ni model austenitic alloy conducted at different strain rates, followed by the study of structural evolution in the deformed zone using transmission electron microscopy (TEM). In the high strength NG/UFG steel (YS~585 MPa), stacking faults and nanotwins contributed to the enhanced ductility (El~35%), while in the case of low strength (YS~260 MPa) coarse-grained (CG) counterpart, ductility was also high (El~40%), but chiefly due to strain-induced martensite, which points to a clear case of grain size effect (and the corresponding level of strength). The distinct change in the deformation mechanism from stacking faults and twinning-induced plasticity (TWIP) in the NG structure to transformation-induced plasticity (TRIP) in the CG structure is elucidated in terms of austenite stability-strain energy relationship. The insights on the relationship between grain structure (and strength) and deformation mechanisms are envisaged to be important in providing a new direction for the futuristic design of high strength
Deformation inhomogeneity in large-grained AA5754 sheets
International Nuclear Information System (INIS)
Zhu Guozhen; Hu Xiaohua; Kang Jidong; Mishra, Raja K.; Wilkinson, David S.
2011-01-01
Research highlights: → Microstructure and strain relationship at individual grain level was studied. → 'Hot spots' nucleate early and most keep growing throughout deformation stages. → 'Hot spots' are correlated with 'soft' grains and soft-evolution grains. → Grains with high Schmid factors tend to be 'soft' grains. → Grains with the direction close to tensile axis tend to become softer. - Abstract: Models for deformation and strain localization in polycrystals that incorporate microstructural features including particles are computationally intensive due to the large variation in scale in going from particles to grains to a specimen. As a result such models are generally 2-D in nature. This is an issue for experimental validation. We have therefore studied deformation heterogeneities and strain localization behavior of coarse-grained alloys with only two grains across the sample thickness, therefore mimicking 2-D behavior. Aluminum alloy sheets (AA5754) have been investigated by a number of surface techniques, including digital image correlation, slip trace analysis and electron backscattered diffraction, at the individual grain level. Local strain concentration zones appear from the very beginning of deformation, which then maintain sustained growth and lead, in one of these regions, to localization and final fracture. These 'hot spots' occur in areas with locally soft grains (i.e. grains with or close to the tensile direction) and soft-evolution orientations (i.e. grains with close to the tensile direction). These grains can be correlated with Taylor and/or Schmid factors.
Tracing magnetic fields with aligned grains
International Nuclear Information System (INIS)
Lazarian, A.
2007-01-01
Magnetic fields play a crucial role in various astrophysical processes, including star formation, accretion of matter, transport processes (e.g., transport of heat), and cosmic rays. One of the easiest ways to determine the magnetic field direction is via polarization of radiation resulting from extinction or/and emission by aligned dust grains. Reliability of interpretation of the polarization maps in terms of magnetic fields depends on how well we understand the grain-alignment theory. Explaining what makes grains aligned has been one of the big issues of the modern astronomy. Numerous exciting physical effects have been discovered in the course of research undertaken in this field. As both the theory and observations matured, it became clear that the grain-alignment phenomenon is inherent not only in diffuse interstellar medium or molecular clouds but also is a generic property of the dust in circumstellar regions, interplanetary space and cometary comae. Currently the grain-alignment theory is a predictive one, and its results nicely match observations. Among its predictions is a subtle phenomenon of radiative torques. This phenomenon, after having stayed in oblivion for many years after its discovery, is currently viewed as the most powerful means of alignment. In this article, I shall review the basic physical processes involved in grain alignment, and the currently known mechanisms of alignment. I shall also discuss possible niches for different alignment mechanisms. I shall dwell on the importance of the concept of grain helicity for understanding of many properties of grain alignment, and shall demonstrate that rather arbitrarily shaped grains exhibit helicity when they interact with gaseous and radiative flows
Grain-size distributions and grain boundaries of chalcopyrite-type thin films
International Nuclear Information System (INIS)
Abou-Ras, D.; Schorr, S.; Schock, H.W.
2007-01-01
CuInSe 2 , CuGaSe 2 , Cu(In,Ga)Se 2 and CuInS 2 thin-film solar absorbers in completed solar cells were studied in cross section by means of electronbackscatter diffraction. From the data acquired, grain-size distributions were extracted, and also the most frequent grain boundaries were determined. The grain-size distributions of all chalcopyrite-type thin films studied can be described well by lognormal distribution functions. The most frequent grainboundary types in these thin films are 60 - left angle 221 right angle tet and 71 - left angle 110 right angle tet (near) Σ3 twin boundaries. These results can be related directly to the importance of {112} tet planes during the topotactical growth of chalcopyrite-type thin films. Based on energetic considerations, it is assumed that the most frequent twin boundaries exhibit a 180 - left angle 221 right angle tet constellation. (orig.)
Grain Unloading of Arsenic Species in Rice
Energy Technology Data Exchange (ETDEWEB)
Carey, Anne-Marie; Scheckel, Kirk G.; Lombi, Enzo; Newville, Matt; Choi, Yongseong; Norton, Gareth J.; Charnock, John M.; Feldmann, Joerg; Price, Adam H.; Meharg, Andrew A. (EPA); (U. South Australia); (Manchester); (Aberdeen); (UC)
2010-01-11
Rice (Oryza sativa) is the staple food for over half the world's population yet may represent a significant dietary source of inorganic arsenic (As), a nonthreshold, class 1 human carcinogen. Rice grain As is dominated by the inorganic species, and the organic species dimethylarsinic acid (DMA). To investigate how As species are unloaded into grain rice, panicles were excised during grain filling and hydroponically pulsed with arsenite, arsenate, glutathione-complexed As, or DMA. Total As concentrations in flag leaf, grain, and husk, were quantified by inductively coupled plasma mass spectroscopy and As speciation in the fresh grain was determined by x-ray absorption near-edge spectroscopy. The roles of phloem and xylem transport were investigated by applying a {+-} stem-girdling treatment to a second set of panicles, limiting phloem transport to the grain in panicles pulsed with arsenite or DMA. The results demonstrate that DMA is translocated to the rice grain with over an order magnitude greater efficiency than inorganic species and is more mobile than arsenite in both the phloem and the xylem. Phloem transport accounted for 90% of arsenite, and 55% of DMA, transport to the grain. Synchrotron x-ray fluorescence mapping and fluorescence microtomography revealed marked differences in the pattern of As unloading into the grain between DMA and arsenite-challenged grain. Arsenite was retained in the ovular vascular trace and DMA dispersed throughout the external grain parts and into the endosperm. This study also demonstrates that DMA speciation is altered in planta, potentially through complexation with thiols.
Grain boundary corrosion of copper canister material
International Nuclear Information System (INIS)
Fennell, P.A.H.; Graham, A.J.; Smart, N.R.; Sofield, C.J.
2001-03-01
The proposed design for a final repository for spent fuel and other long-lived residues in Sweden is based on the multi-barrier principle. The waste will be encapsulated in sealed cylindrical canisters, which will then be placed in granite bedrock and surrounded by compacted bentonite clay. The canister design is based on a thick cast inner container fitted inside a corrosion-resistant copper canister. During fabrication of the outer copper canisters there will be some unavoidable grain growth in the welded areas. As grains grow they will tend to concentrate impurities within the copper at the new grain boundaries. The work described in this report was undertaken to determine whether there is any possibility of enhanced corrosion at grain boundaries within the copper canister. The potential for grain boundary corrosion was investigated by exposing copper specimens, which had undergone different heat treatments and hence had different grain sizes, to aerated artificial bentonite-equilibrated groundwater with two concentrations of chloride, for increasing periods of time. The degree of grain boundary corrosion was determined by atomic force microscopy (AFM) and optical microscopy. AFM showed no increase in grain boundary 'ditching' for low chloride groundwater. In high chloride groundwater the surface was covered uniformly with a fine-grained oxide. No increases in oxide thickness were observed. No significant grain boundary attack was observed using optical microscopy either. The work suggests that in aerated artificial groundwaters containing chloride ions, grain boundary corrosion of copper is unlikely to adversely affect SKB's copper canisters
7 CFR 810.801 - Definition of mixed grain.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of mixed grain. 810.801 Section 810.801 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... GRAIN United States Standards for Mixed Grain Terms Defined § 810.801 Definition of mixed grain. Any...
Nanoscale abnormal grain growth in (001) epitaxial ceria
International Nuclear Information System (INIS)
Solovyov, Vyacheslav F.; Develos-Bagarinao, Katherine; Nykypanchuk, Dmytro
2009-01-01
X-ray reciprocal-space mapping and atomic force microscopy (AFM) are used to study kinetics and mechanisms of lateral grain growth in epitaxial (001) ceria (CeO 2 ) deposited by pulsed laser deposition on (001) yttria-stabilized zirconia (YSZ) and (12 lowbar 10) (r-cut) sapphire. Rate and character of the grain growth during postannealing at 1050 deg. C are found to be strongly dependent on the type of the epitaxial substrate. Films deposited on YSZ exhibit signatures of normal grain growth, which stagnated after the lateral grain size reaches 40 nm, consistent with the grain-boundary pinning by the thermal grooving. In contrast, when r-cut sapphire substrate was used, abnormal (secondary) grain growth is observed. A small population of grains grow to well over 100 nm consuming smaller, 100 nm large (001) terminations and rendering the sample single-crystalline quality. The grain growth is accompanied by reduction in lateral rms strain, resulting in a universal grain size--rms strain dependence. Analysis of the AFM and x-ray diffraction data leads to the conclusion that bimodal initial grain population consisting of grains with very different sizes is responsible for initiation of the abnormal growth in (001) CeO 2 films on r-cut sapphire. Due to different surface chemistry, when a YSZ substrate is used, the initial grain distribution is monomodal, therefore only normal growth is active. We demonstrate that a 2.2 deg. miscut of the sapphire substrate eliminates the large-grain population, thus suppressing abnormal grain growth. It is concluded that utilization of abnormal grain growth is a promising way for synthesis of large (001) ceria terminations.
Physical properties of five grain dust types.
Parnell, C B; Jones, D D; Rutherford, R D; Goforth, K J
1986-01-01
Physical properties of grain dust derived from five grain types (soybean, rice, corn, wheat, and sorghum) were measured and reported. The grain dusts were obtained from dust collection systems of terminal grain handling facilities and were assumed to be representative of grain dust generated during the handling process. The physical properties reported were as follows: particle size distributions and surface area measurements using a Coulter Counter Model TAII; percent dust fractions less than 100 micron of whole dust; bulk density; particle density; and ash content. PMID:3709482
Observation of changing crystal orientations during grain coarsening
International Nuclear Information System (INIS)
Sharma, Hemant; Huizenga, Richard M.; Bytchkov, Aleksei; Sietsma, Jilt; Offerman, S. Erik
2012-01-01
Understanding the underlying mechanisms of grain coarsening is important in controlling the properties of metals, which strongly depend on the microstructure that forms during the production process or during use at high temperature. Grain coarsening of austenite at 1273 K in a binary Fe–2 wt.% Mn alloy was studied using synchrotron radiation. Evolution of the volume, average crystallographic orientation and mosaicity of more than 2000 individual austenite grains was tracked during annealing. It was found that an approximately linear relationship exists between grain size and mosaicity, which means that orientation gradients are present in the grains. The orientation gradients remain constant during coarsening and consequently the character of grain boundaries changes during coarsening, affecting the coarsening rate. Furthermore, changes in the average orientation of grains during coarsening were observed. The changes could be understood by taking the observed orientation gradients and anisotropic movement of grain boundaries into account. Five basic modes of grain coarsening were deduced from the measurements, which include: anisotropic (I) and isotropic (II) growth (or shrinkage); movement of grain boundaries resulting in no change in volume but a change in shape (III); movement of grain boundaries resulting in no change in volume and mosaicity, but a change in crystallographic orientation (IV); no movement of grain boundaries (V).
DEFF Research Database (Denmark)
Winther, Grethe; Wright, Jonathan P.; Schmidt, Søren
2017-01-01
environments representing the bulk texture, yet their deformation-induced rotations are very different. The ALAMEL model is employed to analyse the grain interaction mechanisms. Predictions of this model qualitatively agree with the directionality and magnitude of the experimental orientation spread. However......, quantitative agreement requires fine-tuning of the boundary conditions. The majority of the modelled slip is accounted for by four slip systems also predicted to be active by the classical Taylor model in uniaxial tension, and most of the orientation spread along the grain boundaries is caused by relative...... variations in the activities of these. Although limited to two grains, the findings prove that shear at the grain boundaries as accounted for by the ALAMEL model is a dominant grain interaction mechanism....
Grain interaction effects in polycrystalline Cu
DEFF Research Database (Denmark)
Thorning, C.; Somers, Marcel A.J.; Wert, John A.
2005-01-01
Crystal orientation maps for a grain in a deformed Cu polycrystal have been analysed with the goal of understanding the effect of grain interactions on orientation subdivision. The polycrystal was incrementally strained in tension to 5, 8, 15 and 25% extension; a crystal orientation map...... was measured after each strain increment. The measurements are represented as rotations from the initial crystal orientation. A coarse domain structure forms in the initial 5% strain increment and persists at higher strains. Crystal rotations for all coarse domains in the grain are consistent with the full...... range of Tailor solutions for axisymmetric strain; grain interactions are not required to account for the coarse domain structure. Special orientation domains extend 20-100 µm into the grain at various locations around its periphery. The special orientation domain morphologies include layers along...
Improving detection probabilities for pests in stored grain.
Elmouttie, David; Kiermeier, Andreas; Hamilton, Grant
2010-12-01
The presence of insects in stored grain is a significant problem for grain farmers, bulk grain handlers and distributors worldwide. Inspection of bulk grain commodities is essential to detect pests and thereby to reduce the risk of their presence in exported goods. It has been well documented that insect pests cluster in response to factors such as microclimatic conditions within bulk grain. Statistical sampling methodologies for grain, however, have typically considered pests and pathogens to be homogeneously distributed throughout grain commodities. In this paper, a sampling methodology is demonstrated that accounts for the heterogeneous distribution of insects in bulk grain. It is shown that failure to account for the heterogeneous distribution of pests may lead to overestimates of the capacity for a sampling programme to detect insects in bulk grain. The results indicate the importance of the proportion of grain that is infested in addition to the density of pests within the infested grain. It is also demonstrated that the probability of detecting pests in bulk grain increases as the number of subsamples increases, even when the total volume or mass of grain sampled remains constant. This study underlines the importance of considering an appropriate biological model when developing sampling methodologies for insect pests. Accounting for a heterogeneous distribution of pests leads to a considerable improvement in the detection of pests over traditional sampling models. Copyright © 2010 Society of Chemical Industry.
Three dimensional grain boundary modeling in polycrystalline plasticity
Yalçinkaya, Tuncay; Özdemir, Izzet; Fırat, Ali Osman
2018-05-01
At grain scale, polycrystalline materials develop heterogeneous plastic deformation fields, localizations and stress concentrations due to variation of grain orientations, geometries and defects. Development of inter-granular stresses due to misorientation are crucial for a range of grain boundary (GB) related failure mechanisms, such as stress corrosion cracking (SCC) and fatigue cracking. Local crystal plasticity finite element modelling of polycrystalline metals at micron scale results in stress jumps at the grain boundaries. Moreover, the concepts such as the transmission of dislocations between grains and strength of the grain boundaries are not included in the modelling. The higher order strain gradient crystal plasticity modelling approaches offer the possibility of defining grain boundary conditions. However, these conditions are mostly not dependent on misorientation of grains and can define only extreme cases. For a proper definition of grain boundary behavior in plasticity, a model for grain boundary behavior should be incorporated into the plasticity framework. In this context, a particular grain boundary model ([l]) is incorporated into a strain gradient crystal plasticity framework ([2]). In a 3-D setting, both bulk and grain boundary models are implemented as user-defined elements in Abaqus. The strain gradient crystal plasticity model works in the bulk elements and considers displacements and plastic slips as degree of freedoms. Interface elements model the plastic slip behavior, yet they do not possess any kind of mechanical cohesive behavior. The physical aspects of grain boundaries and the performance of the model are addressed through numerical examples.
Directory of Open Access Journals (Sweden)
Pržulj Novo
2011-01-01
Full Text Available In wheat, rate and duration of dry matter accumulation and remobilization depend on genotype and growing conditions. The objective of this study was to determine the most appropriate polynomial regression of stepwise regression procedure for describing grain filling period in three winter wheat cultivars. The stepwise regression procedure showed that grain filling is a complex biological process and that it is difficult to offer a simple and appropriate polynomial equation that fits the pattern of changes in dry matter accumulation during the grain filling period, i.e., from anthesis to maximum grain weight, in winter wheat. If grain filling is to be represented with a high power polynomial, quartic and quintic equations showed to be most appropriate. In spite of certain disadvantages, a cubic equation of stepwise regression could be used for describing the pattern of winter wheat grain filling.
The Pinning by Particles of Low and High Angle Grain Boundaries during Grain Growth
DEFF Research Database (Denmark)
Tweed, C.J.; Ralph, B.; Hansen, Niels
1984-01-01
A study has been made using transmission electron microscopy of the pinning of grain boundaries in aluminium during grain growth by fine dispersions of alumina particles. The boundary parameters have been determined with precision and the pinning effects measured using an approach due to Ashby...
PESTICIDES USE AMONG GRAIN MERCHANTS IN MUBI GRAIN ...
African Journals Online (AJOL)
AGROSEARCH UIL
pose the greatest threat to increased food production, storage and handling ... are to: assess pest control practices of grain merchants in Mubi markets with a .... This further cements the fact that multiple routes of contaminations are possible.
Diffusion mechanisms in grain boundaries in solids
International Nuclear Information System (INIS)
Peterson, N.L.
1982-01-01
A critical review is given of our current knowledge of grain-boundary diffusion in solids. A pipe mechanism of diffusion based on the well-established dislocation model seems most appropriate for small-angle boundaries. Open channels, which have atomic configurations somewhat like dislocation cores, probably play a major role in large-angle grain-boundary diffusion. Dissociated dislocations and stacking faults are not efficient paths for grain-boundary diffusion. The diffusion and computer modeling experiments are consistent with a vacancy mechanism of diffusion by a rather well-localized vacancy. The effective width of a boundary for grain-boundary diffusion is about two atomic planes. These general features of grain-boundary diffusion, deduced primarily from experiments on metals, are thought to be equally applicable for pure ceramic solids. The ionic character of many ceramic oxides may cause some differences in grain-boundary structure from that observed in metals, resulting in changes in grain-boundary diffusion behavior. 72 references, 5 figures
Experiments on Dust Grain Charging
Abbas, M. N.; Craven, P. D.; Spann, J. F.; Tankosic, D.; LeClair, A.; West, E. A.
2004-01-01
Dust particles in various astrophysical environments are charged by a variety of mechanisms generally involving collisional processes with other charged particles and photoelectric emission with UV radiation from nearby sources. The sign and the magnitude of the particle charge are determined by the competition between the charging processes by UV radiation and collisions with charged particles. Knowledge of the particle charges and equilibrium potentials is important for understanding of a number of physical processes. The charge of a dust grain is thus a fundamental parameter that influences the physics of dusty plasmas, processes in the interplanetary medium and interstellar medium, interstellar dust clouds, planetary rings, cometary and outer atmospheres of planets etc. In this paper we present some results of experiments on charging of dust grains carried out on a laboratory facility capable levitating micron size dust grains in an electrodynamic balance in simulated space environments. The charging/discharging experiments were carried out by exposing the dust grains to energetic electron beams and UV radiation. Photoelectric efficiencies and yields of micron size dust grains of SiO2, and lunar simulates obtained from NASA-JSC will be presented.
Dynamics of interplanetary dust grains
International Nuclear Information System (INIS)
Lamy, P.L.
1975-01-01
The interaction of spherical grains of various materials-three silicates (quartz, obsidian and andesite), water-ice and iron - whose radii lie in the micronic and submicronic range with the interplanetary medium is solved. This includes: the interaction with the solar radiation field which is solved using Mie scattering theory and taking into account the precise dependence of the optical properties of the five materials upon wavelength; the interaction with the solar wind: corpuscular tangential drag is found to be always important and may even be larger than the Poynting-Robertson drag; the interaction with the interplanetary magnetic field is investigated in terms of a diffusion or random walk through a series of electromagnetic scatterings, leading to a Chapman-Komolgorov equation (i.e., a generalized Liouville equation). Numerical results are presented for these interactions spanning the entire solar system with circularity of elliptical orbits, direct or retrograde, with grains of various materials and sizes and giving -probably for the first time - a clear global picture of the interaction of dust grains with the interplanetary medium. The dynamics of the grains is then investigated using the theory of general perturbations and the numerical integration of trajectories of circum-solar grains
Staroske, Nicole; Conrad, Udo; Kumlehn, Jochen; Hensel, Götz; Radchuk, Ruslana; Erban, Alexander; Kopka, Joachim; Weschke, Winfriede; Weber, Hans
2016-04-01
Abscisic acid (ABA) accumulates in seeds during the transition to the seed filling phase. ABA triggers seed maturation, storage activity, and stress signalling and tolerance. Immunomodulation was used to alter the ABA status in barley grains, with the resulting transgenic caryopses responding to the anti-ABA antibody gene expression with increased accumulation of ABA. Calculation of free versus antibody-bound ABA reveals large excess of free ABA, increasing signficantly in caryopses from 10 days after fertilization. Metabolite and transcript profiling in anti-ABA grains expose triggered and enhanced ABA-functions such as transcriptional up-regulation of sucrose-to-starch metabolism, storage protein synthesis and ABA-related signal transduction. Thus, enhanced ABA during transition phases induces precocious maturation but negatively interferes with growth and development. Anti-ABA grains display broad constitutive gene induction related to biotic and abiotic stresses. Most of these genes are ABA- and/or stress-inducible, including alcohol and aldehyde dehydrogenases, peroxidases, chaperones, glutathione-S-transferase, drought- and salt-inducible proteins. Conclusively, ABA immunomodulation results in precocious ABA accumulation that generates an integrated response of stress and maturation. Repression of ABA signalling, occurring in anti-ABA grains, potentially antagonizes effects caused by overshooting production. Finally, mature grain weight and composition are unchanged in anti-ABA plants, although germination is somewhat delayed. This indicates that anti-ABA caryopses induce specific mechanisms to desensitize ABA signalling efficiently, which finally yields mature grains with nearly unchanged dry weight and composition. Such compensation implicates the enormous physiological and metabolic flexibilities of barley grains to adjust effects of unnaturally high ABA amounts in order to ensure and maintain proper grain development. © The Author 2016. Published by
Conception, definition, measuring procedure of grain size
International Nuclear Information System (INIS)
Yanagisawa, Kazuaki
1976-12-01
The conception, definition, measuring procedure of ''Grain Size'' were surveyed. A concept ''grain diameter'' was introduced after deriving a calculation formula for the grain diameter for using the Comparison (simple) and Intercept(detailed) procedure. As an example and putting into practice, the grain diameter determination was carried out by means of the Comparison procedure for a UO 2 pellet used in a densification experiment. (auth.)
Whole grain intake: The Baltimore Longitudinal Study of Aging.
Maras, Janice E; Newby, P K; Bakun, Peter J; Ferrucci, Luigi; Tucker, Katherine L
2009-02-01
Our objective was to identify major dietary sources of whole grains and to describe the construction of a database of whole grain content of foods. Dietary information was collected with 7-d food records from men and women in the Baltimore Longitudinal Study of Aging, mean age 62.1 +/- 16.0 years, who participated in the dietary assessment portion of the study (n = 1516), and estimates of whole grain intake were obtained from a newly developed database. The Pyramid Servings database and 1994-1996 Continuing Survey of Food Intakes by Individuals (CSFII) recipe ingredients database were then used to calculate both servings and gram weights of whole grain intakes. Mean intakes of whole grains, refined grains, and total grains, as well as frequency of intake for major whole grain food groups and whole grain content for each group, were calculated. Top contributors of whole grains were ready-to-eat breakfast cereals (made with whole grain as well as bran), hot breakfast cereals (made with whole grain), multi-grain bread, and whole wheat bread. While more research is needed to better understand the benefits of whole grains, the development of research tools, including databases to accurately assess whole grain intake, is a critical step in completing such research.
The formation of small grains in shocks in the ISM
Jones, Anthony P.; Tielens, Alexander G. G. M.
1994-01-01
Carbonaceous and silicate grains swept up, and betatron accelerated, by supernova-generated shock waves in the interstellar medium are exposed to grain destructive processing. The degree of grain destruction is determined by the differential gas-grain and grain-grain velocities, which lead to sputtering of the grain surface and grain core disruption (deformation, vaporization and shattering), respectively. The threshold pressure for grain shattering in grain-grain collisions (100 k bar) is considerably lower than that for vaporization (approximately 5 M bar). Therefore, collisions between grains shatter large grains into smaller fragments (i.e., small grains and PAH's). Using a new algorithms for the destructive processes, it was possible to model the formation fo small grain fragments in grain-grain collisions in the warm phase of the interstellar medium. It was found that in one cycle through the warm medium (approximately 3 x 10(sup 6) years) of order 1-2% of the total grain mass is shattered into particles with radii of less than 50 A.
Whole Grains: Hearty Options for a Healthy Diet
... in particular are an important part of a healthy diet. Grains are naturally high in fiber, helping you ... to make whole grains a part of your healthy diet. Also called cereals, grains and whole grains are ...
Grain Boundary Engineering of Electrodeposited Thin Films
DEFF Research Database (Denmark)
Alimadadi, Hossein
is not yet well-understood. This, at least partly, owes to the lack of robust characterization methods for analyzing the nature of grain boundaries including the grain boundary plane characteristics, until recently. In the past decade, significant improvements in the 2-dimensional and 3-dimensional analysis...... of the favorable boundaries that break the network of general grain boundaries. Successful dedicated synthesis of a textured nickel film fulfilling the requirements of grain boundary engineered materials, suggests improved boundary specific properties. However, the textured nickel film shows fairly low...... thermal stability and growth twins annihilate by thermal treatment at 600 degree C. In contrast, for oriented grains, growth nano-twins which are enveloped within columnar grains show a high thermal stability even after thermal treatment at 600 degree C. In order to exploit the high thermal...
Krysińska-Traczyk, Ewa; Perkowski, Juliusz; Dutkiewicz, Jacek
2007-01-01
During combine harvesting of 5 various cereal crops (rye, barley, oats, buckwheat, corn) 24 samples of grain and 24 samples of settled grain dust were collected on farms located in the Lublin province of eastern Poland. The samples were examined for the concentration of total microfungi, Fusarium species, deoxynivalenol (DON), nivalenol (NIV), and ochratoxin A (OTA). Microfungi able to grow on malt agar were present in 79.2% of grain samples and in 91.7% of grain dust samples in the concentrations of 1.0-801.3x10(3) cfu/g and 1.5-12440.0x10(3) cfu/g, respectively. The concentration of microfungi in grain dust samples was significantly greater than in grain samples (pgrain samples and from 58.3% of grain dust samples in the concentrations of 0.1-375.0x10(3) cfu/g and 4.0-7,700.0x10(3) cfu/g, respectively. They were found in all samples of grain and grain dust from rye, barley and corn, but only in 0-16.7% of samples of grain and grain dust from oats and buckwheat. DON was found in 79.2% of grain samples and in 100% of grain dust samples in the concentrations of 0.001-0.18 microg/g and 0.006-0.283 microg/g, respectively. NIV was detected in 62.5% of grain samples and in 94.4% of grain dust samples in the concentrations of 0.004-0.502 microg/g and 0.005-0.339 microg/g, respectively. OTA was detected in 58.3% of grain samples and in 91.7% of grain dust samples in the concentrations of 0.00039- 0.00195 microg/g and 0.00036-0.00285 microg/g, respectively. The concentrations of DON, total fusariotoxins (DON+NIV) and OTA were significantly greater in grain dust samples than in grain samples (pgrain and dust was significantly correlated with the concentrations of DON (pgrain and dust was significantly correlated with the concentration of total fusariotoxins (pgrain dust collected from 5 various cereals on farms in eastern Poland was not large, the persistent presence of these mycotoxins in over 90% of examined samples poses a potential health risk of chronic respiratory
Valli, Veronica; Taccari, Annalisa; Di Nunzio, Mattia; Danesi, Francesca; Bordoni, Alessandra
2018-05-01
Nowadays the higher nutritional value of whole grains compared to refined grains is recognized. In the last decade, there has been a renewed interest in the ancient wheat varieties for producing high-value food products with enhanced health benefits. This study compared two ancient grains, two heritage grains, and four modern grains grown in the same agronomic conditions considering not only their chemical characteristics, but also their biological effects. Whole grain flours were obtained and used to make bread. Bread was in vitro digested, the digesta were supplemented to HepG2 cells, and the biological effects of supplementation were evaluated. In addition, cells previously supplemented with the different digested bread types were then exposed to inflammatory agents to evidence possible protective effects of the pre-treatments. Despite the impossibility to discriminate bread made with different grains based on their chemical composition, results herein reported evidence that their supplementation to cultured cells exerts different effects, confirming the potential health benefits of ancient grains. This research represents an advancement for the evaluation of the apparent positive effects of ancient grains and the formulation of cereal-based products with added nutritional value. Copyright © 2018 Elsevier Ltd. All rights reserved.
Grain nucleation and growth during phase transformations
DEFF Research Database (Denmark)
Offerman, S.E.; Dijk, N.H. van; Sietsma, J.
2002-01-01
of individual grains. Our measurements show that the activation energy for grain nucleation is at least two orders of magnitude smaller than that predicted by thermodynamic models. The observed growth curves of the newly formed grains confirm the parabolic growth model but also show three fundamentally...... different types of growth. Insight into the grain nucleation and growth mechanisms during phase transformations contributes to the development of materials with optimal mechanical properties....
On the elastic stiffness of grain boundaries
International Nuclear Information System (INIS)
Zhang Tongyi; Hack, J.E.
1992-01-01
The elastic softening of grain boundaries is evaluated from the starting point of grain boundary energy. Several examples are given to illustrate the relationship between boundary energy and the extent of softening. In general, a high grain boundary energy is associated with a large excess atomic volume in the boundary region. The consequent reduction in grain boundary stiffness can represent a significant fraction of that observed in bulk crystals. (orig.)
Directory of Open Access Journals (Sweden)
Chi Wai Yu
2008-01-01
Full Text Available This paper examines the interface between fine-grained and coarse-grained programmable logic in FPGAs. Specifically, it presents an empirical study that covers the location, pin arrangement, and interconnect between embedded floating point units (FPUs and the fine-grained logic fabric in FPGAs. It also studies this interface in FPGAs which contain both FPUs and embedded memories. The results show that (1 FPUs should have a square aspect ratio; (2 they should be positioned near the center of the FPGA; (3 their I/O pins should be arranged around all four sides of the FPU; (4 embedded memory should be located between the FPUs; and (5 connecting higher I/O density coarse-grained blocks increases the demand for routing resources. The hybrid FPGAs with embedded memory required 12% wider channels than the case where embedded memory is not used.
Gao, Jian; Sasse, Joelle; Lewald, Kyle M; Zhalnina, Kateryna; Cornmesser, Lloyd T; Duncombe, Todd A; Yoshikuni, Yasuo; Vogel, John P; Firestone, Mary K; Northen, Trent R
2018-04-10
Beneficial plant-microbe interactions offer a sustainable biological solution with the potential to boost low-input food and bioenergy production. A better mechanistic understanding of these complex plant-microbe interactions will be crucial to improving plant production as well as performing basic ecological studies investigating plant-soil-microbe interactions. Here, a detailed description for ecosystem fabrication is presented, using widely available 3D printing technologies, to create controlled laboratory habitats (EcoFABs) for mechanistic studies of plant-microbe interactions within specific environmental conditions. Two sizes of EcoFABs are described that are suited for the investigation of microbial interactions with various plant species, including Arabidopsis thaliana, Brachypodium distachyon, and Panicum virgatum. These flow-through devices allow for controlled manipulation and sampling of root microbiomes, root chemistry as well as imaging of root morphology and microbial localization. This protocol includes the details for maintaining sterile conditions inside EcoFABs and mounting independent LED light systems onto EcoFABs. Detailed methods for addition of different forms of media, including soils, sand, and liquid growth media coupled to the characterization of these systems using imaging and metabolomics are described. Together, these systems enable dynamic and detailed investigation of plant and plant-microbial consortia including the manipulation of microbiome composition (including mutants), the monitoring of plant growth, root morphology, exudate composition, and microbial localization under controlled environmental conditions. We anticipate that these detailed protocols will serve as an important starting point for other researchers, ideally helping create standardized experimental systems for investigating plant-microbe interactions.
Directory of Open Access Journals (Sweden)
Yajuan Cheng
2016-07-01
Full Text Available The species within the Lolium/Festuca grass complex have dispersed and colonized large areas of temperate global grasslands both naturally and by human intervention. The species within this grass complex represent some of the most important grass species both for amenity and agricultural use worldwide. There has been renewed interest by grass breeders in producing hybrid combinations between these species and several countries now market Festulolium varieties as a combination of genes from both genera. The two genera have been differentiated by their inflorescence structure, but controversy has surrounded the taxonomic classification of the Lolium-Festuca complex species for several decades. In order to better understand the complexities within the Lolium/Festuca complex and their genetic background, the phylogeny of important examplers from the Lolium-Festuca complex were reconstructed. In total 40 taxa representing the Festuca and Lolium species with Vulpia myuros and Brachypodium distachyon as outgroups were sampled, using two noncoding intergenic spacers (trnQ-rps16, trnH-psbA and one coding gene (rbcL. Maximum parsimony (MP, Bayesian inference (BI analyses based on each partition and combined plastid DNA dataset, and median-jointing network analysis were employed. The outcomes strongly suggested that the subgen. Schedonorus has a close relationship to Lolium, and it is also proposed to move the sect. Leucopoa from subgen. Leucopoa to Subgen. Schedonorus and to separate sect. Breviaristatae from the subgen. Leucopoa. We found that F. californica could be a lineage of hybrid origin because of its intermediate placement between the broad-leaved and fine-leaved clade.
Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses.
Kögler, Anja; Schmidt, Thomas; Wenke, Torsten
2017-11-01
Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.
Evolution of grain structure in nickel oxide scales
International Nuclear Information System (INIS)
Atkinson, H.V.
1987-01-01
In systems such as the oxidation of nickel, in which grain-boundary diffusion in the oxide can control the rate of oxidation, understanding of the factors governing the grain structure is of importance. High-purity mechanically polished polycrystalline nickel was oxidized at 700 0 C, 800 0 C, and 1000 0 C for times up to 20 hr in 1 atm O 2 . The scale microstructures were examined by parallel and transverse cross section transmission electron microscopy (TEM) and scanning electron microscopy (SEM). Texture coefficients were found by x-ray diffraction (XRD). Each grain in the transverse section grain boundary networks was systematically analyzed for width parallel to the Ni-NiO interface and perpendicular length, for boundary radius of curvature and for number of sides. The variation of these parameters with depth in the scale was examined. In particular, grains were increasingly columnar (i.e., with ratio of grain length to width > 1) at higher temperatures and longer times. Columnar grain boundaries tended to be fairly static; the columnar grain width was less than the rate controlling grain size predicted from the oxidation rate. The mean boundary curvature per grain provided a guide to the tendency for grain growth, except in the region of the Ni-NiO interface, where the boundaries were thought to be pinned
Stochastic theory of grain growth
International Nuclear Information System (INIS)
Hu Haiyun; Xing Xiusan.
1990-11-01
The purpose of this note is to set up a stochastic theory of grain growth and to derive the statistical distribution function and the average value of the grain radius so as to match them with the experiment further. 8 refs, 1 fig
Can Whole-Grain Foods Lower Blood Pressure?
... eating more whole-grain foods help lower my blood pressure? Answers from Sheldon G. Sheps, M.D. It might. Eating ... might help reduce your chance of developing high blood pressure (hypertension). Whole grains are grains that include the ...
High temperature microplasticity of fine-grained ceramics
International Nuclear Information System (INIS)
Lakki, A.; Schaller, R.
1996-01-01
Several fine-grained ceramics exhibit enhanced ductility or even structural superplasticity at high temperature. Grain boundaries play a dominant role in the deformation process of these materials which usually involves diffusion-accommodated grain boundary sliding. Sliding is either lubricated by an amorphous intergranular phase or takes place by glide and climb of grain boundary dislocations. At high temperature, anelastic deformation precedes plastic deformation and stems from the short range motion of lattice defects, such as dislocations and grain boundaries. The energy loss (''mechanical loss'') associated with such motion can be measured by using the technique of mechanical spectroscopy. Moreover, at the onset of plasticity (''microplasticity''), long range irrecoverable motion of defects contributes to additional mechanical loss. Mechanical loss spectra may then give an insight into mechanisms operating at the transition between anelastic and plastic deformation. As an illustration, the spectra of three fine-grained ceramics (Si 3 N 4 , ZrO 2 , Al 2 O 3 ) are presented. In all cases, anelastic relaxation phenomena (peak and background) have been observed at high temperature (> 1200 K), bearing a close relation with creep behaviour. Their analysis permits to distinguish between different types of microstructrual elements: bulk regions of amorphous intergranular phase at triple points, grain boundaries separated by a thin glassy film and ''clean'' grain boundaries. (orig.)
Effect of salinity on grain yield and grain quality of wheat (triticum aestivum l.)
International Nuclear Information System (INIS)
Abbas, G.; Saqib, M.; Rafique, Q.; Rahman, A.U.; Akhtar, J.; Haq, M.A.U.
2013-01-01
Salinity is one of the important stresses resulting in the reduction of growth and yield of different crops including wheat. In saline soils the concentration of Na/sup +/ and Cl/sup -/ is higher accompanied with the decreased K/sup +/: Na/sup +/ ratio thus severely affecting the growth and yield of crops. The effect of salinity on the growth and yield of wheat is well documented, whereas there is very little information about salinity tolerance and grain quality of wheat. Present study was conducted to assess the effect of salinity on yield components, ionic relations and grain quality and to understand the relationship among these parameters. A pot experiment was conducted using wheat genotype Pasban-90. There were two treatments i.e. non-saline (0.33 dS m/sup -1/) and saline (15 dS m/sup -1/) with five replications. Salinity resulted in a significant reduction of the grain protein, fat and fiber contents. Similarly yield components were significantly reduced. Maximum reduction was noted in case of number of tillers plant/sup -1/, followed by grain weight plant/sup -1/. High Na/sup +/ and low K/sup +/, P concentration and K/sup +/: Na/sup +/ ratio was observed in the shoot, root and grain. This disturbed ionic composition seems to be apparent cause of yield reduction and deterioration of wheat quality under salinity. (author)
International Nuclear Information System (INIS)
Bruemmer, S.M.; Charlot, L.A.; Simonen, E.P.
1995-08-01
Grain boundary radiation-induced segregation (RIS) in Fe-Ni-Cr stainless alloys has been measured and modelled as a function of irradiation temperature and dose. Heavy-ion irradiation was used to produce damage levels from 1 to 20 displacements per atom (dpa) at temperatures from 175 to 550 degrees C. Measured Fe, Ni, and Cr segregation increased sharply with irradiation dose (from 0 to 5 dpa) and temperature (from 175 to about 350 degrees C). However, grain boundary concentrations did not change significantly as dose or temperatures were further increased. Impurity segregation (Si and P) was also measured, but only Si enrichment appeared to be radiation-induced. Grain boundary Si levels peaked at an intermediate temperature of ∼325 degrees C reaching levels of ∼8 at. %. Equilibrium segregation of P was measured in the high-P alloys, but interfacial concentration did not increase with irradiation exposure. Examination of reported RIS in neutron-irradiated stainless steels revealed similar effects of irradiation dose on grain boundary compositional changes for both major alloying and impurity element's. The Inverse Kirkendall model accurately predicted major alloying element RIS in ion- and neutron-irradiated alloys over the wide range of temperature and dose conditions. In addition, preliminary calculations indicate that the Johnson-Lam model can reasonably estimate grain boundary Si enrichment if back diffusion is enhanced
Energy Technology Data Exchange (ETDEWEB)
Schöberl, Markus, E-mail: m.schoeberl@tum.de [Continuum Mechanics Group, Technical University of Munich, Boltzmannstraße 15, 85748 Garching (Germany); Zabaras, Nicholas [Institute for Advanced Study, Technical University of Munich, Lichtenbergstraße 2a, 85748 Garching (Germany); Department of Aerospace and Mechanical Engineering, University of Notre Dame, 365 Fitzpatrick Hall, Notre Dame, IN 46556 (United States); Koutsourelakis, Phaedon-Stelios [Continuum Mechanics Group, Technical University of Munich, Boltzmannstraße 15, 85748 Garching (Germany)
2017-03-15
We propose a data-driven, coarse-graining formulation in the context of equilibrium statistical mechanics. In contrast to existing techniques which are based on a fine-to-coarse map, we adopt the opposite strategy by prescribing a probabilistic coarse-to-fine map. This corresponds to a directed probabilistic model where the coarse variables play the role of latent generators of the fine scale (all-atom) data. From an information-theoretic perspective, the framework proposed provides an improvement upon the relative entropy method and is capable of quantifying the uncertainty due to the information loss that unavoidably takes place during the coarse-graining process. Furthermore, it can be readily extended to a fully Bayesian model where various sources of uncertainties are reflected in the posterior of the model parameters. The latter can be used to produce not only point estimates of fine-scale reconstructions or macroscopic observables, but more importantly, predictive posterior distributions on these quantities. Predictive posterior distributions reflect the confidence of the model as a function of the amount of data and the level of coarse-graining. The issues of model complexity and model selection are seamlessly addressed by employing a hierarchical prior that favors the discovery of sparse solutions, revealing the most prominent features in the coarse-grained model. A flexible and parallelizable Monte Carlo – Expectation–Maximization (MC-EM) scheme is proposed for carrying out inference and learning tasks. A comparative assessment of the proposed methodology is presented for a lattice spin system and the SPC/E water model.
Straumfors, Anne; Heldal, Kari Kulvik; Wouters, Inge M; Eduard, Wijnand
2015-07-01
The grain and compound feed industry entails inevitable risks of exposure to grain dust and its microbial content. The objective of this study was therefore to investigate task-dependent exposure differences in order to create knowledge basis for awareness and exposure reducing measures in the Norwegian grain and compound feed industry. A total of 166 samples of airborne dust were collected by full-shift personal sampling during work in 20 grain elevators and compound feed mills during one autumn season and two winter seasons. The personal exposure to grain dust, endotoxins, β-1→3-glucans, bacteria, and fungal spores was quantified and used as individual outcomes in mixed models with worker nested in company as random effect and different departments and tasks as fixed effects. The exposure levels were highest in grain elevator departments. Exposure to endotoxins was particularly high. Tasks that represented the highest and lowest exposures varied depending on the bioaerosol component. The most important determinants for elevated dust exposure were cleaning and process controlling. Cleaning increased the dust exposure level by a factor of 2.44 of the reference, from 0.65 to 1.58mg m(-3), whereas process controlling increased the dust exposure level by a factor of 2.97, from 0.65 to 1.93mg m(-3). Process controlling was associated with significantly less grain dust exposure in compound feed mills and the combined grain elevators and compound feed mills, than in grain elevators. The exposure was reduced by a factor of 0.18 and 0.22, from 1.93 to 0.34mg m(-3) and to 0.42mg m(-3), respectively, compared with the grain elevators. Inspection/maintenance, cleaning, and grain rotation and emptying were determinants of higher exposure to both endotoxin and β-1→3-glucans. Seed winnowing was in addition a strong determinant for endotoxin, whereas mixing of animal feed implied higher β-1→3-glucan exposure. Cleaning was the only task that contributed significantly to
International Nuclear Information System (INIS)
Hastings, I.J.; Scoberg, J.A.; Walden, W.
1979-06-01
Grain growth studies have been carried out on UO 2 to provide data for the fuel modelling program and to evaluate fuel fabricated in commissioning the Mixed Oxide Fuel Fabrication Laboratory at Chalk River Nuclear Laboratories. Fuel examined includes natural UO 2 commercially fabricated from ADU powder for CANDU reactors; natural UO 2 commercially fabricated from AU powder; natural UO 2 from ADU and AU powder, fabricated in the MOFFL; and commercially fabricated UO 2 enriched 1.7, 4.5, and 9.6 wt. percent U-235 in U. Samples were step-annealed in vacuo at 1870-2070 K for up to 32.5 h. All data fit a (grain size)sup(2.5) versus annealing time relationship. Apparent activation energy for grain growth, Q, depends on fuel type and varies from 150+-10 kJ/mol for early AU powder to 360+-10 kJ/mol for pellets from ADU fabricated in the MOFFL. Grain sizes calculated using the laboratory equation in a fuel performance code tend to be greater than those measured in irradiated natural fuel, suggesting irradiation-induced inhibition of grain growth. However, any inhibition is equivalent to that expected for a systematic 5 percent underpredicition in reactor power. (author)
Wang, Shaokui; Li, Shan; Liu, Qian; Wu, Kun; Zhang, Jianqing; Wang, Shuansuo; Wang, Yi; Chen, Xiangbin; Zhang, Yi; Gao, Caixia; Wang, Feng; Huang, Haixiang; Fu, Xiangdong
2015-08-01
The deployment of heterosis in the form of hybrid rice varieties has boosted grain yield, but grain quality improvement still remains a challenge. Here we show that a quantitative trait locus for rice grain quality, qGW7, reflects allelic variation of GW7, a gene encoding a TONNEAU1-recruiting motif protein with similarity to C-terminal motifs of the human centrosomal protein CAP350. Upregulation of GW7 expression was correlated with the production of more slender grains, as a result of increased cell division in the longitudinal direction and decreased cell division in the transverse direction. OsSPL16 (GW8), an SBP-domain transcription factor that regulates grain width, bound directly to the GW7 promoter and repressed its expression. The presence of a semidominant GW7(TFA) allele from tropical japonica rice was associated with higher grain quality without the yield penalty imposed by the Basmati gw8 allele. Manipulation of the OsSPL16-GW7 module thus represents a new strategy to simultaneously improve rice yield and grain quality.
Grain-to-Grain Variations in NbC Particle Size Distributions in an Austenitic Stainless Steel
DEFF Research Database (Denmark)
Barlow, Claire; Ralph, B.; Silverman, B.
1979-01-01
Quantitative information has been obtained concerning the size distributions of NbC precipitate particles in different grains in a deformed and aged austenitic stainless steel specimen. The precipitate size distributions obtained differ from one grain to another. The average disparity measured be...
Grain filling parameters and yield components in wheat
Brdar Milka; Kobiljski Borislav; Balalić-Kraljević Marija
2006-01-01
Grain yield of wheat (Triticum aestivum L.) is influenced by number of grains per unit area and grain weight, which is result of grain filling duration and rate. The aim of the study was to investigate the relationships between grain filling parameters in 4 wheat genotypes of different earliness and yield components. Nonlinear regression estimated and observed parameters were analyzed. Rang of estimated parameters corresponds to rang of observed parameters. Stepwise MANOVA indicated that the ...
Grain Boundaries From Theory to Engineering
Priester, Louisette
2013-01-01
Grain boundaries are a main feature of crystalline materials. They play a key role in determining the properties of materials, especially when grain size decreases and even more so with the current improvements of processing tools and methods that allow us to control various elements in a polycrystal. This book presents the theoretical basis of the study of grain boundaries and aims to open up new lines of research in this area. The treatment is light on mathematical approaches while emphasizing practical examples; the issues they raise are discussed with reference to theories. The general approach of the book has two main goals: to lead the reader from the concept of ‘ideal’ to ‘real’ grain boundaries; to depart from established knowledge and address the opportunities emerging through "grain boundary engineering", the control of morphological and crystallographic features that affect material properties. The book is divided in three parts: I ‘From interganular order to disorder’ deals wit...
7 CFR 800.99 - Checkweighing sacked grain.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Checkweighing sacked grain. 800.99 Section 800.99 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS Weighing...
Grain Structure Control of Additively Manufactured Metallic Materials
Directory of Open Access Journals (Sweden)
Fuyao Yan
2017-11-01
Full Text Available Grain structure control is challenging for metal additive manufacturing (AM. Grain structure optimization requires the control of grain morphology with grain size refinement, which can improve the mechanical properties of additive manufactured components. This work summarizes methods to promote fine equiaxed grains in both the additive manufacturing process and subsequent heat treatment. Influences of temperature gradient, solidification velocity and alloy composition on grain morphology are discussed. Equiaxed solidification is greatly promoted by introducing a high density of heterogeneous nucleation sites via powder rate control in the direct energy deposition (DED technique or powder surface treatment for powder-bed techniques. Grain growth/coarsening during post-processing heat treatment can be restricted by presence of nano-scale oxide particles formed in-situ during AM. Grain refinement of martensitic steels can also be achieved by cyclic austenitizing in post-processing heat treatment. Evidently, new alloy powder design is another sustainable method enhancing the capability of AM for high-performance components with desirable microstructures.
Photoemission of Single Dust Grains for Heliospheric Conditions
Spann, James F., Jr.; Venturini, Catherine C.; Abbas, Mian M.; Comfort, Richard H.
2000-01-01
Initial results of an experiment to measure the photoemission of single dust grains as a function of far ultraviolet wavelengths are presented. Coulombic forces dominate the interaction of the dust grains in the heliosphere. Knowledge of the charge state of dust grains, whether in a dusty plasma (Debye length grains is primarily determined by primary electron and ion collisions, secondary electron emission and photoemission due to ultraviolet sunlight. We have established a unique experimental technique to measure the photoemission of individual micron-sized dust grains in vacuum. This technique resolves difficulties associated with statistical measurements of dust grain ensembles and non-static dust beams. The photoemission yield of Aluminum Oxide 3-micron grains For wavelengths from 120-300 nm with a spectral resolution of 1 nm FWHM is reported. Results are compared to interplanetary conditions.
Interactive contribution of grain size and grain orientation to coercivity of melt spun ribbons
International Nuclear Information System (INIS)
Wang, N.; Li, G.; Yao, W.J.; Wen, X.X.
2010-01-01
During melt spinning process, the improvement of certain grain orientation and the refinement of grain size with surface velocity have interactive and contradictory effects on the magnetic properties. The contributions of these effects have seldom been taken into account and they were discussed in this paper via Fe-2, 4, 6.5 wt% Si alloys. Heat treatment at 1173 K for 1 h was performed to show the annealing impact. The X-ray diffraction patterns show that the high surface velocity and heat treatment increase the intensity ratio of line (2 0 0) to (1 1 0) of A2 phase. The (2 0 0) line corresponds to (2 0 0) plane in direction, easy magnetization direction of α-Fe phase in Fe-Si alloy. The improvement of this grain orientation with the surface velocity decreases the coercivity, which should increase due to the grain refinement. It is revealed that the texture promoted by the anisotropic heat release during melt spinning process is one factor to improve the magnetic properties and should be considered when preparing soft magnetic materials.
International Nuclear Information System (INIS)
Sabooni, S.; Karimzadeh, F.; Enayati, M.H.; Ngan, A.H.W.
2015-01-01
In the present study, metastable AISI 304L austenitic stainless steel samples were subjected to different cold rolling reductions from 70% to 93%, followed by annealing at 700 °C for 300 min to form ultrafine grained (UFG) austenite with different grain structures. Transmission electron microscopy (TEM) and nanoindentation were used to characterize the martensitic transformation, in order to relate it to the bimodal distribution of the austenite grain size after subsequent annealing. The results showed that the martensite morphology changed from lath type in the 60% rolled sample to a mixture of lath and dislocation-cell types in the higher rolling reductions. Calculation of the Gibbs free energy change during the reversion treatment showed that the reversion mechanism is shear controlled at the annealing temperature and so the morphology of the reverted austenite is completely dependent on the morphology of the deformation induced martensite. It was found that the austenite had a bimodal grain size distribution in the 80% rolled and annealed state and this is related to the existence of different types of martensite. Increasing the rolling reduction to 93% followed by annealing caused changing of the grain structure to a monomodal like structure, which was mostly covered with small grains of around 300 nm. The existence of bimodal austenite grain size in the 80% rolled and annealed 304L stainless steel led to the improvement of ductility while maintaining a high tensile strength in comparison with the 93% rolled and annealed sample
Decreasing radioactive cesium in lodged buckwheat grain after harvest
Directory of Open Access Journals (Sweden)
Katashi Kubo
2016-01-01
Full Text Available This study assessed soil contamination with high radioactive cesium (R–Cs concentration in buckwheat grains by lodging, and assessed the possibility of R–Cs reduction in grain through post-harvest preparation. Analysis of buckwheat grain produced in farmers’ fields and reports from farmers indicated that grain from fields that had lodging showed higher R–Cs than grain from fields with no lodging. A field experiment demonstrated that R–Cs in grain after threshing and winnowing (TW was about six times higher in lodged plants than in nonlodged plants. In lodged plants, R–Cs in grain was decreased to about one-fourth by polishing, and was decreased to about one-seventh by ultrasonic cleaning, compared with R–Cs in grain after TW. These results demonstrate that R–Cs of buckwheat grain of lodged plants can be decreased by removing soil from the grain surface by polishing and winnowing.
GRAIN-BOUNDARY PRECIPITATION UNDER IRRADIATION IN DILUTE BINARY ALLOYS
Institute of Scientific and Technical Information of China (English)
S.H. Song; Z.X. Yuan; J. Liu; R.G.Faulkner
2003-01-01
Irradiation-induced grain boundary segregation of solute atoms frequently bring about grain boundary precipitation of a second phase because of its making the solubility limit of the solute surpassed at grain boundaries. Until now the kinetic models for irradiation-induced grain boundary precipitation have been sparse. For this reason, we have theoretically treated grain boundary precipitation under irradiation in dilute binary alloys. Predictions ofγ'-Ni3Si precipitation at grain boundaries ave made for a dilute Ni-Si alloy subjected to irradiation. It is demonstrated that grain boundary silicon segregation under irradiation may lead to grain boundaryγ'-Ni3 Si precipitation over a certain temperature range.
Shterner, Vadim; Timokhina, Ilana B.; Rollett, Anthony D.; Beladi, Hossein
2018-04-01
In the current study, the dependence of mechanical twinning on grain orientation and grain boundary characteristics was investigated using quasi in-situ tensile testing. The grains of three main orientations (i.e., , , and parallel to the tensile axis (TA)) and certain characteristics of grain boundaries (i.e., the misorientation angle and the inclination angle between the grain boundary plane normal and the TA) were examined. Among the different orientations, and were the most and the least favored orientations for the formation of mechanical twins, respectively. The orientation was intermediate for twinning. The annealing twin boundaries appeared to be the most favorable grain boundaries for the nucleation of mechanical twinning. No dependence was found for the inclination angle of annealing twin boundaries, but the orientation of grains on either side of the annealing twin boundary exhibited a pronounced effect on the propensity for mechanical twinning. Annealing twin boundaries adjacent to high Taylor factor grains exhibited a pronounced tendency for twinning regardless of their inclination angle. In general, grain orientation has a significant influence on twinning on a specific grain boundary.
Electrostatic forces on grains near asteroids and comets
Directory of Open Access Journals (Sweden)
Hartzell Christine
2017-01-01
Full Text Available Dust on and near the surface of small planetary bodies (e.g. asteroids, the Moon, Mars’ moons is subject to gravity, cohesion and electrostatic forces. Due to the very low gravity on small bodies, the behavior of small dust grains is driven by non-gravitational forces. Recent work by Scheeres et al. has shown that cohesion, specifically van der Waals force, is significant for grains on asteroids. In addition to van der Waals cohesion, dust grains also experience electrostatic forces, arising from their interaction with each other (through tribocharging and the solar wind plasma (which produces both grain charging and an external electric field. Electrostatic forces influence both the interactions of grains on the surface of small bodies as well as the dynamics of grains in the plasma sheath above the surface. While tribocharging between identical dielectric grains remains poorly understood, we have recently expanded an existing charge transfer model to consider continuous size distributions of grains and are planning an experiment to test the charge predictions produced. Additionally, we will present predictions of the size of dust grains that are capable of detaching from the surface of small bodies.
7 CFR 800.61 - Prohibited grain handling practices.
2010-01-01
... such blending will result in grain being designated as Mixed grain in accordance with subpart E of the... processed into a product(s) by the purchaser and not resold into the grain market. (3) Products or... include additional requirements for grain that is officially inspected and weighed. (3) Marketing dockage...
NUTRITIONAL CHARACTERIZATION OF GRAIN AMARANTH ...
African Journals Online (AJOL)
IBUKUN
children; increased body mass index of people formerly wasted by HIV/AIDS; ... and market acceptability of Amaranth cruentus based products in order to ... Peru, grain amaranth also used the grains as food; preparation of local beverage; added ... initiated to know the proximate composition, mineral and vitamin contents of ...
Structure and chemistry of the sorghum grain
Sorghum is grown around the world and often under harsh and variable environmental conditions. Combined with the high degree of genetic diversity present in sorghum, this can result in substantial variability in grain composition and grain quality. While similar to other cereal grains such as maize ...
Chemisputtering of interstellar graphite grains
International Nuclear Information System (INIS)
Draine, B.T.
1979-01-01
The rate of erosion of interstellar graphite grains as a result of chemical reaction with H, N, and O is estimated using the available experiment evidence. It is argued that ''chemical sputtering'' yields for interstellar graphite grains will be much less than unity, contrary to earlier estimates by Barlow and Silk. Chemical sputtering of graphite grains in evolving H II regions is found to be unimportant, except in extremely compact (n/sub H/> or approx. =10 5 cm -3 ) H II regions. Alternative explanations are considered for the apparent weakness of the lambda=2175 A extinction ''bump'' in the direction of several early type stars
7 CFR 75.21 - Grain sample inspection.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Grain sample inspection. 75.21 Section 75.21... AND CERTIFICATION OF QUALITY OF AGRICULTURAL AND VEGETABLE SEEDS Inspection § 75.21 Grain sample inspection. A sample inspection shall be performed by examining official grain samples received from FGIS to...
Ramírez-López, A.; Romero-Romo, M. A.; Muñoz-Negron, D.; López-Ramírez, S.; Escarela-Pérez, R.; Duran-Valencia, C.
2012-10-01
Computational models are developed to create grain structures using mathematical algorithms based on the chaos theory such as cellular automaton, geometrical models, fractals, and stochastic methods. Because of the chaotic nature of grain structures, some of the most popular routines are based on the Monte Carlo method, statistical distributions, and random walk methods, which can be easily programmed and included in nested loops. Nevertheless, grain structures are not well defined as the results of computational errors and numerical inconsistencies on mathematical methods. Due to the finite definition of numbers or the numerical restrictions during the simulation of solidification, damaged images appear on the screen. These images must be repaired to obtain a good measurement of grain geometrical properties. Some mathematical algorithms were developed to repair, measure, and characterize grain structures obtained from cellular automata in the present work. An appropriate measurement of grain size and the corrected identification of interfaces and length are very important topics in materials science because they are the representation and validation of mathematical models with real samples. As a result, the developed algorithms are tested and proved to be appropriate and efficient to eliminate the errors and characterize the grain structures.
Climate and the Soviet Grain Crisis of 1928
Welker, Jean Edward
1995-01-01
This dissertation tests the premise that peasant hoarding of surplus grain supplies and the refusal of the rural Soviet peasants to sell grain to state procurement apparatus during the late New Economic Policy period, caused the Grain Crisis of 1928. The peasants' reluctance to sell grain and claims of peasant hoarding could only occur if sufficient grain surpluses existed during this period. The existence of these assumed grain surpluses is shown to be highly improbable. First, the large but inconsistent body of 1920s grain statistics was evaluated per se and related to two periods of pre-WWI data, the Witte and Stolypin years, on a practical comparison whenever possible. For both these pre-World War I periods, intensive links between rapid industrialization and agriculture had been established similar to the conditions of the 1920s. The climatic conditions of the two imperial and one Soviet period in the 1920s, especially drought in 1927, was analyzed, and its impact on grain production estimated and interpreted. The conclusion was reached that the cause of drop in grain production in 1927 was due to a long-term and persistent trend of regional drought affecting spring wheat yields, especially in the areas of the Middle Volga and Kazakhstan. Second, the resultant conclusion was reached that there was insufficient bread grain on a national basis in 1927 to meet the essential needs of the rural peasants, much less the increasing demands of the government procurements. Third, the government's 1927 policy of monopolizing all available "surpluses" on the grain market under the false assumption that these surpluses were abundant, demonstrated either naivete and incompetence, or political expediency. This monopolization contributed to a breakdown in the marketing distribution of available grain, and generally exacerbated the poor procurement situation which was publically and incorrectly blamed on the peasants' hoarding.
Coarse graining for synchronization in directed networks
Zeng, An; Lü, Linyuan
2011-05-01
Coarse-graining model is a promising way to analyze and visualize large-scale networks. The coarse-grained networks are required to preserve statistical properties as well as the dynamic behaviors of the initial networks. Some methods have been proposed and found effective in undirected networks, while the study on coarse-graining directed networks lacks of consideration. In this paper we proposed a path-based coarse-graining (PCG) method to coarse grain the directed networks. Performing the linear stability analysis of synchronization and numerical simulation of the Kuramoto model on four kinds of directed networks, including tree networks and variants of Barabási-Albert networks, Watts-Strogatz networks, and Erdös-Rényi networks, we find our method can effectively preserve the network synchronizability.
The Rosseland mean opacity of interstellar grain
International Nuclear Information System (INIS)
Ali, A.; El Shalaby, M.A.; El-Nawawy, M.S.
1990-10-01
We have calculated the opacity of interstellar grains in the temperature range 10 deg. K - 1500 deg. K. Two composite grain models have been considered. One of them consists of silicate coated with ice mantle and the second has a graphite core coated also with ice mantle. These models are compared with isolated grain models. An exact analytical and computational development of Guettler's formulae for composite grain models has been used to calculate the extinction coefficient. It has been found that the thickness of the mantle affects the opacity of the interstellar grains. The opacity of composite models differs from that of the isolated models. The effect of the different species (ice, silicate and graphite) is also clear. (author). 22 refs, 4 figs, 1 tab
Role of Grain Boundaries under Long-Time Radiation
Zhu, Yichao; Luo, Jing; Guo, Xu; Xiang, Yang; Chapman, Stephen Jonathan
2018-06-01
Materials containing a high proportion of grain boundaries offer significant potential for the development of radiation-resistant structural materials. However, a proper understanding of the connection between the radiation-induced microstructural behavior of a grain boundary and its impact at long natural time scales is still missing. In this Letter, point defect absorption at interfaces is summarized by a jump Robin-type condition at a coarse-grained level, wherein the role of interface microstructure is effectively taken into account. Then a concise formula linking the sink strength of a polycrystalline aggregate with its grain size is introduced and is well compared with experimental observation. Based on the derived model, a coarse-grained formulation incorporating the coupled evolution of grain boundaries and point defects is proposed, so as to underpin the study of long-time morphological evolution of grains induced by irradiation. Our simulation results suggest that the presence of point defect sources within a grain further accelerates its shrinking process, and radiation tends to trigger the extension of twin boundary sections.
Schellart, N. A.; Zweijpfenning, R. C.; van Marle, J.; Huijsmans, D. P.
1986-01-01
Using a video-image system coupled to a minicomputer with commercial image handling software, autoradiographic grains displayed in dark-field are counted with a fast (ca. 3.5 min for 120,000 microns 2) and reliable (false scores less than 5%) grain-recognizing FORTRAN program executed in the users
Development of Perennial Grain Sorghum
Directory of Open Access Journals (Sweden)
Stan Cox
2018-01-01
Full Text Available Perennial germplasm derived from crosses between Sorghum bicolor and either S. halepense or S. propinquum is being developed with the goal of preventing and reversing soil degradation in the world’s grain sorghum-growing regions. Perennial grain sorghum plants produce subterranean stems known as rhizomes that sprout to form the next season’s crop. In Kansas, breeding perennial sorghum involves crossing S. bicolor cultivars or breeding lines to S. halepense or perennial S. bicolorn × S. halepense breeding lines, selecting perennial plants from F2 or subsequent populations, crossing those plants with S. bicolor, and repeating the cycle. A retrospective field trial in Kansas showed that selection and backcrossing during 2002–2009 had improved grain yields and seed weights of breeding lines. Second-season grain yields of sorghum lines regrowing from rhizomes were similar to yields in the first season. Further selection cycles have been completed since 2009. Many rhizomatous lines that cannot survive winters in Kansas are perennial at subtropical or tropical locations in North America and Africa. Grain yield in Kansas was not correlated with rhizomatousness in either Kansas or Uganda. Genomic regions affecting rhizome growth and development have been mapped, providing new breeding tools. The S. halepense gene pool may harbor many alleles useful for improving sorghum for a broad range of traits in addition to perenniality.
Grain refining efficiency of Al-Ti-C alloys
International Nuclear Information System (INIS)
Birol, Yuecel
2006-01-01
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al 3 Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate α-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al 3 Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified
Grain refining efficiency of Al-Ti-C alloys
Energy Technology Data Exchange (ETDEWEB)
Birol, Yuecel [Materials Institute, Marmara Research Center, TUBITAK, 41470 Gebze, Kocaeli (Turkey)]. E-mail: yucel.birol@mam.gov.tr
2006-09-28
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al{sub 3}Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate {alpha}-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al{sub 3}Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified.
Polyamines and ethylene interact in rice grains in response to soil drying during grain filling.
Chen, Tingting; Xu, Yunji; Wang, Jingchao; Wang, Zhiqin; Yang, Jianchang; Zhang, Jianhua
2013-05-01
This study tested the hypothesis that the interaction between polyamines and ethylene may mediate the effects of soil drying on grain filling of rice (Oryza sativa L.). Two rice cultivars were pot grown. Three treatments, well-watered, moderate soil drying (MD), and severe soil drying (SD), were imposed from 8 d post-anthesis until maturity. The endosperm cell division rate, grain-filling rate, and grain weight of earlier flowering superior spikelets showed no significant differences among the three treatments. However, those of the later flowering inferior spikelets were significantly increased under MD and significantly reduced under SD when compared with those which were well watered. The two cultivars showed the same tendencies. MD increased the contents of free spermidine (Spd) and free spermine (Spm), the activities of S-adenosyl-L-methionine decarboxylase and Spd synthase, and expression levels of polyamine synthesis genes, and decreased the ethylene evolution rate, the contents of 1-aminocylopropane-1-carboxylic acid (ACC) and hydrogen peroxide, the activities of ACC synthase, ACC oxidase, and polyamine oxidase, and the expression levels of ethylene synthesis genes in inferior spikelets. SD exhibited the opposite effects. Application of Spd, Spm, or an inhibitor of ethylene synthesis to rice panicles significantly reduced ethylene and ACC levels, but significantly increased Spd and Spm contents, grain-filling rate, and grain weight of inferior spikelets. The results were reversed when ACC or an inhibitor of Spd and Spm synthesis was applied. The results suggest that a potential metabolic interaction between polyamines and ethylene biosynthesis responds to soil drying and mediates the grain filling of inferior spikelets in rice.
Grain-Scale Supercharging and Breakdown on Airless Regoliths
Zimmerman, M. I.; Farrell, W. M.; Hartzell, C.M.; Wang, X.; Horanyi, M.; Hurley, D. M.; Hibbitts, K.
2016-01-01
Interactions of the solar wind and emitted photoelectrons with airless bodies have been studied extensively. However, the details of how charged particles interact with the regolith at the scale of a single grain have remained largely uncharacterized. Recent efforts have focused upon determining total surface charge under photoemission and solar wind bombardment and the associated electric field and potential. In this work, theory and simulations are used to show that grain-grain charge differences can exceed classical sheath predictions by several orders of magnitude, sometimes reaching dielectric breakdown levels. Temperature-dependent electrical conductivity works against supercharging by allowing current to leak through individual grains; the balance between internal conduction and surface charging controls the maximum possible grain-to-grain electric field. Understanding the finer details of regolith grain charging, conductive equilibrium, and dielectric breakdown will improve future numerical studies of space weathering and dust levitation on airless bodies.
Discrete stochastic charging of aggregate grains
Matthews, Lorin S.; Shotorban, Babak; Hyde, Truell W.
2018-05-01
Dust particles immersed in a plasma environment become charged through the collection of electrons and ions at random times, causing the dust charge to fluctuate about an equilibrium value. Small grains (with radii less than 1 μm) or grains in a tenuous plasma environment are sensitive to single additions of electrons or ions. Here we present a numerical model that allows examination of discrete stochastic charge fluctuations on the surface of aggregate grains and determines the effect of these fluctuations on the dynamics of grain aggregation. We show that the mean and standard deviation of charge on aggregate grains follow the same trends as those predicted for spheres having an equivalent radius, though aggregates exhibit larger variations from the predicted values. In some plasma environments, these charge fluctuations occur on timescales which are relevant for dynamics of aggregate growth. Coupled dynamics and charging models show that charge fluctuations tend to produce aggregates which are much more linear or filamentary than aggregates formed in an environment where the charge is stationary.
Monte Carlo simulation of grain growth
Directory of Open Access Journals (Sweden)
Paulo Blikstein
1999-07-01
Full Text Available Understanding and predicting grain growth in Metallurgy is meaningful. Monte Carlo methods have been used in computer simulations in many different fields of knowledge. Grain growth simulation using this method is especially attractive as the statistical behavior of the atoms is properly reproduced; microstructural evolution depends only on the real topology of the grains and not on any kind of geometric simplification. Computer simulation has the advantage of allowing the user to visualize graphically the procedures, even dynamically and in three dimensions. Single-phase alloy grain growth simulation was carried out by calculating the free energy of each atom in the lattice (with its present crystallographic orientation and comparing this value to another one calculated with a different random orientation. When the resulting free energy is lower or equal to the initial value, the new orientation replaces the former. The measure of time is the Monte Carlo Step (MCS, which involves a series of trials throughout the lattice. A very close relationship between experimental and theoretical values for the grain growth exponent (n was observed.
The Influence of Abrasion on Martian Dust Grains: Evidence from a Study of Antigorite Grains
Bishop, Janice L.; Drief, Ahmed; Dyar, M. Darby
2003-01-01
Grinding was shown to greatly affect the structure and a number of properties of antigorite grains in a study by Drief and Nieto. Grinding is likely to influence the structure of most clay mineral grains and has been shown recently to influence the structure of kaolinite. The antigorite structure includes curved waves of layered silicate as shown by D dony et al.. Our study was performed in order to characterize in detail changes in the mineral grains resulting from grinding and to assess the influence of physical processes on clay minerals on the surface of Mars. This project includes a combination of SEM, reflectance spectroscopy and Moessbauer spectroscopy.
Grain size dependence of wear in ceramics
International Nuclear Information System (INIS)
Wu, C.C.; Rice, R.W.; Johnson, D.; Platt, B.A.
1985-01-01
Pin-On-Disk (POD), microwear tests of Al 2 O 3 , MgO, MgAl 2 O 4 , and ZrO 2 , most being dense and essentially single phase, showed the reciprocal of wear following a hall-petch type relationship. However, extrapolation to infinite grain size always gave a lower intercept than most or all single-crystal values; in particular, Al 2 O 3 data projects to a negative intercept. Initial macro wear tests of some of the same Al 2 O 3 materials also indicate a hall-petch type grain-size dependence, but with a greatly reduced grain-size dependence, giving a positive hall-petch intercept. Further, the macrowear grain-size dependence appears to decrease with increased wear. It is argued that thermal expansion anisotropy (of Al 2 O 3 ) significantly affects the grain size dependence of POD wear, in particular, giving a negative intercept, while elastic anisotropy is suggested as a factor in the grain-size dependence of the cubic (MgO, MgAl 2 O 4 , and ZrO 2 ) materials. The reduced grain-size dependence in the macrowear tests is attributed to overlapping wear tracks reducing the effects of enhanced wear damage, e.g., from elastic and thermal expansion anisotropies
International Nuclear Information System (INIS)
PremKumar, R.; Samajdar, I.; Viswanathan, N.N.; Singal, V.; Seshadri, V.
2003-01-01
Hot rolled low Si (silicon) non-grain oriented electrical steel was cold rolled to different reductions. Cold rolled material was subsequently recrystallized, 650 deg. C and 2 h, and then temper rolled (to 7% reduction) for the final grain growth annealing and decarburization treatment at 850 deg. C for 2-24 h. The development of texture, grain size and magnetic properties were characterized at different stages of processing. Effect of texture on magnetic properties (watt loss and permeability) was observed to be best represented by the ratio of volume fractions of (1 1 1) /(0 0 1) fibers, as estimated by convoluting X-ray ODFs (orientation distribution functions) with respective model functions. Such a ratio was termed as generalized texture factor (tf) for the non-grain oriented electrical steel. An effort was made to delink effects of grain size and texture, as represented by respective tf, on watt loss and permeability by careful analysis of experimental data. In general, low tf and/or high grain size were responsible for low watt loss and high permeability. However, individual effect of grain size or tf on magnetic properties was less significant at low tf or large grain size, respectively. An attempt was made to fit regression equations, namely--linear, exponential and power, relating magnetic properties with tf and grain size, limiting the fitting parameters to 3. Least standard deviations, between experimental and predicted values, were obtained by power regression equations for both magnetic properties
Chang, Xiaoping; Li, Runzhi; Jing, Ruilian
2014-01-01
Drought, heat and other abiotic stresses during grain filling can result in reductions in grain weight. Conserved water-soluble carbohydrates (WSC) at early grain filling play an important role in partial compensation of reduced carbon supply. A diverse population of 262 historical winter wheat accessions was used in the present study. There were significant correlations between 1000-grain weight (TGW) and four types of WSC, viz. (1) total WSC at the mid-grain filling stage (14 days after flowering) produced by leaves and non-leaf organs; (2) WSC contributed by current leaf assimilation during the mid-grain filling; (3) WSC in non-leaf organs at the mid-grain filling, excluding the current leaf assimilation; and (4) WSC used for respiration and remobilization during the mid-grain filling. Association and favorable allele analyses of 209 genome-wide SSR markers and the four types of WSC were conducted using a mixed linear model. Seven novel favorable WSC alleles exhibited positive individual contributions to TGW, which were verified under 16 environments. Dosage effects of pyramided favorable WSC alleles and significantly linear correlations between the number of favorable WSC alleles and TGW were observed. Our results suggested that pyramiding more favorable WSC alleles was effective for improving both WSC and grain weight in future wheat breeding programs. PMID:25036550
Energy Technology Data Exchange (ETDEWEB)
Peter, D. [Ruhr University Bochum, Institute for Materials, D-44780 Bochum (Germany); Viswanathan, G.B., E-mail: Viswanathan.11@osu.edu [Ruhr University Bochum, Institute for Materials, D-44780 Bochum (Germany) and Department of Materials Science and Engineering, Ohio State University, Columbus, OH 43210 (United States); Wagner, M.F.-X.; Eggeler, G. [Ruhr University Bochum, Institute for Materials, D-44780 Bochum (Germany)
2009-06-15
Constant-load creep experiments at a temperature of 750 deg. C and a nominal stress of 300 MPa were conducted on a fine-grained Ti-45Al-5Nb-0.2B-0.2C (in at.%) alloy with a duplex microstructure. Microstructures before and after creep (accumulated strain: 9.6%) were analyzed using scanning and transmission electron microscopy (SEM and TEM). TEM analysis after creep indicates that the individual microstructural constituents of the fine duplex microstructure, namely, the equiaxed {gamma} and the lamellar {alpha}{sub 2}/{gamma} colonies, undergo varying degrees of deformation and develop various substructures. Lamellar grains deform by dislocation creep. They show clear evidence for dislocation and twin activity. In contrast, only few dislocations are found in the equiaxed grains. We show that the regions with small equiaxed {gamma} grains, representing 65-75 vol.% of the microstructure, deform by grain-boundary sliding.
International Nuclear Information System (INIS)
Peter, D.; Viswanathan, G.B.; Wagner, M.F.-X.; Eggeler, G.
2009-01-01
Constant-load creep experiments at a temperature of 750 deg. C and a nominal stress of 300 MPa were conducted on a fine-grained Ti-45Al-5Nb-0.2B-0.2C (in at.%) alloy with a duplex microstructure. Microstructures before and after creep (accumulated strain: 9.6%) were analyzed using scanning and transmission electron microscopy (SEM and TEM). TEM analysis after creep indicates that the individual microstructural constituents of the fine duplex microstructure, namely, the equiaxed γ and the lamellar α 2 /γ colonies, undergo varying degrees of deformation and develop various substructures. Lamellar grains deform by dislocation creep. They show clear evidence for dislocation and twin activity. In contrast, only few dislocations are found in the equiaxed grains. We show that the regions with small equiaxed γ grains, representing 65-75 vol.% of the microstructure, deform by grain-boundary sliding.
The composition of interstellar grain mantles
International Nuclear Information System (INIS)
Tielens, A.G.G.M.
1984-01-01
The molecular composition of interstellar grain mantles employing gas phase as well as grain surface reactions has been calculated. The calculated mixtures consist mainly of the molecules H 2 O H 2 CO, N 2 , CO, O 2 , CO 2 , H 2 O 2 , NH 3 , and their deuterated counterparts in varying ratios. The exact compositions depend strongly on the physical conditions in the gas phase. The calculated mixtures are compared to the observations by using laboratory spectra of grain mantle analogs. (author)
Gamma irradiation of rice grains
International Nuclear Information System (INIS)
Roy, M.K.; Ghosh, S.K.; Chatterjee, S.R.
1991-01-01
Rice grains of the variety, Pusa-33, at 12.0% moisture, were irradiated with doses of 0-150 kGy. The crystallinity of starch, soluble amylose and yellowness of treated grains increased with increment in the dose of radiation but water absorption and volume expansion on cooling decreased. irradiation at doses of 3-5 kGy increased imperceptibly the hardening of rice cooled after cooking, but had no effect on edibility. The off-aroma in irradiated grains was perceptible at doses higher than 5 kGy. The changes in colour and aroma persisted also on cooking. Upto a dose of 5 kGy, the sensory scores of rice, both cooked and uncooked, were at or above acceptable limit of score (5,5). The doses of 3 and 5 kGy were highly effective in reducing fungal population in irradiated grains, but in view of the changes in colour and cooking qualities, 3 kGy is the preferred dose-limit of irradiation. (author). 17 refs., 5 tabs., 1 fig
Grain-growth law during Stage 1 sintering of materials
International Nuclear Information System (INIS)
He Zeming; Ma, J.
2002-01-01
This work investigates the grain-growth behaviour of powder compact during Stage 1 sintering (<90{%} theoretical density). It is widely accepted that grain size is an important state variable in the constitutive modelling in material sintering. However, it is noted that all the existing grain-growth laws proposed in the literature do not incorporate the effect of externally applied stress independently. In this work, a grain-growth law with externally applied stress as a variable was proposed. Alumina powders were forge-sintered at different applied stresses to examine the proposed grain-growth relationship. The proposed grain-growth law was then applied to model the grain-growth process on the sinter forging of tool steel. It is shown that the present proposed grain-growth law provides a good description on the experimental results. (author)
Deformation bands in ⟨120⟩ grains in coarse-grained aluminium
DEFF Research Database (Denmark)
Bilde-Sørensen, Jørgen
1986-01-01
Coarse-grained aluminium, deformed in tension to a strain of 0.05, was examined in a scanning electron microscope by channelling contrast. Pronounced bands with a width typically of the order of 200 μm were found in some grains with an orientation close to [120]. When observed on surfaces close......)[011](111) and (a/2)[011](111). The Schmid factor for the highest stressed secondary systems has a local minimum of 0.245 at [120]. The application of Frank's equation shows that the only boundaries without long-range stresses that can be formed by combination of the two sets of dislocations, (a/2)- [011...
The Evolution of the Whole Grain Partnership in Denmark
DEFF Research Database (Denmark)
Greve, Carsten; Neess, Rikke Iben
This paper is about the evolution of the Whole Grain Partnership in Denmark. The partnership’s objective is to increase public health by encouraging Danes to eat more whole grain. The partnership also provides a business opportunity for the food industry to expand the market for whole grain...... products. The Whole Grain Partnership is a campaign organization supported by 35 partners from government, health NGOs and the food industry. A public‐private partnership holds much promise and presents an exciting opportunity to increase whole grain intake for the benefit of public health. Before...... the Danish Whole Grain Partnership was established in January 2008, Danes ate on average only 36 grams of whole grain per day per 10MJ (mega joules). Today, Danes eat on average 63 grams of whole grain per day per 10MJ. 30% of the population now eats the recommended intake of 75 grams of whole grain per day...
Interstellar Grains: 50 Years on
Wickramasinghe, N. C.
Our understanding of the nature of interstellar grains has evolved considerably over the past half century with the present author and Fred Hoyle being intimately involved at several key stages of progress. The currently fashionable graphite-silicate-organic grain model has all its essential aspects unequivocally traceable to original peer-reviewed publications by the author and/or Fred Hoyle. The prevailing reluctance to accept these clear-cut priorities may be linked to our further work that argued for interstellar grains and organics to have a biological provenance -- a position perceived as heretical. The biological model, however, continues to provide a powerful unifying hypothesis for a vast amount of otherwise disconnected and disparate astronomical data.
Interactions of impurities with a moving grain boundary
Energy Technology Data Exchange (ETDEWEB)
Bauer, C L [Carnegie-Mellon Univ., Pittsburgh, Pa. (USA)
1975-01-01
Most theories developed to explain interaction of impurities with a moving grain boundary involve a uniform excess impurity concentration distributed along a planar grain boundary. As boundary velocity increases, the excess impurities exert a net drag force on the boundary until a level is reached whereat the drag force no longer can balance the driving force and breakaway of the boundary from these impurities occurs. In this investigation, assumptions of a uniform lateral impurity profile and a planar grain boundary shape are relaxed by allowing both forward and lateral diffusion of impurities in the vicinity of a grain boundary. It is found that the two usual regions (drag of impurities by, and breakaway of a planar grain boundary) are separated by an extensive region wherein a uniform lateral impurity profile and a planar grain boundary shape are unstable. It is suspected that, in this unstable region, grain boundaries assume a spectrum of more complex morphologies and that elucidation of these morphologies can provide the first definitive description of the breakaway process and insight to more complex phenomena such as solid-solution strengthening, grain growth and secondary recrystallization.
Kibbey, T. C. G.; Adegbule, A.; Yan, S.
2017-12-01
The movement of nonvolatile solutes in unsaturated porous media at low water contents depends on transport in surface-associated water films. The focus of the work described here was on studying solute movement in water films advancing by capillary forces over initially-dry grain surfaces, to understand how microscopic surface roughness features influence the initial velocity of water film advance. For this work, water containing a non-adsorbing conservative tracer was used to track the movement of advancing water films. A stainless steel capillary tube connected to an external reservoir a fixed distance below the grain surface was used to transmit solution to the grain surface under negative pressure (positive capillary pressure), consistent with conditions that might be expected in the unsaturated zone. The small internal diameter of the capillary prevents solution from draining out of the capillary back into the reservoir. When the capillary is contacted with a grain surface, capillary forces that result from contact between the fluid and the rough grain surface cause water films to wick across the grain surface. Multiple experiments were conducted on the same grain, rotating the grain and varying the capillary contact point around the circumference of the grain. Imaging was conducted at fixed intervals using an automated Extended Depth of Field (EDF) imaging system, and images were analyzed to determine initial velocity. Grain surfaces were then characterized through scanning electron microscope (SEM) imaging, using a hybrid stereoscopic reconstruction method designed to extract maximum detail in creating elevation maps of geologic surfaces from tilted pairs of SEM images. The resulting elevation maps were used to relate surface roughness profiles around the grain with initial velocities. Results suggest that velocity varies significant with contact point around an individual grain, and correlates quantitatively with the local grain surface structure
Film grain noise modeling in advanced video coding
Oh, Byung Tae; Kuo, C.-C. Jay; Sun, Shijun; Lei, Shawmin
2007-01-01
A new technique for film grain noise extraction, modeling and synthesis is proposed and applied to the coding of high definition video in this work. The film grain noise is viewed as a part of artistic presentation by people in the movie industry. On one hand, since the film grain noise can boost the natural appearance of pictures in high definition video, it should be preserved in high-fidelity video processing systems. On the other hand, video coding with film grain noise is expensive. It is desirable to extract film grain noise from the input video as a pre-processing step at the encoder and re-synthesize the film grain noise and add it back to the decoded video as a post-processing step at the decoder. Under this framework, the coding gain of the denoised video is higher while the quality of the final reconstructed video can still be well preserved. Following this idea, we present a method to remove film grain noise from image/video without distorting its original content. Besides, we describe a parametric model containing a small set of parameters to represent the extracted film grain noise. The proposed model generates the film grain noise that is close to the real one in terms of power spectral density and cross-channel spectral correlation. Experimental results are shown to demonstrate the efficiency of the proposed scheme.
The interactions of radiation damage with grain boundaries
International Nuclear Information System (INIS)
King, A.H.
1979-01-01
This thesis reports a theoretical and experimental study of the fundamental effects giving rise to zones adjacent to grain boundaries which are denuded of irradiation-induced damage. The results, however, have significance in the wider field of point-defect absorption (and emission) by grain boundaries. Particular emphasis has been laid upon correlating the point-defect sink behaviour of grain boundaries with their structures and to this end, grain boundaries with periodically repeating structures have been chosen for study. The hypotheses that point-defect absorption is achieved by the climb of grain boundary dislocation spirals, loops and structural arrays have been investigated and firm evidence has been found to support the two latter mechanisms in specific cases. Loops, in particular, have been found to grow only on coherent twin boundary planes. Chapter two of the thesis investigates the crystallographic nature of the possible reactions of point-defects with periodic boundaries and demonstrates that effects such as grain boundary migration and grain translations may be associated with point-defect absorption. Chapter three presents a theoretical study of the effects of elastic interactions between point-defects and grain boundary dislocations and gives predictions of sink strength and bias of a grain boundary as a function of its structure. Chapter four consists of experimental examples of grain boundaries observed during and after irradiation. Chapter five discusses the results of chapters two, three and four considering their implications for the various hypotheses and presents the conclusions of the thesis and some suggestions for further work. (author)
CASS Ferrite and Grain Structure Relationship
Energy Technology Data Exchange (ETDEWEB)
Ruud, Clayton O. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ramuhalli, Pradeep [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Meyer, Ryan M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Diaz, Aaron A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Michael T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-07-13
This document summarizes the results of research conducted at Pacific Northwest National Laboratory (PNNL) to determine whether, based on experimental measurements, a correlation existed between grain structure in cast austenitic stainless steel (CASS) piping and ferrite content of the casting alloy. The motivation for this research lies in the fact that ultrasonic testing (UT) is strongly influenced by CASS grain structure; knowledge of this grain structure may help improve the ability to interpret UT responses, thereby improving the overall reliability of UT inspections of CASS components.
Grain boundary and triple junction diffusion in nanocrystalline copper
Energy Technology Data Exchange (ETDEWEB)
Wegner, M., E-mail: m.wegner@uni-muenster.de; Leuthold, J.; Peterlechner, M.; Divinski, S. V., E-mail: divin@uni-muenster.de [Institut für Materialphysik, Universität Münster, Wilhelm-Klemm-Straße 10, D-48149, Münster (Germany); Song, X., E-mail: xysong@bjut.edu.cn [College of Materials Science and Engineering, Beijing University of Technology, 100124 Beijing (China); Wilde, G. [Institut für Materialphysik, Universität Münster, Wilhelm-Klemm-Straße 10, D-48149, Münster (Germany); Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, 200444 Shanghai (China)
2014-09-07
Grain boundary and triple junction diffusion in nanocrystalline Cu samples with grain sizes, 〈d〉, of ∼35 and ∼44 nm produced by spark plasma sintering were investigated by the radiotracer method using the {sup 63}Ni isotope. The measured diffusivities, D{sub eff}, are comparable with those determined previously for Ni grain boundary diffusion in well-annealed, high purity, coarse grained, polycrystalline copper, substantiating the absence of a grain size effect on the kinetic properties of grain boundaries in a nanocrystalline material at grain sizes d ≥ 35 nm. Simultaneously, the analysis predicts that if triple junction diffusion of Ni in Cu is enhanced with respect to the corresponding grain boundary diffusion rate, it is still less than 500⋅D{sub gb} within the temperature interval from 420 K to 470 K.
Comet Grains: Their IR Emission and Their Relation to ISM Grains
Wooden, Diane H.; DeVincenzi, Donald (Technical Monitor)
2002-01-01
Comets and the chodritic, porous interplanetary dust particles (CP IDPs) that they shed in their comae are reservoirs of primitive solar nebula materials. The high porosity and fragility of cometary grains and CP IDPs, and anomalously high deuterium contents of highly fragile, pyroxene-rich Cluster IDPs imply these aggregate particles contain significant abundances of grains from the interstellar medium (ISM). IR spectra of comets (3 - 40 micron) reveal the presence of a warm (nearIR) featureless emission modeled by amorphous carbon grains. Broad and narrow resonances near 10 and 20 microns are modeled by warm chondritic (50% Fe and 50% Mg) amorphous silicates and cooler Mg-rich crystalline silicate minerals, respectively. Cometary amorphous silicates resonances are well matched by IR spectra of CP IDPs dominated by GEMS (0.1 micron silicate spherules) that are thought to be the interstellar Fe-bearing amorphous silicates produced in AGB stars. Acid-etched ultramicrotomed CP IDP samples, however, show that both the carbon phase (amorphous and aliphatic) and the Mg-rich amorphous silicate phase in GEMS are not optically absorbing. Rather, it is Fe and FeS nanoparticles embedded in the GEMS that makes the CP IDPs dark. Therefore, CP IDPs suggest significant processing has occurred in the ISM. ISM processing probably includes in He' ion bombardment in supernovae shocks. Laboratory experiments show He+ ion bombardment amorphizes crystalline silicates, increases porosity, and reduces Fe into nanoparticles. Cometary crystalline silicate resonances are well matched by IR spectra of laboratory submicron Mg-rich olivine crystals and pyroxene crystals. Discovery of a Mg-pure olivine crystal in a Cluster IDP with isotopically anomalous oxygen indicates that a small fraction of crystalline silicates may have survived their journey from AGB stars through the ISM to the early solar nebula. The ISM does not have enough crystalline silicates (ISM Mg-rich crystals leads to the
MIDDLEMEN IN THE MARKET FOR GRAIN: CHANGES AND COMPARISONS
Directory of Open Access Journals (Sweden)
Mary Eschelbach Hansen
2000-01-01
Full Text Available The role of middlemen in the market for grain changed with the advent of standardized grain grading. Prior to grain grading, economies of scale were limited because of the requirement that middlemen develop strong personal reputations though the maintenance of multi-faceted relationships with clients. Grain grading homogenized grain, making it possible for middlemen to take advantage of economies of scale in their operations.
Creep of quartz by dislocation and grain boundary processes
Fukuda, J. I.; Holyoke, C. W., III; Kronenberg, A. K.
2015-12-01
Wet polycrystalline quartz aggregates deformed at temperatures T of 600°-900°C and strain rates of 10-4-10-6 s-1 at a confining pressure Pc of 1.5 GPa exhibit plasticity at low T, governed by dislocation glide and limited recovery, and grain size-sensitive creep at high T, governed by diffusion and sliding at grain boundaries. Quartz aggregates were HIP-synthesized, subjecting natural milky quartz powder to T=900°C and Pc=1.5 GPa, and grain sizes (2 to 25 mm) were varied by annealing at these conditions for up to 10 days. Infrared absorption spectra exhibit a broad OH band at 3400 cm-1 due to molecular water inclusions with a calculated OH content (~4000 ppm, H/106Si) that is unchanged by deformation. Rate-stepping experiments reveal different stress-strain rate functions at different temperatures and grain sizes, which correspond to differing stress-temperature sensitivities. At 600-700°C and grain sizes of 5-10 mm, flow law parameters compare favorably with those for basal plasticity and dislocation creep of wet quartzites (effective stress exponents n of 3 to 6 and activation enthalpy H* ~150 kJ/mol). Deformed samples show undulatory extinction, limited recrystallization, and c-axis maxima parallel to the shortening direction. Similarly fine-grained samples deformed at 800°-900°C exhibit flow parameters n=1.3-2.0 and H*=135-200 kJ/mol corresponding to grain size-sensitive Newtonian creep. Deformed samples show some undulatory extinction and grain sizes change by recrystallization; however, grain boundary deformation processes are indicated by the low value of n. Our experimental results for grain size-sensitive creep can be compared with models of grain boundary diffusion and grain boundary sliding using measured rates of silicon grain boundary diffusion. While many quartz mylonites show microstructural and textural evidence for dislocation creep, results for grain size-sensitive creep may apply to very fine-grained (<10 mm) quartz mylonites.
Thermomagnetic Stability in Pseudo Single Domain Grains
Nagy, Lesleis; Williams, Wyn; Muxworthy, Adrian; Fabian, Karl; Conbhuí, Pádraig Ó.
2016-04-01
The reliability of paleomagnetic remanences are well understood for fine grains of magnetite that are single-domain (SD, uniformly magnetized). In particular Néel's theory [1] outlined the thermal energies required to block and unblock magnetic remanences. This lead to determination of thermal stability for magnetization in fine grains as outlined in Pullaiah et. al. [2] and a comprehensive understanding of SD paleomagnetic recordings. It has been known for some time that single domain magnetite is possible only in the grain size range 30 - 80nm, which may only account for a small fraction of the grain size distribution in any rock sample. Indeed rocks are often dominated by grains in the pseudo single domain (PSD) size range, at approximately 80 - 1000nm. Toward the top end of this range multi-domain features begin to dominate. In order to determine thermomagnetic stability in PSD grains we need to identify the energy barriers between all possible pairs of local energy minima (LEM) domain states as a function of both temperature and grain size. We have attempted to do this using the nudged elastic band (NEB) method [3] which searches for minimum energy paths between any given pair of LEM states. Using this technique we have determined, for the first time, complete thermomagnetic stability curves for PSD magnetite. The work presented is at a preliminary stage. However it can be shown that PSD grains of magnetite with simple geometries (e.g. cubes or cuboctahedra) have very few low energy transition paths and the stability is likely to be similar to that observed for SD grains (as expected form experimental observations). The results will provide a basis for a much more rigorous understanding of the fidelity of paleomagnetic signals in assemblages of PSD grains and their ability to retain ancient recordings of the geomagnetic field. References: [1] Néel, Louis. "Théorie du traînage magnétique des ferromagnétiques en grains fins avec applications aux terres
International Nuclear Information System (INIS)
Nagashima, Nobuo; Hayakawa, Masao; Tsukada, Takashi; Kaji, Yoshiyuki; Miwa, Yukio; Ando, Masami; Nakata, Kiyotomo
2009-01-01
In this study, micro-hardness tests and AFM observations were performed on SUS 316L low-carbon austenitic stainless steel pre-strained by cold rolling to investigate its deformation behavior. The following results were obtained. Despite the fact that the same plastic strain was applied, post-tensile test AFM showed narrower slip-band spacing in a reduction in area of 30% cold-rolled specimen than the unrolled specimen. Concentrated slip bands were observed near grain boundaries. These were presumably due to slip blocking at grain boundaries. SCC sensitivity increased at a hardness of 300 or higher, the frequency occurrence of a hardness of 300 or higher in the micro-hardness measurements was compared. The micro-hardness did not exceed 300 both within grains and at grain boundaries in the unrolled and up to a reduction in area of 20% cold-rolled specimens of before and after the tensile tests. Micro-hardness exceeding 300 was found to occur frequently in after tensile test specimens with a reduction in area of 30% or more, particularly at grain boundaries. It is suggested that the nonuniformity of deformation at grain boundaries plays an important role of IGSCC crack propagation mechanism of low-carbon austenitic stainless steel. (author)
Interlinking backscatter, grain size and benthic community structure
McGonigle, Chris; Collier, Jenny S.
2014-06-01
The relationship between acoustic backscatter, sediment grain size and benthic community structure is examined using three different quantitative methods, covering image- and angular response-based approaches. Multibeam time-series backscatter (300 kHz) data acquired in 2008 off the coast of East Anglia (UK) are compared with grain size properties, macrofaunal abundance and biomass from 130 Hamon and 16 Clamshell grab samples. Three predictive methods are used: 1) image-based (mean backscatter intensity); 2) angular response-based (predicted mean grain size), and 3) image-based (1st principal component and classification) from Quester Tangent Corporation Multiview software. Relationships between grain size and backscatter are explored using linear regression. Differences in grain size and benthic community structure between acoustically defined groups are examined using ANOVA and PERMANOVA+. Results for the Hamon grab stations indicate significant correlations between measured mean grain size and mean backscatter intensity, angular response predicted mean grain size, and 1st principal component of QTC analysis (all p PERMANOVA for the Hamon abundance shows benthic community structure was significantly different between acoustic groups for all methods (p ≤ 0.001). Overall these results show considerable promise in that more than 60% of the variance in the mean grain size of the Clamshell grab samples can be explained by mean backscatter or acoustically-predicted grain size. These results show that there is significant predictive capacity for sediment characteristics from multibeam backscatter and that these acoustic classifications can have ecological validity.
Sticking properties of ice grains
Jongmanns, M.; Kumm, M.; Wurm, G.; Wolf, D. E.; Teiser, J.
2017-06-01
We study the size dependence of pull-off forces of water ice in laboratory experiments and numerical simulations. To determine the pull-off force in our laboratory experiments, we use a liquid nitrogen cooled centrifuge. Depending on its rotation frequency, spherical ice grains detach due to the centrifugal force which is related to the adhesive properties. Numerical simulations are conducted by means of molecular dynamics simulations of hexagonal ice using a standard coarse-grained water potential. The pull-off force of a single contact between two spherical ice grains is measured due to strain controlled simulations. Both, the experimental study and the simulations reveal a dependence between the pull-off force and the (reduced) particle radii, which differ significantly from the linear dependence of common contact theories.
International Nuclear Information System (INIS)
Huang, F.; Peng, R. D.; Liu, Y. H.; Chen, Z. Y.; Ye, M. F.; Wang, L.
2012-01-01
Fractal dust grains of different shapes are observed in a radially confined magnetized radio frequency plasma. The fractal dimensions of the dust structures in two-dimensional (2D) horizontal dust layers are calculated, and their evolution in the dust growth process is investigated. It is found that as the dust grains grow the fractal dimension of the dust structure decreases. In addition, the fractal dimension of the center region is larger than that of the entire region in the 2D dust layer. In the initial growth stage, the small dust particulates at a high number density in a 2D layer tend to fill space as a normal surface with fractal dimension D = 2. The mechanism of the formation of fractal dust grains is discussed.
Grain size refinement of inconel 718 thermomechanical processing
International Nuclear Information System (INIS)
Okimoto, P.C.
1988-01-01
Inconel 718 is a Ni-Fe precipitation treated superalloy. It presents good thermal fatigue properties when the material has small grain size. The aim of this work is to study the grain size refinement by thermomechanical processing, through observations of the microstructural evolution and the influence of some of the process variables in the final grain size. The results have shown that this refinement occured by static recrystallization. The presence of precipitates have influenced the final grain size if the deformations are below 60%. For greater deformations the grain size is independent of the precipitate distribution in the matrix and tends to a limit size of 5 μm. (author)
Aune, Dagfinn; Norat, Teresa; Romundstad, Pål; Vatten, Lars J
2013-11-01
Several studies have suggested a protective effect of intake of whole grains, but not refined grains on type 2 diabetes risk, but the dose-response relationship between different types of grains and type 2 diabetes has not been established. We conducted a systematic review and meta-analysis of prospective studies of grain intake and type 2 diabetes. We searched the PubMed database for studies of grain intake and risk of type 2 diabetes, up to June 5th, 2013. Summary relative risks were calculated using a random effects model. Sixteen cohort studies were included in the analyses. The summary relative risk per 3 servings per day was 0.68 (95% CI 0.58-0.81, I(2) = 82%, n = 10) for whole grains and 0.95 (95% CI 0.88-1.04, I(2) = 53%, n = 6) for refined grains. A nonlinear association was observed for whole grains, p nonlinearity cereals, wheat bran and brown rice, but these results were based on few studies, while white rice was associated with increased risk. Our meta-analysis suggests that a high whole grain intake, but not refined grains, is associated with reduced type 2 diabetes risk. However, a positive association with intake of white rice and inverse associations between several specific types of whole grains and type 2 diabetes warrant further investigations. Our results support public health recommendations to replace refined grains with whole grains and suggest that at least two servings of whole grains per day should be consumed to reduce type 2 diabetes risk.
Grain boundaries in high temperature superconductors
Hilgenkamp, Johannes W.M.; Mannhart, J.
2002-01-01
Since the first days of high-Tc superconductivity, the materials science and the physics of grain boundaries in superconducting compounds have developed into fascinating fields of research. Unique electronic properties, different from those of the grain boundaries in conventional metallic
Competing Grain Boundary and Interior Deformation Mechanisms with Varying Sizes
Energy Technology Data Exchange (ETDEWEB)
Zhang, Wei [University of Tennessee (UT); Gao, Yanfei [ORNL; Nieh, T. G. [University of Tennessee, Knoxville (UTK)
2018-01-01
In typical coarse-grained alloys, the dominant plastic deformations are dislocation gliding or climbing, and material strengths can be tuned by dislocation interactions with grain boundaries, precipitates, solid solutions, and other defects. With the reduction of grain size, the increase of material strengths follows the classic Hall-Petch relationship up to nano-grained materials. Even at room temperatures, nano-grained materials exhibit strength softening, or called the inverse Hall-Petch effect, as grain boundary processes take over as the dominant deformation mechanisms. On the other hand, at elevated temperatures, grain boundary processes compete with grain interior deformation mechanisms over a wide range of the applied stress and grain sizes. This book chapter reviews and compares the rate equation model and the microstructure-based finite element simulations. The latter explicitly accounts for the grain boundary sliding, grain boundary diffusion and migration, as well as the grain interior dislocation creep. Therefore the explicit finite element method has clear advantages in problems where microstructural heterogeneities play a critical role, such as in the gradient microstructure in shot peening or weldment. Furthermore, combined with the Hall-Petch effect and its breakdown, the above competing processes help construct deformation mechanism maps by extending from the classic Frost-Ashby type to the ones with the dependence of grain size.
Directory of Open Access Journals (Sweden)
Hongyan Sun
Full Text Available To reveal grain physio-chemical and proteomic differences between two barley genotypes, Zhenong8 and W6nk2 of high- and low-grain-Cd-accumulation, grain profiles of ultrastructure, amino acid and proteins were compared. Results showed that W6nk2 possesses significantly lower protein content, with hordein depicting the greatest genotypic difference, compared with Zhenong8, and lower amino acid contents with especially lower proportion of Glu, Tyr, Phe and Pro. Both scanning and transmission electron microscopy observation declared that the size of A-type starch molecule in W6nk2 was considerably larger than that of Zhenong8. Grains of Zhenong8 exhibited more protein-rich deposits around starch granules, with some A-type granules having surface pits. Seventeen proteins were identified in grains, using 2-DE coupled with mass spectrometry, with higher expression in Zhenong8 than that in W6nk2; including z-type serpin, serpin-Z7 and alpha-amylase/trypsin inhibitor CM, carbohydrate metabolism, protein synthesis and signal transduction related proteins. Twelve proteins were less expressed in Zhenong8 than that in W6nk2; including barley trypsin inhibitor chloroform/methanol-soluble protein (BTI-CMe2.1, BTI-CMe2.2, trypsin inhibitor, dehydroascorbate reductase (DHAR, pericentrin, dynein heavy chain and some antiviral related proteins. The data extend our understanding of mechanisms underlying Cd accumulation/tolerance and provides possible utilization of elite genetic resources in developing low-grain-Cd barley cultivars.
Industrial application of radiation disinfestation of grain
International Nuclear Information System (INIS)
Zakladnoj, G.A.; Men'shenin, A.I.; Pertsovskij, E.S.; Salimov, R.A.; Cherepkov, V.G.; Krsheminskij, V.S.
1982-01-01
One of the main reasons for grain losses during storage is its damage by pest insects. Chemical methods widely used at present for grain decontamination have some shortcomings. In this connection a radiation method for grain disinfestation is developed and introduced in industry. First in the world experimental-industrial disinfestator on the base of electron accelerators is put into operation at Odessa port elevator
Grain Refinement of Permanent Mold Cast Copper Base Alloys
Energy Technology Data Exchange (ETDEWEB)
M.Sadayappan; J.P.Thomson; M.Elboujdaini; G.Ping Gu; M. Sahoo
2005-04-01
Grain refinement is a well established process for many cast and wrought alloys. The mechanical properties of various alloys could be enhanced by reducing the grain size. Refinement is also known to improve casting characteristics such as fluidity and hot tearing. Grain refinement of copper-base alloys is not widely used, especially in sand casting process. However, in permanent mold casting of copper alloys it is now common to use grain refinement to counteract the problem of severe hot tearing which also improves the pressure tightness of plumbing components. The mechanism of grain refinement in copper-base alloys is not well understood. The issues to be studied include the effect of minor alloy additions on the microstructure, their interaction with the grain refiner, effect of cooling rate, and loss of grain refinement (fading). In this investigation, efforts were made to explore and understand grain refinement of copper alloys, especially in permanent mold casting conditions.
Performance of organic grain legumes in Tuscany
Directory of Open Access Journals (Sweden)
Valentina Moschini
2014-03-01
Full Text Available In 2005-2007 growing season, few varieties of field bean, high protein pea and white lupin were compared in an organic farm of Central Italy (Mugello area, Tuscany, to evaluate their agronomic performance in terms of grain yield, nutritional quality and competitive ability against weeds. The experiment was performed under rain-fed conditions. Furthermore, grain legumes features were compared between two different sowing seasons (autumnal vs late-winter for two years, in order to get information on the best time of sowing of these species, and the stability of yields of different genotypes in those climatic and soil conditions. These legumes could be an alternative protein source to external soybean, a high-risk alimentary source of genetically modified organisms, in the organic livestock sector. The main findings indicate that higher yields in grain and crude protein were obtained with the pea species and in particular with cultivars Hardy (4.0 t/ha grain yield; 626 kg/ha crude protein yield and Classic (3.1 t/ha grain yield; 557 kg/ha crude protein yield; followed by field bean cv. Chiaro di Torre Lama (2.9 t/ha grain yield; 624 kg/ha crude protein yield and cv. Vesuvio (2.5 t/ha grain yield; 549 kg/ha crude protein yield. Furthermore the field bean is interesting for the stability of yield in both years despite climatic conditions rather different. The white lupin has showed the lower yield but the best values of grain quality, with higher values in lupin Multitalia for dry matter, crude protein and ether extract and in lupin Luxe also for crude fibre, respect to the other legumes analysed. Among lupin varieties, lupin Multitalia showed the best yield results for the pedo-climatic conditions of Mugello area (0.9 t/ha lupin Multitalia; 0.2 t/ha lupin Luxe. The total yield of organic grain legumes, in the experimental site, is resulted higher with an autumnal seeding respect to the late-winter seeding (2.8 t/ha vs 1.9 t/ha.
Equi-axed and columnar grain growth in UO2
International Nuclear Information System (INIS)
White, R.J.
1997-01-01
The grain size of UO 2 is an important parameter in the actual performance and the modelling of the performance of reactor fuel elements. Many processes depend critically on the grain size, for example, the degree of initial densification, the evolution rate of stable fission gases, the release rates of radiologically hazardous fission products, the fission gas bubble swelling rates and the fuel creep. Many of these processes are thermally activated and further impact on the fuel thermal behavior thus creating complex feedback processes. In order to model the fuel performance accurately it is necessary to model the evolution of the fuel grain radius. When UO 2 is irradiated, the fission gases xenon and krypton are created from the fissioning uranium nucleus. At high temperatures these gases diffuse rapidly to the grain boundaries where they nucleate immobile lenticular shaped fission gas bubbles. In this paper the Hillert grain growth model is adapted to account for the inhibiting ''Zener'' effects of grain boundary fission gas porosity on grain boundary mobility and hence grain growth. It is shown that normal grain growth ceases at relatively low levels of irradiation. At high burnups, high temperatures and in regions of high temperature gradients, columnar grain growth is often observed, in some cases extending over more than fifty percent of the fuel radius. The model is further extended to account for the de-pinning of grains in the radial direction by the thermal gradient induced force on a fission gas grain boundary bubble. The observed columnar/equi-axed boundary is in fair agreement with the predictions of an evaporation/condensation model. The grain growth model described in this paper requires information concerning the scale of grain boundary porosity, the local fuel temperature and the local temperature gradient. The model is currently used in the Nuclear Electric version of the ENIGMA fuel modelling code. (author). 14 refs, 3 figs, 1 tab
Statistical model for grain boundary and grain volume oxidation kinetics in UO2 spent fuel
International Nuclear Information System (INIS)
Stout, R.B.; Shaw, H.F.; Einziger, R.E.
1989-09-01
This paper addresses statistical characteristics for the simplest case of grain boundary/grain volume oxidation kinetics of UO 2 to U 3 O 7 for a fragment of a spent fuel pellet. It also presents a limited discussion of future extensions to this simple case to represent the more complex cases of oxidation kinetics in spent fuels. 17 refs., 1 fig
Sedimentary controls on modern sand grain coat formation
Dowey, Patrick J.; Worden, Richard H.; Utley, James; Hodgson, David M.
2017-05-01
Coated sand grains can influence reservoir quality evolution during sandstone diagenesis. Porosity can be reduced and fluid flow restricted where grain coats encroach into pore space. Conversely pore-lining grain coats can restrict the growth of pore-filling quartz cement in deeply buried sandstones, and thus can result in unusually high porosity in deeply buried sandstones. Being able to predict the distribution of coated sand grains within petroleum reservoirs is thus important to help find good reservoir quality. Here we report a modern analogue study of 12 sediment cores from the Anllóns Estuary, Galicia, NW Spain, collected from a range of sub-environments, to help develop an understanding of the occurrence and distribution of coated grains. The cores were described for grain size, bioturbation and sedimentary structures, and then sub-sampled for electron and light microscopy, laser granulometry, and X-ray diffraction analysis. The Anllóns Estuary is sand-dominated with intertidal sand flats and saltmarsh environments at the margins; there is a shallowing/fining-upwards trend in the estuary-fill succession. Grain coats are present in nearly every sample analysed; they are between 1 μm and 100 μm thick and typically lack internal organisation. The extent of grain coat coverage can exceed 25% in some samples with coverage highest in the top 20 cm of cores. Samples from muddy intertidal flat and the muddy saltmarsh environments, close to the margins of the estuary, have the highest coat coverage (mean coat coverage of 20.2% and 21.3%, respectively). The lowest mean coat coverage occurs in the sandy saltmarsh (10.4%), beyond the upper tidal limit and sandy intertidal flat environments (8.4%), close to the main estuary channel. Mean coat coverage correlates with the concentration of clay fraction. The primary controls on the distribution of fine-grained sediment, and therefore grain coat distribution, are primary sediment transport and deposition processes that
International Nuclear Information System (INIS)
Miller, D. J.
1998-01-01
We have used studies of single grain boundaries in YBCO thin films and bulk bicrystals to study the influence of vortex pinning along a grain boundary on dissipation. The critical current density for transport across grain boundaries in thin films is typically more than an order of magnitude larger than that measured for transport across grain boundaries in bulk samples. For low disorientation angles, the difference in critical current density within the grains that form the boundary can contribute to the substantial differences in current density measured across the boundary. However, substantial differences exist in the critical current density across boundaries in thin film compared to bulk bicrystals even in the higher angle regime in which grain boundary dissipation dominates. The differences in critical current density in this regime can be understood on the basis of vortex pinning along the boundary
Reduced Height (Rht Alleles Affect Wheat Grain Quality.
Directory of Open Access Journals (Sweden)
Richard Casebow
Full Text Available The effects of dwarfing alleles (reduced height, Rht in near isogenic lines on wheat grain quality are characterised in field experiments and related to effects on crop height, grain yield and GA-sensitivity. Alleles included those that conferred GA-insensitivity (Rht-B1b, Rht-B1c, Rht-D1b, Rht-D1c as well as those that retained GA-sensitivity (rht(tall, Rht8, Rht8 + Ppd-D1a, Rht12. Full characterisation was facilitated by including factors with which the effects of Rht alleles are known to interact for grain yield (i.e. system, [conventional or organic]; tillage intensity [plough-based, minimum or zero]; nitrogen fertilizer level [0-450 kg N/ha]; and genetic backgrounds varying in height [cvs Maris Huntsman, Maris Widgeon, and Mercia]. Allele effects on mean grain weight and grain specific weight were positively associated with final crop height: dwarfing reduced these quality criteria irrespective of crop management or GA-sensitivity. In all but two experiments the effects of dwarfing alleles on grain nitrogen and sulphur concentrations were closely and negatively related to effects on grain yield, e.g. a quadratic relationship between grain yield and crop height manipulated by the GA-insensitive alleles was mirrored by quadratic relationships for nitrogen and sulphur concentrations: the highest yields and most dilute concentrations occurred around 80cm. In one of the two exceptional experiments the GA-insensitive Rht-B1b and Rht-B1c significantly (P<0.05 reduced grain nitrogen concentration in the absence of an effect on yield, and in the remaining experiment the GA-sensitive Rht8 significantly reduced both grain yield and grain nitrogen concentration simultaneously. When Rht alleles diluted grain nitrogen concentration, N:S ratios and SDS-sedimentation volumes were often improved. Hagberg falling number (HFN was negatively related to crop height but benefits from dwarfing were only seen for GA-insensitive alleles. For HFN, therefore, there
A novel grain cluster-based homogenization scheme
International Nuclear Information System (INIS)
Tjahjanto, D D; Eisenlohr, P; Roters, F
2010-01-01
An efficient homogenization scheme, termed the relaxed grain cluster (RGC), for elasto-plastic deformations of polycrystals is presented. The scheme is based on a generalization of the grain cluster concept. A volume element consisting of eight (= 2 × 2 × 2) hexahedral grains is considered. The kinematics of the RGC scheme is formulated within a finite deformation framework, where the relaxation of the local deformation gradient of each individual grain is connected to the overall deformation gradient by the, so-called, interface relaxation vectors. The set of relaxation vectors is determined by the minimization of the constitutive energy (or work) density of the overall cluster. An additional energy density associated with the mismatch at the grain boundaries due to relaxations is incorporated as a penalty term into the energy minimization formulation. Effectively, this penalty term represents the kinematical condition of deformation compatibility at the grain boundaries. Simulations have been performed for a dual-phase grain cluster loaded in uniaxial tension. The results of the simulations are presented and discussed in terms of the effective stress–strain response and the overall deformation anisotropy as functions of the penalty energy parameters. In addition, the prediction of the RGC scheme is compared with predictions using other averaging schemes, as well as to the result of direct finite element (FE) simulation. The comparison indicates that the present RGC scheme is able to approximate FE simulation results of relatively fine discretization at about three orders of magnitude lower computational cost
7 CFR 800.30 - Foreign commerce grain business.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Foreign commerce grain business. 800.30 Section 800.30 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS Registration...
Reduced Height (Rht) Alleles Affect Wheat Grain Quality.
Casebow, Richard; Hadley, Caroline; Uppal, Rajneet; Addisu, Molla; Loddo, Stefano; Kowalski, Ania; Griffiths, Simon; Gooding, Mike
2016-01-01
The effects of dwarfing alleles (reduced height, Rht) in near isogenic lines on wheat grain quality are characterised in field experiments and related to effects on crop height, grain yield and GA-sensitivity. Alleles included those that conferred GA-insensitivity (Rht-B1b, Rht-B1c, Rht-D1b, Rht-D1c) as well as those that retained GA-sensitivity (rht(tall), Rht8, Rht8 + Ppd-D1a, Rht12). Full characterisation was facilitated by including factors with which the effects of Rht alleles are known to interact for grain yield (i.e. system, [conventional or organic]; tillage intensity [plough-based, minimum or zero]; nitrogen fertilizer level [0-450 kg N/ha]; and genetic backgrounds varying in height [cvs Maris Huntsman, Maris Widgeon, and Mercia]. Allele effects on mean grain weight and grain specific weight were positively associated with final crop height: dwarfing reduced these quality criteria irrespective of crop management or GA-sensitivity. In all but two experiments the effects of dwarfing alleles on grain nitrogen and sulphur concentrations were closely and negatively related to effects on grain yield, e.g. a quadratic relationship between grain yield and crop height manipulated by the GA-insensitive alleles was mirrored by quadratic relationships for nitrogen and sulphur concentrations: the highest yields and most dilute concentrations occurred around 80cm. In one of the two exceptional experiments the GA-insensitive Rht-B1b and Rht-B1c significantly (Pgrain nitrogen concentration in the absence of an effect on yield, and in the remaining experiment the GA-sensitive Rht8 significantly reduced both grain yield and grain nitrogen concentration simultaneously. When Rht alleles diluted grain nitrogen concentration, N:S ratios and SDS-sedimentation volumes were often improved. Hagberg falling number (HFN) was negatively related to crop height but benefits from dwarfing were only seen for GA-insensitive alleles. For HFN, therefore, there was the strongest evidence for
Analytical study of spheroidal dust grains in plasma
International Nuclear Information System (INIS)
Zahed, H.; Mahmoodi, J.; Sobhanian, S.
2006-01-01
Using the modified spheroidal equations, the potential of a spheroidal conducting grain, floated in a plasma, is calculated. The electric field and capacitance for both prolate and oblate spheroidal grains are investigated. The solutions, obtained up to the second-order approximation, show that the plasma screening causes the equipotential surfaces around the grain to be more elongated or flattened than the potential spheroids of the Laplace equation. This leads to the variation of the plasma concentration around the grain
Consumer anxieties about food grain safety in China
Jackson, P.A.; Zhu, H.; Wang, W.
2016-01-01
China has a long history of eating staple plant foods which are mainly derived from food grains, especially rice and wheat. Food grain safety has been a worrying challenge on health and nutrition grounds in China, although evidence clearly suggests that expanding agricultural production is linked to reducing undernourishment. The focus of this study is to investigate consumers' anxieties about food grain safety in China. The nature and extent of consumer anxieties about grain safety, the caus...
Effects of grain size distribution on the interstellar dust mass growth
Hirashita, Hiroyuki; Kuo, Tzu-Ming
2011-01-01
Grain growth by the accretion of metals in interstellar clouds (called `grain growth') could be one of the dominant processes that determine the dust content in galaxies. The importance of grain size distribution for the grain growth is demonstrated in this paper. First, we derive an analytical formula that gives the grain size distribution after the grain growth in individual clouds for any initial grain size distribution. The time-scale of the grain growth is very sensitive to grain size di...
Electrons scattered inside small dust grains of various materials
International Nuclear Information System (INIS)
Richterova, Ivana; Beranek, Martin; Pavlu, Jiri; Nemecek, Zdenek; Safrankova, Jana
2010-01-01
The dust grain charge in an electron beam is given by a difference in numbers of electrons that fall onto the grain and those leaving it. Electrons with energies exceeding 1 keV can penetrate through submicron-sized dust grains. If the grain is small enough, a yield of these electrons reaches unity but they leave a part of their energy inside the grain and this energy excites secondary electrons. The paper presents a hybrid Monte Carlo code that simulates paths of the primary electrons inside a spherical grain and provides the yield of scattered electrons and their energy spectrum as a function of the grain size and material. This code is based on the Richterovaet al. [Phys. Rev. B 74, 235430 (2006)] model but it includes several corrections important for light materials like carbon or ice. The model was verified using experimental results obtained on large planar samples. For spherical samples, we have found that the yield of scattered electrons reaches unity for 50 nm Au grains illuminated by 5 keV electrons, whereas the same effect can be observed on ≅1000 nm carbon grains.
Quantum theory of multiscale coarse-graining.
Han, Yining; Jin, Jaehyeok; Wagner, Jacob W; Voth, Gregory A
2018-03-14
Coarse-grained (CG) models serve as a powerful tool to simulate molecular systems at much longer temporal and spatial scales. Previously, CG models and methods have been built upon classical statistical mechanics. The present paper develops a theory and numerical methodology for coarse-graining in quantum statistical mechanics, by generalizing the multiscale coarse-graining (MS-CG) method to quantum Boltzmann statistics. A rigorous derivation of the sufficient thermodynamic consistency condition is first presented via imaginary time Feynman path integrals. It identifies the optimal choice of CG action functional and effective quantum CG (qCG) force field to generate a quantum MS-CG (qMS-CG) description of the equilibrium system that is consistent with the quantum fine-grained model projected onto the CG variables. A variational principle then provides a class of algorithms for optimally approximating the qMS-CG force fields. Specifically, a variational method based on force matching, which was also adopted in the classical MS-CG theory, is generalized to quantum Boltzmann statistics. The qMS-CG numerical algorithms and practical issues in implementing this variational minimization procedure are also discussed. Then, two numerical examples are presented to demonstrate the method. Finally, as an alternative strategy, a quasi-classical approximation for the thermal density matrix expressed in the CG variables is derived. This approach provides an interesting physical picture for coarse-graining in quantum Boltzmann statistical mechanics in which the consistency with the quantum particle delocalization is obviously manifest, and it opens up an avenue for using path integral centroid-based effective classical force fields in a coarse-graining methodology.
Quantum theory of multiscale coarse-graining
Han, Yining; Jin, Jaehyeok; Wagner, Jacob W.; Voth, Gregory A.
2018-03-01
Coarse-grained (CG) models serve as a powerful tool to simulate molecular systems at much longer temporal and spatial scales. Previously, CG models and methods have been built upon classical statistical mechanics. The present paper develops a theory and numerical methodology for coarse-graining in quantum statistical mechanics, by generalizing the multiscale coarse-graining (MS-CG) method to quantum Boltzmann statistics. A rigorous derivation of the sufficient thermodynamic consistency condition is first presented via imaginary time Feynman path integrals. It identifies the optimal choice of CG action functional and effective quantum CG (qCG) force field to generate a quantum MS-CG (qMS-CG) description of the equilibrium system that is consistent with the quantum fine-grained model projected onto the CG variables. A variational principle then provides a class of algorithms for optimally approximating the qMS-CG force fields. Specifically, a variational method based on force matching, which was also adopted in the classical MS-CG theory, is generalized to quantum Boltzmann statistics. The qMS-CG numerical algorithms and practical issues in implementing this variational minimization procedure are also discussed. Then, two numerical examples are presented to demonstrate the method. Finally, as an alternative strategy, a quasi-classical approximation for the thermal density matrix expressed in the CG variables is derived. This approach provides an interesting physical picture for coarse-graining in quantum Boltzmann statistical mechanics in which the consistency with the quantum particle delocalization is obviously manifest, and it opens up an avenue for using path integral centroid-based effective classical force fields in a coarse-graining methodology.
Constitutive modeling of stress-driven grain growth in nanocrystalline metals
Gürses, Ercan
2013-02-08
In this work, we present a variational multiscale model for grain growth in face-centered cubic nanocrystalline (nc) metals. In particular, grain-growth-induced stress softening and the resulting relaxation phenomena are addressed. The behavior of the polycrystal is described by a conventional Taylor-type averaging scheme in which the grains are treated as two-phase composites consisting of a grain interior phase and a grain boundary-affected zone. Furthermore, a grain-growth law that captures the experimentally observed characteristics of the grain coarsening phenomena is proposed. To this end, the grain size is not taken as constant and varies according to the proposed stress-driven growth law. Several parametric studies are conducted to emphasize the influence of the grain-growth rule on the overall macroscopic response. Finally, the model is shown to provide a good description of the experimentally observed grain-growth-induced relaxation in nc-copper. © 2013 IOP Publishing Ltd.
Directory of Open Access Journals (Sweden)
Mariem Bradai
Full Text Available Reversible phosphorylation is an essential mechanism regulating signal transduction during development and environmental stress responses. An important number of dephosphorylation events in the cell are catalyzed by type one protein phosphatases (PP1, which catalytic activity is driven by the binding of regulatory proteins that control their substrate specificity or subcellular localization. Plants harbor several PP1 isoforms accounting for large functional redundancies. While animal PP1s were reported to play relevant roles in controlling multiple cellular processes, plant orthologs remain poorly studied. To decipher the role of plant PP1s, we compared PP1 genes from three monocot species, Brachypodium, common wheat and rice at the genomic and transcriptomic levels. To gain more insight into the wheat PP1 proteins, we identified and characterized TdPP1a, the first wheat type one protein phosphatase from a Tunisian durum wheat variety Oum Rabiaa3. TdPP1a is highly conserved in sequence and structure when compared to mammalian, yeast and other plant PP1s. We demonstrate that TdPP1a is an active, metallo-dependent phosphatase in vitro and is able to interact with AtI2, a typical regulator of PP1 functions. Also, TdPP1a is capable to complement the heat stress sensitivity of the yeast mutant indicating that TdPP1a is functional also in vivo. Moreover, transient expression of TdPP1a::GFP in tobacco leaves revealed that it is ubiquitously distributed within the cell, with a strong accumulation in the nucleus. Finally, transcriptional analyses showed similar expression levels in roots and leaves of durum wheat seedlings. Interestingly, the expression in leaves is significantly induced following salinity stress, suggesting a potential role of TdPP1a in wheat salt stress response.
Grain by grain study of the mechanisms of crack propagation during iodine SCC of Zry-4
International Nuclear Information System (INIS)
Haddad Andalag, R.E.
1993-01-01
This paper describes the tests conducted to determine the conditions leading to cracking of a specified grain of metal, focussing on the crystallographic orientation of crack paths, the critical stress conditions and the significance of the fractographic features encountered. In order to get orientable cracking, a technique was developed to produce iodine SCC, by means of pressurizing tubes of a specially heat treated Zry-4 having very large grains, shaped as discs of a few millimeters in diameter and grown up to the wall thickness. Careful orientation of fractured grains, performed by means of a back-reflection Laue technique with a precision better than one degree, has proved that transgranular cracking occurs only along basal planes. The effect of anisotropy, plasticity, triaxiality and residual stresses originated in thermal contraction, has to be considered to account for the influence of the stress state . A grain by grain calculation led to the conclusion that transgranular cracking always occurs on those bearing the maximum resolved tensile stress on basal planes. There are clear indications of the need of a triaxial stress state for the process to occur. Fracture modes other than pseudo-cleavage have been encountered, including intergranular separation, ductile tearing produced by prismatic slip and propagation along twin boundaries. In each case the fractographic features have been identified, and associations have been made with fractographs obtained in normal fuel cladding. (Author)
Sputtering of nano-grains by energetic ions
Bringa, E M
2002-01-01
Sputtering from grains with a size of tens of nanometers is important in a number of astrophysical environments having a variety of plasma properties and can have applications in nano-technology. Since energy deposition by incident ions or electrons can create 'hot' regions in a small grain, thermal spike (TS) models have been applied to estimate the sputtering. The excitations produced by a fast ion are often assumed to form a 'hot' cylindrical track. In this paper we use molecular dynamics (MD) calculations to describe the energy transport and sputtering due to the creation of a 'hot' track in a grain with one quarter million atoms. We show the enhancement due to grain size and find that TS models work over a limited range of excitation densities. Discrepancies of several orders of magnitude are found when comparing our MD results for sputtering of small dust grains to those obtained by the astrophysical community using spike models.
Study of magnetoresistance and conductance of bicrystal grain ...
Indian Academy of Sciences (India)
Presence of grain boundary exhibits substantial magnetoresistance ratio (MRR) in the low field and low temperature region. Bicrystal grain boundary contribution in MRR disappears at temperature > 175 K. At low temperature, - characteristic of the microbridge across bicrystal grain boundary is nonlinear. Analysis of ...
Sticking properties of ice grains
Directory of Open Access Journals (Sweden)
Jongmanns M.
2017-01-01
Full Text Available We study the size dependence of pull-off forces of water ice in laboratory experiments and numerical simulations. To determine the pull-off force in our laboratory experiments, we use a liquid nitrogen cooled centrifuge. Depending on its rotation frequency, spherical ice grains detach due to the centrifugal force which is related to the adhesive properties. Numerical simulations are conducted by means of molecular dynamics simulations of hexagonal ice using a standard coarse-grained water potential. The pull-off force of a single contact between two spherical ice grains is measured due to strain controlled simulations. Both, the experimental study and the simulations reveal a dependence between the pull-off force and the (reduced particle radii, which differ significantly from the linear dependence of common contact theories.
Grain Growth in Nanocrystalline Mg-Al Thin Films
Energy Technology Data Exchange (ETDEWEB)
Kruska, Karen; Rohatgi, Aashish; Vemuri, Venkata Rama Ses; Kovarik, Libor; Moser, Trevor H.; Evans, James E.; Browning, Nigel D.
2017-10-05
An improved understanding of grain growth kinetics in nanocrystalline materials, and in metals and alloys in general, is of continuing interest to the scientific community. In this study, Mg - Al thin films containing ~10 wt.% Al and with 14.5 nm average grain size were produced by magnetron-sputtering and subjected to heat-treatments. The grain growth evolution in the early stages of heat treatment at 423 K (150 °C), 473 K (200 °C) and 573K (300 °C) was observed with transmission electron microscopy and analyzed based upon the classical equation developed by Burke and Turnbull. The grain growth exponent was found to be 7±2 and the activation energy for grain growth was 31.1±13.4 kJ/mol, the latter being significantly lower than in bulk Mg-Al alloys. The observed grain growth kinetics are explained by the Al supersaturation in the matrix and the pinning effects of the rapidly forming beta precipitates and possibly shallow grain boundary grooves. The low activation energy is attributed to the rapid surface diffusion which is dominant in thin film systems.
Lead enrichment in different genotypes of rice grains.
Chen, Gang; Sun, Guo-rong; Liu, Ai-ping; Zhou, Wei-dong
2008-03-01
Using environmental scanning electron microscopy and X-ray electron probe microanalysis, the lead content was studied in inner and outer surface of rice glume, surface of caryopsis, center of caryopsis, near aleuronic layer and aleuronic layer in 21 genotypes of rice grains. The results showed that the lead content in different part of 21 genotypes of rice grains changed as inner surface of rice glume > aleuronic layer > near aleuronic layer > surface of caryopsis > outer surface of rice glume > center of caryopsis. There were genetic differences in lead enrichment in different genotypes of rice grains, which reflected as the differences of lead content in the same part and different part of rice grains. In different genotypes of rice grains, there were significant non-linear correlations between lead content in the inner surface of rice glume, center of caryopsis, aleuronic layer and that in the other parts of rice grain. The results also indicated that the lead enrichment in the center of caryopsis regulated by glume and aleuronic layer. In addition, in different genotypes of rice grains, there were differences in regulation of lead enrichment among different parts, which changed non-linearly.
Spent grain as energy source for breweries
Energy Technology Data Exchange (ETDEWEB)
Scharf, P; Meyer-Pittroff, R [Technical Univ. of Munich, Freising (West Germany)
1990-01-01
About 1.7 million tons of spent grain are produced from brewing operations each year in the Federal Republic of Germany. Because there is more spent grain than can be sold as cattle fodder, other uses for this product are being sought. These include composting, methane generation, and direct combustion. Researchers are using anaerobic fermentation as a means of producing biogas and using waste energy from the brewery to heat the fermenter. Combustion of spent grain can give a net energy of 12.8 MJ per kg dry grain. With biogas production, about 15-20% of the whole primary energy or 50% of the primary energy used in the boiling house could be substituted by the biogas.
International Nuclear Information System (INIS)
Trisviatski, L.A.
1973-01-01
First the importance of cereals collected in the S.S.S.R., the reason why the government had to put in practice a storage chain, composed of large capacity store houses (200 000 metric tonnes, or more) is reminded. When climatic conditions result in wet harvested grains, cereals are dried either in state enterprise dryers (32 to 50 tonnes/hour) or in kolkhozes' dryers (2 to 16 tonnes/hour). A new type of drying with recycling, has been developped, economizing 10 to 15 p. 100. Then the possibilities offered by the technique of partial drying of very wet grains are studied and the preservation processes using fresh ventilation, or hot ventilation with drying effect are described. The question of silage of wet grains destined to animal consumption is then examined as well as preservation by sodium pyrosulfide; the use of propionic acid, little developped in SSSR, is studied now, just as storage with inert gas. The struggle technics against insects, either with chemical agents, or with irradiation are described. Finally the modalities of technicians formation, specialized in preservation, are discussed [fr
Energy Technology Data Exchange (ETDEWEB)
Choi, Sung-Ji; Park, No-Jin [Kumoh National Institute of Technology, Gumi (Korea, Republic of); Joo, Hyung-Don; Park, Jong-Tae [POSCO, Pohang (Korea, Republic of)
2016-07-15
Grain-oriented electrical steel is used as a core material in transformers and motors. To obtain improved magnetic properties from the grain-oriented electrical steel, the steel should have a strong {110}<001> Goss texture. Recently, controlled manufacturing processes have been employed for developing electrical steels with a strong Goss texture. It is important to carry out research on the {411}<148> and {111}<112> oriented grains in relation to coincidence site lattice (CSL) boundaries, as they have an effect on the easy growth of the Goss grains upon secondary recrystallization. In this study, the behavior of the{411}<148> and {111}<112> oriented grains, which are neighbored with Goss grains after recrystallization with rapid and typical heating rates, and after decarburization, was examined by using x-ray diffraction (XRD) and electron back-scattered diffraction (EBSD) measurements. In the decarburized specimen, the Goss grains encroached the {411}<148> and {111}<112> oriented grains to a greater extent with a rapid heating rate than with a typical heating rate, and larger Goss grains were observed with the rapid heating rate. The {111}<112> oriented grains especially affect the easy growth of the Goss grains, as they are located near the Goss grains. Therefore, larger Goss grains can be produced at rapid heating rates, and the product is estimated to exhibit improved magnetic properties after secondary recrystallization.
Study of magnetoresistance and conductance of bicrystal grain ...
Indian Academy of Sciences (India)
Bicrystal grain boundary contribution in MRR disappears at temperature. T > 175 K. At low temperature, I–V characteristic of the microbridge across bicrystal grain bound- ary is nonlinear. Analysis of temperature dependence of dynamic conductance–voltage characteris- tics of the bicrystal grain boundary indicates that at ...
Zhang, Weiyang; Cao, Zhuanqin; Zhou, Qun; Chen, Jing; Xu, Gengwen; Gu, Junfei; Liu, Lijun; Wang, Zhiqin; Yang, Jianchang; Zhang, Hao
2016-01-01
This study determined if the variation in grain filling parameters between two different spikelet types of rice (Oryza sativa L.) is regulated by the hormonal levels in the grains. Two rice mutants, namely, a large-grain mutant (AZU-M) and a small-grain mutant (ZF802-M), and their respective wild types (AZU-WT and ZF802-WT) were grown in the field. The endosperm cell division rate, filling rate, and hormonal levels: zeatin + zeatin riboside (Z+ZR), indo-3-acetic acid (IAA), polyamines (PAs), and abscisic acid (ABA) were determined. The results showed that there was no significant difference between the filling and endosperm cell division rates. These rates were synchronous between the superior and inferior spikelets for both mutants. However, the abovementioned parameters were significantly different between the two spikelet types for the two wild types. The superior spikelets filled faster and their filling rate was higher compared to the inferior ones. Changes in the concentrations of plant hormones were consistent with the observed endosperm cell division rate and the filling rate for both types of spikelets of mutant and wild type plants. Regression analysis showed a significant positive correlation between cell division and filling rates with the concentrations of the investigated hormones. Exogenous chemical application verified the role of ABA, IAA, and PAs in grain filling. The results indicate that poor filling of inferior spikelets in rice occurs primarily due to the reduced hormone concentrations therein, leading to lower division rate of endosperm cells, fewer endosperm cells, slower filling rate, and smaller grain weight.
Directory of Open Access Journals (Sweden)
Weiyang Zhang
Full Text Available This study determined if the variation in grain filling parameters between two different spikelet types of rice (Oryza sativa L. is regulated by the hormonal levels in the grains. Two rice mutants, namely, a large-grain mutant (AZU-M and a small-grain mutant (ZF802-M, and their respective wild types (AZU-WT and ZF802-WT were grown in the field. The endosperm cell division rate, filling rate, and hormonal levels: zeatin + zeatin riboside (Z+ZR, indo-3-acetic acid (IAA, polyamines (PAs, and abscisic acid (ABA were determined. The results showed that there was no significant difference between the filling and endosperm cell division rates. These rates were synchronous between the superior and inferior spikelets for both mutants. However, the abovementioned parameters were significantly different between the two spikelet types for the two wild types. The superior spikelets filled faster and their filling rate was higher compared to the inferior ones. Changes in the concentrations of plant hormones were consistent with the observed endosperm cell division rate and the filling rate for both types of spikelets of mutant and wild type plants. Regression analysis showed a significant positive correlation between cell division and filling rates with the concentrations of the investigated hormones. Exogenous chemical application verified the role of ABA, IAA, and PAs in grain filling. The results indicate that poor filling of inferior spikelets in rice occurs primarily due to the reduced hormone concentrations therein, leading to lower division rate of endosperm cells, fewer endosperm cells, slower filling rate, and smaller grain weight.
Wautier, Antoine; Bonelli, Stéphane; Nicot, François
2017-06-01
Suffusion is the selective erosion of the finest particles of a soil subjected to an internal flow. Among the four types of internal erosion and piping identified today, suffusion is the least understood. Indeed, there is a lack of micromechanical approaches for identifying the critical microstructural parameters responsible for this process. Based on a discrete element modeling of non cohesive granular assemblies, specific micromechanical tools are developed in a unified framework to account for the two first steps of suffusion, namely the grain detachment and the grain transport processes. Thanks to the use of an enhanced force chain definition and autocorrelation functions the typical lengths scales associated with grain detachment are characterized. From the definition of transport paths based on a graph description of the pore space the typical lengths scales associated with grain transport are recovered. For a uniform grain size distribution, a separation of scales between these two processes exists for the finest particles of a soil
Grain transport mechanics in shallow flow
A physical model based on continuum multiphase flow is described to represent saltating transport of grains in shallow overland flows. The two-phase continuum flow of water and sediment considers coupled St.Venant type equations. The interactive cumulative effect of grains is incorporated by a dispe...
Grain breakage under uniaxial compression, through 3D DEM modelling
Directory of Open Access Journals (Sweden)
Nader François
2017-01-01
Full Text Available A breakable grain model is presented, using the concept of particles assembly. Grains of polyhedral shapes are generated, formed by joining together tetrahedral subgrains using cohesive bonds. Single grain crushing simulations are performed for multiple values of the intra-granular cohesion to study the effect on the grain’s strength. The same effect of intra-granular cohesion is studied under oedometric compression on samples of around 800 grains, which allows the evaluation of grain breakage model on the macroscopic behaviour. Grain size distribution curves and grain breakage ratios are monitored throughout the simulations.
Suriyasak, Chetphilin; Harano, Keisuke; Tanamachi, Koichiro; Matsuo, Kazuhiro; Tamada, Aina; Iwaya-Inoue, Mari; Ishibashi, Yushi
2017-09-01
Heat stress during grain filling increases rice grain chalkiness due to increased activity of α-amylase, which hydrolyzes starch. In rice and barley seeds, reactive oxygen species (ROS) produced after imbibition induce α-amylase activity via regulation of gibberellin (GA) and abscisic acid (ABA) levels during seed germination. Here, we examined whether ROS is involved in induction of grain chalkiness by α-amylase in developing rice grains under heat stress. To elucidate the role of ROS in grain chalkiness, we grew post-anthesis rice plants (Oryza sativa L. cv. Koshihikari) under control (25°C) or heat stress (30°C) conditions with or without antioxidant (dithiothreitol) treatment. The developing grains were analyzed for expression of NADPH oxidases, GA biosynthesis genes (OsGA3ox1, OsGA20ox1), ABA catabolism genes (OsABA8'OH1, OsABA8'OH2) and an α-amylase gene (OsAmy3E), endogenous H 2 O 2 content and the grain quality. In grains exposed to heat stress, the expression of NADPH oxidase genes (especially, OsRbohB, OsRbohD, OsRbohF and OsRbohI) and the ROS content increased. Heat stress also increased the expression of OsGA3ox1, OsGA20ox1, OsABA8'OH1, OsABA8'OH2 and OsAmy3E. On the other hand, dithiothreitol treatment reduced the effects of heat stress on the expression of these genes and significantly reduced grain chalkiness induced by heat stress. These results suggest that, similar to cereal seed germination mechanism, ROS produced under heat stress is involved in α-amylase induction in maturating rice grains through GA/ABA metabolism, and consequently caused grain chalkiness. Copyright © 2017 Elsevier GmbH. All rights reserved.
Brassard, M-E; Chouinard, P Y; Berthiaume, R; Tremblay, G F; Gervais, R; Martineau, R; Cinq-Mars, D
2015-11-01
Microbial protein synthesis in the rumen would be optimized when dietary carbohydrates and proteins have synchronized rates and extent of degradation. The aim of this study was to evaluate the effect of varying ruminal degradation rate of energy and nitrogen sources on intake, nitrogen balance, microbial protein yield, and kinetics of nutrients in the rumen of growing kids. Eight Boer goats (38.2 ± 3.0 kg) were used. The treatments were arranged in a split-plot Latin square design with grain sources (barley or corn) forming the main plots (squares). Grain processing methods and levels of protein degradability formed the subplots in a 2 × 2 factorial arrangement for a total of 8 dietary treatments. The grain processing method was rolling for barley and cracking for corn. Levels of protein degradability were obtained by feeding untreated soybean meal (SBM) or heat-treated soybean meal (HSBM). Each experimental period lasted 21 d, consisting of a 10-d adaptation period, a 7-d digestibility determination period, and a 4-d rumen evacuation and sampling period. Kids fed with corn had higher purine derivatives (PD) excretion when coupled with SBM compared with HSBM and the opposite occurred with barley-fed kids ( ≤ 0.01). Unprocessed grain offered with SBM led to higher PD excretion than with HSBM whereas protein degradability had no effect when processed grain was fed ( ≤ 0.03). Results of the current experiment with high-concentrate diets showed that microbial N synthesis could be maximized in goat kids by combining slowly fermented grains (corn or unprocessed grains) with a highly degradable protein supplement (SBM). With barley, a more rapidly fermented grain, a greater microbial N synthesis was observed when supplementing a low-degradable protein (HSBM).
Spring Small Grains Area Estimation
Palmer, W. F.; Mohler, R. J.
1986-01-01
SSG3 automatically estimates acreage of spring small grains from Landsat data. Report describes development and testing of a computerized technique for using Landsat multispectral scanner (MSS) data to estimate acreage of spring small grains (wheat, barley, and oats). Application of technique to analysis of four years of data from United States and Canada yielded estimates of accuracy comparable to those obtained through procedures that rely on trained analysis.
Shock fabrics in fine-grained micrometeorites
Suttle, M. D.; Genge, M. J.; Russell, S. S.
2017-10-01
The orientations of dehydration cracks and fracture networks in fine-grained, unmelted micrometeorites were analyzed using rose diagrams and entropy calculations. As cracks exploit pre-existing anisotropies, analysis of their orientation provides a mechanism with which to study the subtle petrofabrics preserved within fine-grained and amorphous materials. Both uniaxial and biaxial fabrics are discovered, often with a relatively wide spread in orientations (40°-60°). Brittle deformation cataclasis and rotated olivine grains are reported from a single micrometeorite. This paper provides the first evidence for impact-induced shock deformation in fine-grained micrometeorites. The presence of pervasive, low-grade shock features in CM chondrites and CM-like dust, anomalously low-density measurements for C-type asteroids, and impact experiments which suggest CM chondrites are highly prone to disruption all imply that CM parent bodies are unlikely to have remained intact and instead exist as a collection of loosely aggregated rubble-pile asteroids, composed of primitive shocked clasts.
Generalized coarse-grained Becker-Doering equations
International Nuclear Information System (INIS)
Bolton, Colin D; Wattis, Jonathan A D
2003-01-01
We present and apply a generalized coarse-graining method of reducing the Becker-Doering model; originally formulated to describe the stepwise aggregation and fragmentation of clusters during nucleation. Previous formulations of the coarse-graining procedure have allowed a temporal rescaling of the coarse-grained reaction rates; this is generalized to allow the rescaling to depend on cluster size. The form of this factor is derived for general reaction rates and general mesh function so that the steady-state solution is preserved; in the case of an even mesh function the kinetics can also be accurately reproduced. With a size-dependent mesh function the equilibrium solution and the form of convergence to this state are matched for a specific example. Finally we consider reaction rates relevant to the classical nucleation theory of spherical cluster growth, and numerically compare solutions of the full system to the generalized coarse-grained system in both constant monomer and constant mass formulations, demonstrating the accuracy of the method
Simulation of growing grains under orientation relation - dependent quadruple point dragging
International Nuclear Information System (INIS)
Ito, K
2015-01-01
The growth behaviour of a specified grain embedded in matrix grains, for which the migration mobility of the quadruple points depended on the relation between the orientations of the growing and shrinking grains, was studied using a modified Potts MC-type threedimensional simulation. Large embedded grains continued to grow without being overcome by coarsening matrix grains, whereas small embedded grains disappeared, under the influence of the relative mobilities of the quadruple points, the composition of the matrix grain texture and the width of the grain size distribution of the matrix grains. These results indicate that orientation relation-dependent quadruple point dragging can affect the recrystallization texture during the grain coarsening stage. (paper)
Simulation study on the growth of grains in dusty plasmas
International Nuclear Information System (INIS)
Sato, Tetsuya; Watanabe, Kunihiko
1997-01-01
A new particle simulation code is developed for studying the dynamics of the grains which are exposed to charging by the background plasma particles. Effects of regular attachment of electrons and ions, effects of secondary electron emission, and coagulation of grains are included in this code. Simulation results show that grains randomly change their charges from negative to positive, or from positive to negative in a 'flip-flop' fashion as a result of competition between the electron attachment and secondary electron emission. It is found that the flip-flop effect becomes remarkable when the radius of grains is of the order of 10 nm, because the attachment of a single electron to a grain is less effective on the surface potential for larger grains, while the average probability of electron attachment is smaller for smaller grains. Grains with opposite charges attract each other to coagulate, so that grains of size of 10 nm are likely to grow in size. The flip-flop effect is found to be essential to the growth of grains. (author)
Why Is It Important to Eat Grains, Especially Whole Grains?
... Style What Is a Healthy Eating Style? Choosing Foods and Beverages Saturated, Unsaturated, and Trans Fats Sodium Added Sugars ... may reduce the risk of heart disease. Consuming foods containing fiber, ... weight management. Eating grain products fortified with folate before and ...
Nanocrystalline and ultrafine grain copper obtained by mechanical attrition
Directory of Open Access Journals (Sweden)
Rodolfo Rodríguez Baracaldo
2010-01-01
Full Text Available This article presents a method for the sample preparation and characterisation of bulk copper having grain size lower than 1 μm (ultra-fine grain and lower than 100 nm grain size (nanocrystalline. Copper is initially manufactured by a milling/alloying me- chanical method thereby obtaining a powder having a nanocrystalline structure which is then consolidated through a process of warm compaction at high pressure. Microstructural characterisation of bulk copper samples showed the evolution of grain size during all stages involved in obtaining it. The results led to determining the necessary conditions for achieving a wide range of grain sizes. Mechanical characterisation indicated an increase in microhardness to values of around 3.40 GPa for unconsolida- ted nanocrystalline powder. Compressivee strength was increased by reducing the grain size, thereby obtaining an elastic limit of 650 MPa for consolidated copper having a ~ 62 nm grain size.
Insect pest management in stored grain
Stored grain is vulnerable to attach by a variety of insect pests, that can generally be classified as external or internal feeders. Infestations primarily occur after grain is stored, though there is some evidence that infestations can occur in the field right before harvest. There are a variety of...
Computerized radioautographic grain counting
International Nuclear Information System (INIS)
McKanna, J.A.; Casagrande, V.A.
1985-01-01
In recent years, radiolabeling techniques have become fundamental assays in physiology and biochemistry experiments. They also have assumed increasingly important roles in morphologic studies. Characteristically, radioautographic analysis of structure has been qualitative rather than quantitative, however, microcomputers have opened the door to several methods for quantifying grain counts and density. The overall goal of this chapter is to describe grain counting using the Bioquant, an image analysis package based originally on the Apple II+, and now available for several popular microcomputers. The authors discuss their image analysis procedures by applying them to a study of development in the central nervous system
Grain iron density variability among new farmer-preferred ...
African Journals Online (AJOL)
Grain micronutrient content assessment is important in breeding pearl millet, in order to maintain or improve its high nutritional quality. Grain samples of 12 farmer-preferred pearl millet varieties produced in four representative environments in Niger during the 2013 rainy season were assessed for Fe, Zn, Al and P grain ...
FORMATION INNOVATIVELY FOCUSED INFRASTRUCTURE OF THE GRAIN MARKET
Directory of Open Access Journals (Sweden)
D. S. Latynin
2014-01-01
Full Text Available Summary. The perspective scheme of infrastructure of the modern grain market is directed on perfection merchandising grains by means of liquidation of is material disproportions between its participants for decrease in logistical costs counting upon 1 t grains, and creations of the alternative organized channel merchandising, providing a direct output on the wholesale market of direct commodity producers of grain and their participation in distribution of profit received from export. Elimination of is material disproportions on all circuit passage of grain from the supplier of production up to the end user is necessary for connecting with the organization merchandising on principles of logistics. It will allow to ensure the general synergistic effect exceeding total effect at separate participants of a circuit. The structure of Association participants of the grain market, is directed on creation mutual interest by a deepening specialization of each participant merchandising, consolidations of their investment resources to development of this circuit, to decrease in logistical costs. Feature of the modern period functioning of the grain market is necessity acceleration of scientific and technical progress on the basis of innovative processes. Innovative activity causes necessity of faster development of an infrastructure of the grain market. One directions promotion of innovations is development in region techno park formations. Their advantage consists in an opportunity initiators of new technologies independently to carry out their scientific and design development and to advance a grain husbandry through commercialization and a transfer. With a view modernization of a regional infrastructure of the grain market in modern conditions creation electronic trading platform, introduction system of electronic commerce is extremely actual. By means of electronic technologies economic attitudes in the market essentially change, giving to them scale
Tsunami sediments and their grain size characteristics
Sulastya Putra, Purna
2018-02-01
Characteristics of tsunami deposits are very complex as the deposition by tsunami is very complex processes. The grain size characteristics of tsunami deposits are simply generalized no matter the local condition in which the deposition took place. The general characteristics are fining upward and landward, poor sorting, and the grain size distribution is not unimodal. Here I review the grain size characteristics of tsunami deposit in various environments: swale, coastal marsh and lagoon/lake. Review results show that although there are similar characters in some environments and cases, but in detail the characteristics in each environment can be distinguished; therefore, the tsunami deposit in each environment has its own characteristic. The local geological and geomorphological condition of the environment may greatly affect the grain size characteristics.
Long-range interaction between dust grains in plasma
Directory of Open Access Journals (Sweden)
D.Yu. Mishagli
2014-03-01
Full Text Available The nature of long-range interactions between dust grains in plasma is discussed. The dust grain interaction potential within a cell model of dusty plasma is introduced. The attractive part of inter-grain potential is described by multipole interaction between two electro-neutral cells. This allowed us to draw an analogy with molecular liquids where attraction between molecules is determined by dispersion forces. Also main ideas of the fluctuation theory for electrostatic field in cell model are formulated, and the dominating contribution to attractive part of inter-grain potential is obtained.
RF installation for the grain disinfestation
Zajtzev, B V; Kobetz, A F; Rudiak, B I
2001-01-01
The ecologically pure method of grain product disinfestations through the grain treatment with the RF electric field is described. The experimental data obtained showed that with strengths of the electrical RF field of E=5 kV/cm and frequency of 80 MHz the relative death rate is 100%.The time of the grain treatment it this case is 1 sec. The pulses with a duration of 600 mu s and repetition rate of 2 Hz were used, the duration of the front was 10 mu s. The schematic layout of installation with a productivity of 50 tones/h and power of 10 kW is given.
Towards modeling intergranular stress corrosion cracks on grain size scales
International Nuclear Information System (INIS)
Simonovski, Igor; Cizelj, Leon
2012-01-01
Highlights: ► Simulating the onset and propagation of intergranular cracking. ► Model based on the as-measured geometry and crystallographic orientations. ► Feasibility, performance of the proposed computational approach demonstrated. - Abstract: Development of advanced models at the grain size scales has so far been mostly limited to simulated geometry structures such as for example 3D Voronoi tessellations. The difficulty came from a lack of non-destructive techniques for measuring the microstructures. In this work a novel grain-size scale approach for modelling intergranular stress corrosion cracking based on as-measured 3D grain structure of a 400 μm stainless steel wire is presented. Grain topologies and crystallographic orientations are obtained using a diffraction contrast tomography, reconstructed within a detailed finite element model and coupled with advanced constitutive models for grains and grain boundaries. The wire is composed of 362 grains and over 1600 grain boundaries. Grain boundary damage initialization and early development is then explored for a number of cases, ranging from isotropic elasticity up to crystal plasticity constitutive laws for the bulk grain material. In all cases the grain boundaries are modeled using the cohesive zone approach. The feasibility of the approach is explored.
Advanced technologies available for future solid propellant grains
Energy Technology Data Exchange (ETDEWEB)
Thepenier, J. [SNPE Propulsion, St Medard en Jalles (France); Fonblanc, G. [SNPE Propulsion, Vert le Petit (France). Centre de Recherche de Bouchet
2001-06-01
Significant advances have been made during the last decade in several fields of solid propulsion: the advances have enabled new savings in the motor development phase and in recurring costs, because they help limit the number of prototypes and tests. The purpose of the paper is to describe the improvements achieved by SNPE in solid grain technologies, making these technologies available for new developments in more efficient and reliable future SRMs: new energetic molecules, new solid propellants, new processes for grain manufacturing, quick response grain design tools associated with advanced models for grain performance predictions. Using its expertise in chemical synthesis, SNPE develops new molecules to fit new energetic material requirements. Tests based on new propellant formulations have produced good results in the propellant performance/safety behavior ratio. New processes have been developed simultaneously to reduce the manufacturing costs of the new propellants. In addition, the grain design has been optimized by using the latest generation of predictive theoretical tools supported by a large data bank of experimental parameters resulting from over 30 years' experience in solid propulsion: computer-aided method for the preliminary grain design; advanced models for SRM operating and performance predictions. All these technologies are available for industrial applications in future developments of solid propellant grains. (author)
Ancient whole grain gluten-free egg-free Pasta
The USDA food guide recommends that at least ½ of all the grains eaten should be whole grains. The FDA allows food Health Claim labels for food containing 51% whole gains and 11 g of dietary fiber per serving. This is the only report demonstrating innovative ancient whole grain, gluten-free, egg-fre...
Protein (Viridiplantae): 799502 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available hypodium distachyon MMLSMPTDCWPDPVDCYEHLFCHMMQIYSLKLAYTSADADTSGNPILLYGFMAVRDCLNPR...RNYVFRRTRDDPFVVVQDSNGSSFIRMSGPKRGIEMQSLVLVEFDMRIKIGENEEDDLQLIDGAIYFDSLVLPPDMIINRRIVGDCGAVDMSLAFLHCAAEATIQVGI
Superconductivity of individual grains and inter-grain boundaries for polycrystalline FeSr2YCu2O6+y
International Nuclear Information System (INIS)
Yamaguchi, K.; Hata, Y.; Mochiku, T.; Yasuoka, H.
2013-01-01
Polycrystalline FeSr 2 YCu 2 O 6+y was synthesized and its transport and magnetic properties were studied. Diamagnetism was observed below 60 K. Zero resistivity was observed below 38 K under zero magnetic field and below 10 K under 160 kOe. A two-step transition was observed in resistivity measurement due to the superconductivity in individual grains and across inter-grain boundaries. The critical current density in individual grains, J c intra , at 2 K under 1 kOe was deduced 3.4 × 10 5 A/cm 2 from the Bean model. In contrast, the critical current density in inter-grain boundaries, J c inter , at 2 K was 1.7 A/cm 2 in voltage–current measurement. The two-step transition seems to result from the large difference between J c intra and J c inter
Nadella, R.; Eskin, D.G.; Katgerman, L.
2007-01-01
Direct-chill (DC) cast billets 192 mm in diameter of an Al-Cu-Mg alloy were examined in detail with the aim to reveal the effects of grain refining (GR) and casting speed on structure, “floating” grains, and centerline macrosegregation. Experimental results show that grain size and dendrite arm
Ultrastructure of Withania Somnifera (L.) Dunal pollen grains
International Nuclear Information System (INIS)
Alwadie, H.M.
2002-01-01
Light, scanning and transmission electron microscopy were used to study the morphology and ultrastructure of Withania Somnifera (L.) Dunall pollen grains. Light microscopic examination revealed that the pollen grains are tri- or tetrazonocoplate grains, approximately as long as broad, measuring 29-um. Scanning electron microscopic observation showed that surface sculpturing of the pollen is scarbate-granulate. Ultrathin sections as examined by transmission electron microscope showed that the pollen contained numerous starch grains, lipid droplets, endoplasmic reticulum and vesicles of dictyosomes. Two layers of the pollen wall were also distinguished, the outer wall (exine) divided into ektexine and endexine as well as the inner layer (intine). The nutritive values of Withania pollen are discussed. The importance of studying the ultrastructure of pollen grains as a new tool in palynology is also discussed. (author)
Deacon, S P; Paddle, G M
1998-05-01
A health surveillance study of male grain food manufacturing workers used a respiratory health questionnaire and spirometry to assess the prevalence of work-related respiratory symptoms and impaired ventilatory performance. The prevalence of cough, breathlessness, wheeze and chest tightness was between 8-13% but was 20% for rhinitis. Rhinitis was the most common symptom with 37% of those reporting rhinitis describing this as work-related. A case-control analysis of workers reporting rhinitis did not identify any specific occupational activities associated with increased risk of rhinitis. Smoking habit and all respiratory symptoms apart from rhinitis had a significant effect upon ventilatory performance. Occupational exposure to raw grains, flour, ingredients and finished food was categorized as high, medium or low in either continuous or intermediate patterns. Multiple regression analysis confirmed the effects of height, age and smoking upon ventilatory performance. However, occupational exposure to grain, flour, food ingredients and cooked food dusts had no effect upon ventilatory performance. It is concluded that smoking habit is the major determinant of respiratory symptoms and impaired ventilatory function. The excess complaints of rhinitis warrant further study but it would appear that the current occupational exposure limits for grain, flour, food ingredients and cooked food dusts are adequate to protect workers against impairment of ventilatory performance.
Grain weight improvement in wheat through irradiation
International Nuclear Information System (INIS)
Rasal, P.N.; Gadekar, D.A.; Gavhane, V.N.; Bhoite, K.D.
2006-01-01
T. aestivum wheat variety NIAW 34 was developed by Agricultural Research Station, Niphad, and was released by Central Varietal Release Committee, for cultivation under irrigated late sown conditions of Peninsular Zone. The grains of NIAW 34 are medium sized with 40g 1000 grain weight. However, in market the bold sized grains (above 40g 1000 grain weight) are preferred by the traders and consumers. To overcome this lacuna, grains of wheat variety NIAW 34 were irradiated to exploit the possibilities of improvement in test weight. The material was irradiated with 15 and 20 kr dose of gamma rays. In M2 generation, mutants for various morphological characters were observed. The plants showing vigorous growth habit and desirable morphological characters were selected. These selected plants were studied for grain characters after harvest. On the basis of improved test weight as compared to parental line, selections were effected. The material was advanced to M6 generation and found stable for character of interest. The material selected comprised of total 10 lines showing improved test weight having range of 42-46 g i.e. increase of 4-6 g over the parental line NIAW 34. The lines selected are being evaluated in yield evaluation trials during Rabi 2006-07. Amongst the doses used, frequency of desired mutants was higher in treatment, of 15 kr
The grain charging and the dust acoustic wave instability
International Nuclear Information System (INIS)
Varma, Ram K.
2001-01-01
The stability of the steady charging state of the assembly of dust grains in a plasma is analyzed using, besides the equations of continuity and momentum balance, also the equations of thermal energy balance with the grain charging terms for both the electron and ion species. The grain charging terms account for the energy exchange between the dust grains and the electron and ion fluids. The grains are taken to be immobile for the purpose of this analysis. Two limiting cases are analyzed: (i) f(≡4πn d λ D 2 a) >1 (n d is the dust number density, λ D plasma Debye length, and a, the grain radius). The steady grain charge state is found to be stable in the case f o is unaffected. On the other hand, in the limit f>>1, the state is found to be unstable provided γ q (≡q o e/aT e ) e -T i )/T e (T e , T i are electron and ion temperatures). A coherent charging of the dust grains results as a consequence of this instability until γ q ≅(1/2) (T e -T i )/T i . Next, by letting the grain charges be mobile, so that the perturbation of dust number density is nonzero, we examine the stability of the dust-acoustic wave (DAW). The DAW is found to be unstable, also in the f>>1 case, while stable in the f<<1. The instability of the DAW also implies a concomitant grain charge growth, which would again be of a coherent nature
Micromechanics of pressure-induced grain crushing in porous rocks
Zhang, Jiaxiang; Wong, Teng-Fong; Davis, Daniel M.
1990-01-01
The hydrostatic compaction behavior of a suite of porous sandstones was investigated at confining pressures up to 600 MPa and constant pore pressures ranging up to 50 MPa. These five sandstones (Boise, Kayenta, St. Peter, Berea, and Weber) were selected because of their wide range of porosity (5-35%) and grain size (60-460 μm). We tested the law of effective stress for the porosity change as a function of pressure. Except for Weber sandstone (which has the lowest porosity and smallest grain size), the hydrostat of each sandstone shows an inflection point corresponding to a critical effective pressure beyond which an accelerated, irrecoverable compaction occurs. Our microstructural observations show that brittle grain crushing initiates at this critical pressure. We also observed distributed cleavage cracking in calcite and intensive kinking in mica. The critical pressures for grain crushing in our sandstones range from 75 to 380 MPa. In general, a sandstone with higher porosity and larger grain size has a critical pressure which is lower than that of a sandstone with lower porosity and smaller grain size. We formulate a Hertzian fracture model to analyze the micromechanics of grain crushing. Assuming that the solid grains have preexisting microcracks with dimensions which scale with grain size, we derive an expression for the critical pressure which depends on the porosity, grain size, and fracture toughness of the solid matrix. The theoretical prediction is in reasonable agreement with our experimental data as well as other data from soil and rock mechanics studies for which the critical pressures range over 3 orders of magnitude.
On the theory of dynamics of dust grain in plasma
Stepanenko, A. A.; Krasheninnikov, S. I.
2013-03-01
The dynamics of rotationally symmetric dust grains in plasma embedded in a magnetic field are of concern. The general expressions for forces and torques acting on dust are found. It is shown that dust spinning is determined by torques related to both the Lorentz force (dominant for relatively small grains) and the gyro-motion of plasma particles impinging the grain (which prevails for large grains). The stability of grain spinning is analyzed and it is shown that, for some cases (e.g., oblate spheroid), there is no stable dynamic equilibrium of grain spinning.
Jansen, R.C.; Nijs, A.P.M. den
1993-01-01
The size of pollen grains is commonly used to indicate the ploidy level of pollen grains. In this paper observations of the diameter of pollen grains are evaluated from one diploid accession of perennial ryegrass (Lolium perenne L.), which was expected to produce diploid (unreduced) pollen grains in
Attraction of likely charged nano-sized grains in dust-electron plasmas
Energy Technology Data Exchange (ETDEWEB)
Vishnyakov, Vladimir I., E-mail: eksvar@ukr.net [Physical-Chemical Institute for Environmental and Human Protection, Odessa 65082 (Ukraine)
2016-01-15
Dust-electron plasma, which contains only the dust grains and electrons, emitted by them, is studied. Assumption of almost uniform spatial electrons distribution, which deviates from the uniformity only near the dust grains, leads to the grain charge division into two parts: first part is the individual for each grain “visible” charge and the second part is the common charge of the neutralized background. The visible grain charge can be both negative and positive, while the total grain charge is only positive. The attraction of likely charged grains is possible, because the grain interaction is determined by the visible charges. The equilibrium state between attraction and repulsion of grains is demonstrated.
Biological conversion assay using Clostridium phytofermentans to estimate plant feedstock quality.
Lee, Scott J; Warnick, Thomas A; Pattathil, Sivakumar; Alvelo-Maurosa, Jesús G; Serapiglia, Michelle J; McCormick, Heather; Brown, Virginia; Young, Naomi F; Schnell, Danny J; Smart, Lawrence B; Hahn, Michael G; Pedersen, Jeffrey F; Leschine, Susan B; Hazen, Samuel P
2012-02-08
There is currently considerable interest in developing renewable sources of energy. One strategy is the biological conversion of plant biomass to liquid transportation fuel. Several technical hurdles impinge upon the economic feasibility of this strategy, including the development of energy crops amenable to facile deconstruction. Reliable assays to characterize feedstock quality are needed to measure the effects of pre-treatment and processing and of the plant and microbial genetic diversity that influence bioconversion efficiency. We used the anaerobic bacterium Clostridium phytofermentans to develop a robust assay for biomass digestibility and conversion to biofuels. The assay utilizes the ability of the microbe to convert biomass directly into ethanol with little or no pre-treatment. Plant samples were added to an anaerobic minimal medium and inoculated with C. phytofermentans, incubated for 3 days, after which the culture supernatant was analyzed for ethanol concentration. The assay detected significant differences in the supernatant ethanol from wild-type sorghum compared with brown midrib sorghum mutants previously shown to be highly digestible. Compositional analysis of the biomass before and after inoculation suggested that differences in xylan metabolism were partly responsible for the differences in ethanol yields. Additionally, we characterized the natural genetic variation for conversion efficiency in Brachypodium distachyon and shrub willow (Salix spp.). Our results agree with those from previous studies of lignin mutants using enzymatic saccharification-based approaches. However, the use of C. phytofermentans takes into consideration specific organismal interactions, which will be crucial for simultaneous saccharification fermentation or consolidated bioprocessing. The ability to detect such phenotypic variation facilitates the genetic analysis of mechanisms underlying plant feedstock quality.
Biological conversion assay using Clostridium phytofermentans to estimate plant feedstock quality
Directory of Open Access Journals (Sweden)
Lee Scott J
2012-02-01
Full Text Available Abstract Background There is currently considerable interest in developing renewable sources of energy. One strategy is the biological conversion of plant biomass to liquid transportation fuel. Several technical hurdles impinge upon the economic feasibility of this strategy, including the development of energy crops amenable to facile deconstruction. Reliable assays to characterize feedstock quality are needed to measure the effects of pre-treatment and processing and of the plant and microbial genetic diversity that influence bioconversion efficiency. Results We used the anaerobic bacterium Clostridium phytofermentans to develop a robust assay for biomass digestibility and conversion to biofuels. The assay utilizes the ability of the microbe to convert biomass directly into ethanol with little or no pre-treatment. Plant samples were added to an anaerobic minimal medium and inoculated with C. phytofermentans, incubated for 3 days, after which the culture supernatant was analyzed for ethanol concentration. The assay detected significant differences in the supernatant ethanol from wild-type sorghum compared with brown midrib sorghum mutants previously shown to be highly digestible. Compositional analysis of the biomass before and after inoculation suggested that differences in xylan metabolism were partly responsible for the differences in ethanol yields. Additionally, we characterized the natural genetic variation for conversion efficiency in Brachypodium distachyon and shrub willow (Salix spp.. Conclusion Our results agree with those from previous studies of lignin mutants using enzymatic saccharification-based approaches. However, the use of C. phytofermentans takes into consideration specific organismal interactions, which will be crucial for simultaneous saccharification fermentation or consolidated bioprocessing. The ability to detect such phenotypic variation facilitates the genetic analysis of mechanisms underlying plant feedstock quality.
Overexpression of BdMATE Gene Improves Aluminum Tolerance in Setaria viridis
Directory of Open Access Journals (Sweden)
Ana P. Ribeiro
2017-06-01
Full Text Available Acidic soils are distributed worldwide, predominantly in tropical and subtropical areas, reaching around 50% of the arable soil. This type of soil strongly reduces crop production, mainly because of the presence of aluminum, which has its solubility increased at low pH levels. A well-known physiological mechanism used by plants to cope with Al stress involves activation of membrane transporters responsible for organic acid anions secretion from the root apex to the rhizosphere, which chelate Al, preventing its absorption by roots. In sorghum, a membrane transporter gene belonging to multidrug and toxic compound extrusion (MATE family was identified and characterized as an aluminum-activated citrate transporter gene responsible for Al tolerance in this crop. Setaria viridis is an emerging model for C4 species and it is an important model to validate some genes for further C4 crops transformation, such as sugarcane, maize, and wheat. In the present work, Setaria viridis was used as a model plant to overexpress a newly identified MATE gene from Brachypodium distachyon (BdMATE, closely related to SbMATE, for aluminum tolerance assays. Transgenic S. viridis plants overexpressing a BdMATE presented an improved Al tolerance phenotype, characterized by sustained root growth and exclusion of aluminum from the root apex in transgenic plants, as confirmed by hematoxylin assay. In addition, transgenic plants showed higher root citrate exudation into the rhizosphere, suggesting that Al tolerance improvement in these plants could be related to the chelation of the metal by the organic acid anion. These results suggest that BdMATE gene can be used to transform C4 crops of economic importance with improved aluminum tolerance.
Deformation-induced microstructural evolution at grain scale
DEFF Research Database (Denmark)
Winther, Grethe
During plastic deformation metals develop microstructures which may be analysed on several scales,spanning from crystallographic textures averaged over the entire sample to the scale of individualgrains. Even within individual grains, intragranular phenomena in the form of orientation gradients...... aswell as dislocation patterning by formation of dislocation boundaries occur. Experimental data andassociated data analysis at the grain scale and below will be presented to illustrate our current level ofunderstanding. The basis for the analysis is the crystallographic orientation of the grain as well...... is presented for both fcc and bcc materials inseveral deformation modes, demonstrating a clear grain orientation dependence [Huang & Winther,2007]. This dependence has its origin in a dependence on the slip systems [Winther & Huang, 2007].This further implies that the dislocations in the boundaries come from...
Grain boundary structure and properties
International Nuclear Information System (INIS)
Balluffi, R.W.
1979-05-01
An attempt is made to distinguish those fundamental aspects of grain boundaries which should be relevant to the problem of the time dependent fracture of high temperature structural materials. These include the basic phenomena which are thought to be associated with cavitation and cracking at grain boundaries during service and with the more general microstructural changes which occur during both processing and service. A very brief discussion of the current state of knowledge of these fundamentals is given
Interstellar Grains: 50 Years On
Wickramasinghe, N. Chandra
2011-01-01
Our understanding of the nature of interstellar grains has evolved considerably over the past half century with the present author and Fred Hoyle being intimately involved at several key stages of progress. The currently fashionable graphite-silicate-organic grain model has all its essential aspects unequivocally traceable to original peer-reviewed publications by the author and/or Fred Hoyle. The prevailing reluctance to accept these clear-cut priorities may be linked to our further work tha...
Energy Technology Data Exchange (ETDEWEB)
Miao, Yinbin [Argonne National Lab. (ANL), Argonne, IL (United States); Mo, Kun [Argonne National Lab. (ANL), Argonne, IL (United States); Jamison, Laura M. [Argonne National Lab. (ANL), Argonne, IL (United States); Lian, Jie [Rensselaer Polytechnic Inst., Troy, NY (United States); Yao, Tiankai [Rensselaer Polytechnic Inst., Troy, NY (United States); Bhattacharya, Sumit [Argonne National Lab. (ANL), Argonne, IL (United States); Northwestern Univ., Evanston, IL (United States)
2016-01-01
This activity is supported by the US Nuclear Energy Advanced Modeling and Simulation (NEAMS) Fuels Product Line (FPL) and aims at providing experimental data for the validation of the mesoscale simulation code MARMOT. MARMOT is a mesoscale multiphysics code that predicts the coevolution of microstructure and properties within reactor fuel during its lifetime in the reactor. It is an important component of the Moose-Bison-Marmot (MBM) code suite that has been developed by Idaho National Laboratory (INL) to enable next generation fuel performance modeling capability as part of the NEAMS Program FPL. In order to ensure the accuracy of the microstructure-based materials models being developed within the MARMOT code, extensive validation efforts must be carried out. In this report, we summarize the experimental efforts in FY16 including the following important experiments: (1) in-situ grain growth measurement of nano-grained UO2; (2) investigation of surface morphology in micrograined UO2; (3) Nano-indentation experiments on nano- and micro-grained UO2. The highlight of this year is: we have successfully demonstrated our capability to in-situ measure grain size development while maintaining the stoichiometry of nano-grained UO2 materials; the experiment is, for the first time, using synchrotron X-ray diffraction to in-situ measure grain growth behavior of UO2.
Grain size measurements by ultrasonic Rayleigh surface waves
International Nuclear Information System (INIS)
Palanichamy, P.; Jayakumar, T.
1996-01-01
The use of Rayleigh surface waves to determine average grain size nondestructively in an austenitic stainless steel AISI type 316 stainless is discussed. Two commercial type 4MHz frequency surface wave transducers, one as transmitter and the other as receiver were employed for the measurement of surface wave amplitudes. Relative amplitudes of the Rayleigh surface waves were correlated with the metallographically obtained grain sizes. Results indicate that surface/sub-surface average grain sizes of AISI type 316 austenitic stainless steel can be estimated with a confidence level of more than 80% in the grain size range 30-170 μm. (author)
African Journals Online (AJOL)
create a favourable environment for rice ... developing lines adaptable to many ... have stable, not too short crop duration with ..... Analysis of variance of the effect of site and season on maturity, grain yield and plant ..... and yield components.
Semi-automated petrographic assessment of coal by coal grain analysis
Energy Technology Data Exchange (ETDEWEB)
O' Brien, G.; Jenkins, B.; Ofori, P.; Ferguson, K. [CSIRO Exploration and Mining, Pullenvale, Qld. (Australia)
2007-04-15
A new classification method, coal grain analysis, which uses optical imaging techniques for the microscopic characterisation of the individual grains present in coal samples is discussed. This differs from other coal petrography imaging methods in that a mask is used to remove the pixels of mounting resin to obtain compositional information of the maceral (vitrinite, inertinite and liptinite) and mineral abundances on each individual grain within each image. Experiments were conducted to establish the density of individual constituents in order to enable the density of each grain to be determined and the results reported on a mass basis. The grains were sorted into eight grain classes of liberated (single component) and composite grains. By analysing all streams (feed, concentrate and tailings) of the flotation circuit at a coal washing plant, the flotation response of the individual grain classes was tracked. This has implications for flotation process diagnostics and optimisation.
Whole grain foods and health - A Scandinavian perspective
DEFF Research Database (Denmark)
Frølich, Wenche; Aman, Per; Tetens, Inge
2013-01-01
and health effects of the final whole grain products. Future research should consider the specific properties of each cereal and its processing methods to further identify the uniqueness and health potentials of whole grain products. This would enable the authorities to provide more specific food......The food-based dietary guidelines in the Scandinavian countries that recommend an intake of minimum 75 g whole grain per 10 MJ (2,388 kcal) per day are mainly derived from prospective cohort studies where quantitative but little qualitative details are available on whole grain products....... The objective of the current paper is to clarify possible differences in nutritional and health effects of the types of whole grain grown and consumed in the Scandinavian countries. A further objective is to substantiate how processing may influence the nutritional value and potential health effects...
Drying watery wheat grains by far infrared
International Nuclear Information System (INIS)
Suda, K.; Murata, K.; Hara, M.
2004-01-01
Summary A far infrared dryer was experimented to dry wheat grains for high performance and cost reduction. It is more efficient than a circulating dryer reducing drying time by 20% and fuel consumption by 20 - 30%. Whereas it takes more time and more fuel, when the drying rate is set at 1%/h. Moreover, on condition that the average drying rate is lower, it could decrease the rate of green wheat grains up to 3%. But green wheat grains did not disappear at all on the condition
Compressive Load Resistance Characteristics of Rice Grain
Sumpun Chaitep; Chaiy R. Metha Pathawee; Pipatpong Watanawanyoo
2008-01-01
Investigation was made to observe the compressive load property of rice gain both rough rice and brown grain. Six rice varieties (indica and japonica) were examined with the moisture content at 10-12%. A compressive load with reference to a principal axis normal to the thickness of the grain were conducted at selected inclined angles of 0°, 15°, 30°, 45°, 60° and 70°. The result showed the compressive load resistance of rice grain based on its characteristic of yield s...
Phase field simulation of grain growth in porous uranium dioxide
International Nuclear Information System (INIS)
Ahmed, Karim; Pakarinen, Janne; Allen, Todd; El-Azab, Anter
2014-01-01
Graphical abstract: Display Omitted -- Abstract: A novel phase field model has been developed to investigate grain growth in porous polycrystalline UO 2 . Based on a system of Cahn–Hilliard and Allen–Cahn equations, the model takes into consideration both the curvature driven grain boundary motion and pore migration by surface diffusion. As such, the model accounts for the interaction between pore and grain boundary kinetics, which tends to retard the growth process. The phase field model parameters are found in terms of measurable material properties. Hence, quantitative results that can be compared with experiments were obtained. The model has been used to investigate the effect of porosity on the kinetics of grain growth in UO 2 . It is found that, as the amount of porosity increases, grain growth in UO 2 gradually changes from boundary controlled growth to pore controlled growth. For high porosity levels, the grain growth completely stops after a short evolution time. It is also found that the inhomogeneous distribution of pores leads to abnormal grain growth even without taking into account the anisotropy in grain boundary energy and mobility. The effects of porosity, temperature and initial microstructure on grain growth were thoroughly investigated. The model predictions are in good agreement with published experimental results of grain growth in UO 2
Adiabatic motion of charged dust grains in rotating magnetospheres
International Nuclear Information System (INIS)
Northrop, T.G.; Hill, J.R.
1983-01-01
Dust grains in the ring systems and rapidly rotating magnetospheres of the outer planets such as Jupiter and Saturn may be sufficiently charged that the magnetic and electric forces on them are comparable with the gravitational force. The adiabatic theory of charged particle motion has previously been applied to electrons and atomic size particles. But it is also applicable to these charged dust grains in the micrometer and smaller size range. We derive here the guiding center equation of motion, drift velocity, and parallel equation of motion for these grains in a rotating magnetosphere. The effects of periodic grain charge-discharge have not been treated previously and have been included in this analysis. Grain charge is affected by the surrounding plasma properties and by the grain plasma velocity (among other factors), both of which may vary over the gyrocircle. The resulting charge-discharge process at the gyrofrequency destroys the invariance of the magnetic moment and causes a grain to move radially. The magnetic moment may increase or decrease, depending on the gyrophase of the charge variation. If it decreases, the motion is always toward synchronous radius for an equatorial grain. But the orbit becomes circular before the grain reaches synchronous radius, a conclusion that follows from an exact constant of the motion. This circularization can be viewed as a consequence of the gradual reduction in the magnetic moment. This circularization also suggests that dust grains leaving Io could not reach the region of the Jovian ring, but several effects could change that conclusion. Excellent qualitative and quantitative agreement is obtained between adiabatic theory and detailed numerical orbit integrations
Towards realistic molecular dynamics simulations of grain boundary mobility
International Nuclear Information System (INIS)
Zhou, J.; Mohles, V.
2011-01-01
In order to investigate grain boundary migration by molecular dynamics (MD) simulations a new approach involving a crystal orientation-dependent driving force has been developed by imposing an appropriate driving force on grain boundary atoms and enlarging the effective range of driving force. The new approach has been validated by the work of the driving force associated with the motion of grain boundaries. With the new approach the relation between boundary migration velocity and driving force is found to be nonlinear, as was expected from rate theory for large driving forces applied in MD simulations. By evaluating grain boundary mobility nonlinearly for a set of symmetrical tilt boundaries in aluminum at high temperature, high-angle grain boundaries were shown to move much faster than low-angle grain boundaries. This agrees well with experimental findings for recrystallization and grain growth. In comparison with the available data the simulated mobility of a 38.21 o Σ7 boundary was found to be significantly lower than other MD simulation results and comparable with the experimental values. Furthermore, the average volume involved during atomic jumps for boundary migration is determined in MD simulations for the first time. The large magnitude of the volume indicates that grain boundary migration is accomplished by the correlated motion of atom groups.
The evolution of ferrite grain size in structural steels
International Nuclear Information System (INIS)
Hodgson, P.D.
1999-01-01
The refinement of the ferrite grain size is the main aim of modern thermomechanical processes for hot rolled steels. The ferrite grain size is determined by the composition, the state of the austenite at the point of transformation and the cooling rate through transformation. By adding microalloying additions of Ti for grain refinement and Nb to retard recrystallisation, it is possible to reduce the ferrite grain size to less than 5μm at moderate to high cooling rates. However, it is not possible under even the most extreme traditional controlled rolling and accelerated cooling conditions to produce an equiaxed ferrite grain size of less than 3μm. More recent work, though, involving rolling with high undercooling and friction conditions that lead to high shear, suggests that it is possible to produce microstructures in a single rolling pass with an average grain size less than 1μm. This appears to involve a dynamic (ie strain induced) transformation process. The current understanding of static and dynamic transformation and the resultant grain size is reviewed and areas requiring further research are highlighted
Straumfors, Anne; Heldal, Kari Kulvik; Wouters, Inge M; Eduard, Wijnand
OBJECTIVES: The grain and compound feed industry entails inevitable risks of exposure to grain dust and its microbial content. The objective of this study was therefore to investigate task-dependent exposure differences in order to create knowledge basis for awareness and exposure reducing measures
Diagnosis and management of grain-induced asthma.
Quirce, Santiago; Diaz-Perales, Araceli
2013-11-01
Grain-induced asthma is a frequent occupational allergic disease mainly caused by inhalation of cereal flour or powder. The main professions affected are bakers, confectioners, pastry factory workers, millers, farmers, and cereal handlers. This disorder is usually due to an IgE-mediated allergic response to inhalation of cereal flour proteins. The major causative allergens of grain-related asthma are proteins derived from wheat, rye and barley flour, although baking additives, such as fungal α-amylase are also important. This review deals with the current diagnosis and treatment of grain-induced asthma, emphasizing the role of cereal allergens as molecular tools to enhance diagnosis and management of this disorder. Asthma-like symptoms caused by endotoxin exposure among grain workers are beyond the scope of this review. Progress is being made in the characterization of grain and bakery allergens, particularly cereal-derived allergens, as well as in the standardization of allergy tests. Salt-soluble proteins (albumins plus globulins), particularly members of the α-amylase/trypsin inhibitor family, thioredoxins, peroxidase, lipid transfer protein and other soluble enzymes show the strongest IgE reactivities in wheat flour. In addition, prolamins (not extractable by salt solutions) have also been claimed as potential allergens. However, the large variability of IgE-binding patterns of cereal proteins among patients with grain-induced asthma, together with the great differences in the concentrations of potential allergens observed in commercial cereal extracts used for diagnosis, highlight the necessity to standardize and improve the diagnostic tools. Removal from exposure to the offending agents is the cornerstone of the management of grain-induced asthma. The availability of purified allergens should be very helpful for a more refined diagnosis, and new immunomodulatory treatments, including allergen immunotherapy and biological drugs, should aid in the management
Equi-axed and columnar grain growth in UO{sub 2}
Energy Technology Data Exchange (ETDEWEB)
White, R J [Berkely Technology Centre, Nuclear Electric plc, Berkeley (United Kingdom)
1997-08-01
The grain size of UO{sub 2} is an important parameter in the actual performance and the modelling of the performance of reactor fuel elements. Many processes depend critically on the grain size, for example, the degree of initial densification, the evolution rate of stable fission gases, the release rates of radiologically hazardous fission products, the fission gas bubble swelling rates and the fuel creep. Many of these processes are thermally activated and further impact on the fuel thermal behavior thus creating complex feedback processes. In order to model the fuel performance accurately it is necessary to model the evolution of the fuel grain radius. When UO{sub 2} is irradiated, the fission gases xenon and krypton are created from the fissioning uranium nucleus. At high temperatures these gases diffuse rapidly to the grain boundaries where they nucleate immobile lenticular shaped fission gas bubbles. In this paper the Hillert grain growth model is adapted to account for the inhibiting ``Zener`` effects of grain boundary fission gas porosity on grain boundary mobility and hence grain growth. It is shown that normal grain growth ceases at relatively low levels of irradiation. At high burnups, high temperatures and in regions of high temperature gradients, columnar grain growth is often observed, in some cases extending over more than fifty percent of the fuel radius. The model is further extended to account for the de-pinning of grains in the radial direction by the thermal gradient induced force on a fission gas grain boundary bubble. The observed columnar/equi-axed boundary is in fair agreement with the predictions of an evaporation/condensation model. The grain growth model described in this paper requires information concerning the scale of grain boundary porosity, the local fuel temperature and the local temperature gradient. The model is currently used in the Nuclear Electric version of the ENIGMA fuel modelling code. (author). 14 refs, 3 figs, 1 tab.
Advantageous grain boundaries in iron pnictide superconductors
Katase, Takayoshi; Ishimaru, Yoshihiro; Tsukamoto, Akira; Hiramatsu, Hidenori; Kamiya, Toshio; Tanabe, Keiichi; Hosono, Hideo
2011-01-01
High critical temperature superconductors have zero power consumption and could be used to produce ideal electric power lines. The principal obstacle in fabricating superconducting wires and tapes is grain boundaries—the misalignment of crystalline orientations at grain boundaries, which is unavoidable for polycrystals, largely deteriorates critical current density. Here we report that high critical temperature iron pnictide superconductors have advantages over cuprates with respect to these grain boundary issues. The transport properties through well-defined bicrystal grain boundary junctions with various misorientation angles (θGB) were systematically investigated for cobalt-doped BaFe2As2 (BaFe2As2:Co) epitaxial films fabricated on bicrystal substrates. The critical current density through bicrystal grain boundary (JcBGB) remained high (>1 MA cm−2) and nearly constant up to a critical angle θc of ∼9°, which is substantially larger than the θc of ∼5° for YBa2Cu3O7–δ. Even at θGB>θc, the decay of JcBGB was much slower than that of YBa2Cu3O7–δ. PMID:21811238
Directory of Open Access Journals (Sweden)
Cheng-gang LIANG
2013-09-01
Full Text Available Global warming causes the exacerbation of rice growing environment, which seriously affects rice growth and reproduction, and finally results in the decrease of rice yield and quality. We investigated the activities of aspartate metabolism enzymes in grains, and the contents of Aspartate-family amino acids and protein components to further understand the effects of high temperature (HT on rice nutritional quality during rice grain filling. Under HT, the average activities of aspartate aminotransferase (AAT and aspartokinase (AK in grains significantly increased, the amino acid contents of aspartate (Asp, lysine (Lys, threonine (Thr, methionine (Met and isoleucine (Ile and the protein contents of albumin, globulin, prolamin and glutelin also significantly increased. The results indicated that HT enhanced Asp metabolism during rice grain filling and the enhancement of Asp metabolism might play an important role in the increase of Asp-family amino acids and protein components in grains. In case of the partial appraisal of the change of Asp-family amino acids and protein components under HT, we introduced eight indicators (amino acid or protein content, ratio of amino acid or protein, amino acid or protein content per grain and amino acid or protein content per panicle to estimate the effects of HT. It is suggested that HT during rice grain filling was benefit for the accumulation of Asp-family amino acids and protein components. Combined with the improvement of Asp-family amino acid ratio in grains under HT, it is suggested that HT during grain filling may improve the rice nutritional quality. However, the yields of parts of Asp-family amino acids and protein components were decreased under HT during rice grain filling.
Heat transfer rate within non-spherical thick grains
Directory of Open Access Journals (Sweden)
Huchet Florian
2017-01-01
Full Text Available The prediction of the internal heat conduction into non-spherical thick grains constitutes a significant issue for physical modeling of a large variety of application involving convective exchanges between fluid and grains. In that context, the present paper deals with heat rate measurements of various sizes of particles, the thermal sensors being located at the interface fluid/grain and into the granular materials. Their shape is designed as cuboid in order to control the surface exchanges. In enclosed coneshaped apparatus, a sharp temperature gradient is ensured from a hot source releasing the air stream temperature equal to about 400°C. Two orientations of grain related to the air stream are considered: diagonally and straight arrangements. The thermal diffusivity of the grains and the Biot numbers are estimated from an analytical solution established for slab. The thermal kinetics evolution is correlated to the sample granular mass and its orientation dependency is demonstrated. Consequently, a generalized scaling law is proposed which is funded from the effective area of the heat transfer at the grain-scale, the dimensionless time being defined from the calculated diffusional coefficients.
Heat transfer rate within non-spherical thick grains
Huchet, Florian; Richard, Patrick; Joniot, Jules; Le Guen, Laurédan
2017-06-01
The prediction of the internal heat conduction into non-spherical thick grains constitutes a significant issue for physical modeling of a large variety of application involving convective exchanges between fluid and grains. In that context, the present paper deals with heat rate measurements of various sizes of particles, the thermal sensors being located at the interface fluid/grain and into the granular materials. Their shape is designed as cuboid in order to control the surface exchanges. In enclosed coneshaped apparatus, a sharp temperature gradient is ensured from a hot source releasing the air stream temperature equal to about 400°C. Two orientations of grain related to the air stream are considered: diagonally and straight arrangements. The thermal diffusivity of the grains and the Biot numbers are estimated from an analytical solution established for slab. The thermal kinetics evolution is correlated to the sample granular mass and its orientation dependency is demonstrated. Consequently, a generalized scaling law is proposed which is funded from the effective area of the heat transfer at the grain-scale, the dimensionless time being defined from the calculated diffusional coefficients.
Isochron measurements of naturally irradiated K-feldspar grains
International Nuclear Information System (INIS)
Li Bo; Li Shenghua; Wintle, Ann G.; Zhao Hui
2007-01-01
The equivalent doses of K-feldspar grains in a range of grain sizes from 90 to 250μm diameter were measured using a single-aliquot regenerative-dose protocol for the infrared stimulated luminescence (IRSL) signals for two samples of desert sand. The equivalent doses for each sample were compared with that for the 125-150μm grains of quartz from the same samples. The results suggested that the K-feldspar equivalent doses were underestimated because of anomalous fading. Measurements of the decay of the IRSL signals following laboratory irradiation for these two samples, and an additional one from a previously published isochron study, showed anomalous fading during the period of laboratory storage. The decay rate was about 3% per decade for all samples and was independent of the grain size used. Using plots of equivalent doses for K-feldspars as a function of their calculated internal dose rate, and the quartz equivalent dose as a function of grain size, it was concluded that the IRSL signal derived from the internal dose rate had not faded over the 13,000 years that had elapsed since the grains were deposited
Slim 198gold-grain implanter loaded with standard royal marsden 14-grain magazines
International Nuclear Information System (INIS)
Delclos, L.; Moore, E.B.
1979-01-01
We designed a slim gold-grain implanter with adaptable lengths to implant areas accessible only through long, narrow, examining instruments, such as a suspension laryngoscope. The implanter is loaded with the same 14-grain magazine designed for and supplied with the Royal Marsden gun. The simplicity of the loading mechanism with a minimum of moving parts makes the instrument practically trouble free. Although it is designed to be used along narrow examining instruments, it can also be used in any situation in which a permanent implant is required, for instance, prostatic cancer and pelvic recurrences in cancer of the uterine cervix previously treated by external and intracavitary irradiation
Pure iron grains are rare in the universe.
Kimura, Yuki; Tanaka, Kyoko K; Nozawa, Takaya; Takeuchi, Shinsuke; Inatomi, Yuko
2017-01-01
The abundant forms in which the major elements in the universe exist have been determined from numerous astronomical observations and meteoritic analyses. Iron (Fe) is an exception, in that only depletion of gaseous Fe has been detected in the interstellar medium, suggesting that Fe is condensed into a solid, possibly the astronomically invisible metal. To determine the primary form of Fe, we replicated the formation of Fe grains in gaseous ejecta of evolved stars by means of microgravity experiments. We found that the sticking probability for the formation of Fe grains is extremely small; only a few atoms will stick per hundred thousand collisions so that homogeneous nucleation of metallic Fe grains is highly ineffective, even in the Fe-rich ejecta of type Ia supernovae. This implies that most Fe is locked up as grains of Fe compounds or as impurities accreted onto other grains in the interstellar medium.
Grain size distributions and their effects on auto-acoustic compaction
Taylor, S.; Brodsky, E. E.
2013-12-01
A variety of geophysical and geomorphological processes depend on the response of granular mixtures to shear stress. For example, if shear sliding in a fault zone causes gouge to compact or dilate, this has implications on our understanding of earthquake nucleation and propagation. The behavior of granular flows has previously been found to be strongly dependent on shear rate. At relatively slow shear velocities, a granular flow will support stresses elastically through force chains in what is recognized as the 'quasi-static' regime. At relatively high shear velocities, it will support stresses by transferring momentum in higher velocity grain collisions in the 'grain-inertial' regime, which results in dilation of the flow. Recent experiments conducted using a commercial torsional rheometer found that at intermediate shear velocities, force chain collapse in angular sand samples produced sound waves capable of vibrating the shear zone enough to cause compaction. To expand on the characterization of this newly identified rheological regime, the 'auto-acoustic' regime, we used the same experimental set up to observe how volumetric and acoustic response to shear stress changes with grain size mean and range. Stepped velocity ramp experiments were conducted first on five separate grain size bins, and then on various mixtures of these grain sizes. As expected, larger grain sizes entered the mass-dependent grain-inertial regime at lower shear velocities than smaller grain sizes. Interestingly, smaller grain sizes exhibited more pronounced compaction at slower velocities resulting from the auto-acoustic regime, and the largest grain sizes showed no compaction, implying a grain size threshold for auto-acoustic compaction. In mixtures of different grain size bins, the response of the flow to intermediate shear velocities was consistent with the response of the smallest grain size bin included in the mixture, while the response of the flow to high shear velocities was most
Assessment of bleaching of K-feldspar grains
International Nuclear Information System (INIS)
Zhang Jiafu; Li Shenghua; Tso, M-Y.W.
2001-01-01
Based on the difference in the bleaching rate between IRSL and TL signals, a new method of assessing the bleaching of sedimentary feldspar is proposed. All measurements for De and the bleaching factor (normalized ratio of IRSL to TL) are carried out on the same grain. K-feldspar grains from two sediments, a marine and an alluvium, from Hong Kong were tested. Their bleaching factors indicate that bleaching of the marine sediment was not uniform, whereas the latter was relatively homogeneous. Furthermore, the relatively well-bleached grains in each sample were identified
Grain refinement control in TIG arc welding
Iceland, W. F.; Whiffen, E. L. (Inventor)
1975-01-01
A method for controlling grain size and weld puddle agitation in a tungsten electrode inert gas welding system to produce fine, even grain size and distribution is disclosed. In the method the frequency of dc welding voltage pulses supplied to the welding electrode is varied over a preselected frequency range and the arc gas voltage is monitored. At some frequency in the preselected range the arc gas voltage will pass through a maximum. By maintaining the operating frequency of the system at this value, maximum weld puddle agitation and fine grain structure are produced.
Research on operation mode of abrasive grain during grinding
Ivanova, T. N.; Dement’ev, V. B.; Nikitina, O. V.
2018-03-01
The processing of materials by cutting with an abrasive tool is carried out by means of thousands of grains bonded together as a single whole. The quality of the abrasive tool is defined by cutting properties of abrasive grains and depends on features of spreading the temperature field in time and in the abrasive grain volume. Grains are exposed to heating and cooling during work. It leads to undesired effects such as a decrease of durability of grain retention in the binder, hardness, intensification of diffusion and oxidation processes between the binder and the grain, the occurrence of considerable temperature stresses in the grain itself. The obtained equation which allows calculation of temperature field of grain for one rotation of grinding wheel shows that the temperature of the wheel depends on grinding modes and thermophysical properties of abrasive material. Thus, as the time of contact of grain with processed material increases, the temperature in the cutting area rises. As thermophysical properties increase, the temperature in cutting area decreases. Thermal working conditions are determined to be different from each other depending on contact time of the grain and the material. For example, in case of creep-feed grinding, the peak value of temperature is higher than during multistep grinding; the depth of expansion is greater. While the speed of the thermal process in creep-feed grinding is 2-3 times lower than in multistep grinding, the gradient reduces 3-4 times. The analysis of machining methods shows that creep-feed grinding ensures greater depth of grain heating, a smaller heating rate and a reduced velocity gradient. It causes a decrease of probable allotropic modifications and prevents from occurring of heat strokes - cracking of grains due to high temperature falls. Consequently, it is necessary to employ creep-feed grinding to increase the efficiency of abrasive tool employing. Three operation modes of grinding wheel including blunting, full
7 CFR 800.16 - Certification requirements for export grain.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Certification requirements for export grain. 800.16 Section 800.16 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL...
Defect distribution in deformed grains of Cu-based alloy polycrystals
Koneva, N. A.; Trishkina, L. I.; Cherkasova, T. V.
2017-12-01
The paper presents transmission electron microscopy data on the grain defect structure formed in deformed Cu-Al polycrystals. The data show that the parameters of dislocation substructures vary with distance from grain boundaries and that a hardened zone arises near the grain boundaries and its size depends on the grain size.
Directory of Open Access Journals (Sweden)
Melchinger Albrecht E
2010-04-01
Full Text Available Abstract Background The importance of maize for human and animal nutrition, but also as a source for bio-energy is rapidly increasing. Maize yield is a quantitative trait controlled by many genes with small effects, spread throughout the genome. The precise location of the genes and the identity of the gene networks underlying maize grain yield is unknown. The objective of our study was to contribute to the knowledge of these genes and gene networks by transcription profiling with microarrays. Results We assessed the grain yield and grain dry matter content (an indicator for early maturity of 98 maize hybrids in multi-environment field trials. The gene expression in seedlings of the parental inbred lines, which have four different genetic backgrounds, was assessed with genome-scale oligonucleotide arrays. We identified genes associated with grain yield and grain dry matter content using a newly developed two-step correlation approach and found overlapping gene networks for both traits. The underlying metabolic pathways and biological processes were elucidated. Genes involved in sucrose degradation and glycolysis, as well as genes involved in cell expansion and endocycle were found to be associated with grain yield. Conclusions Our results indicate that the capability of providing energy and substrates, as well as expanding the cell at the seedling stage, highly influences the grain yield of hybrids. Knowledge of these genes underlying grain yield in maize can contribute to the development of new high yielding varieties.
Grain boundary corrosion of copper canister weld material
International Nuclear Information System (INIS)
Gubner, Rolf; Andersson, Urban; Linder, Mats; Nazarov, Andrej; Taxen, Claes
2006-01-01
The proposed design for a final repository for spent fuel and other long-lived residues in Sweden is based on the multi-barrier principle. The waste will be encapsulated in sealed cylindrical canisters, which will then be placed in granite bedrock and surrounded by compacted bentonite clay. The canister design is based on a thick cast inner container fitted inside a corrosion-resistant copper canister. During fabrication of the outer copper canisters there will be some unavoidable grain growth in the welded areas. As grains grow, they will tend to concentrate impurities within the copper at the new grain boundaries. The work described in this report was undertaken to determine whether there is any possibility of enhanced corrosion at grain boundaries within the copper canister, based on the recommendations of the report SKB-TR--01-09 (INIS ref. 32025363). Grain boundary corrosion of copper is not expected to be a problem for the copper canisters in a repository. However, as one step in the experimental verification it is necessary to study grain boundary corrosion of copper in an environment where it may occur. A literature study aimed to find one or several solutions that are aggressive with respect to grain boundary corrosion of copper. Copper specimens cut from welds of real copper canisters where exposed to aerated ammonium hydroxide solution for a period of 14 days at 80 degrees C and 10 bar pressure. The samples were investigated prior to exposure using the scanning Kelvin probe technique to characterize anodic and cathodic areas on the samples. The degree of corrosion was determined by optical microscopy. No grain boundary corrosion could be observed in the autoclave experiments, however, a higher rate of corrosion was observed for the weld material compared to the base material. The work suggests that grain boundary corrosion of copper weld material is most unlikely to adversely affect SKB's copper canisters under the conditions in the repository
Grain boundary corrosion of copper canister weld material
Energy Technology Data Exchange (ETDEWEB)
Gubner, Rolf; Andersson, Urban; Linder, Mats; Nazarov, Andrej; Taxen, Claes [Corrosion and Metals Research Inst. (KIMAB), Stockholm (Sweden)
2006-01-15
The proposed design for a final repository for spent fuel and other long-lived residues in Sweden is based on the multi-barrier principle. The waste will be encapsulated in sealed cylindrical canisters, which will then be placed in granite bedrock and surrounded by compacted bentonite clay. The canister design is based on a thick cast inner container fitted inside a corrosion-resistant copper canister. During fabrication of the outer copper canisters there will be some unavoidable grain growth in the welded areas. As grains grow, they will tend to concentrate impurities within the copper at the new grain boundaries. The work described in this report was undertaken to determine whether there is any possibility of enhanced corrosion at grain boundaries within the copper canister, based on the recommendations of the report SKB-TR--01-09 (INIS ref. 32025363). Grain boundary corrosion of copper is not expected to be a problem for the copper canisters in a repository. However, as one step in the experimental verification it is necessary to study grain boundary corrosion of copper in an environment where it may occur. A literature study aimed to find one or several solutions that are aggressive with respect to grain boundary corrosion of copper. Copper specimens cut from welds of real copper canisters where exposed to aerated ammonium hydroxide solution for a period of 14 days at 80 degrees C and 10 bar pressure. The samples were investigated prior to exposure using the scanning Kelvin probe technique to characterize anodic and cathodic areas on the samples. The degree of corrosion was determined by optical microscopy. No grain boundary corrosion could be observed in the autoclave experiments, however, a higher rate of corrosion was observed for the weld material compared to the base material. The work suggests that grain boundary corrosion of copper weld material is most unlikely to adversely affect SKB's copper canisters under the conditions in the repository.
Consumption of whole grains in French children, adolescents and adults.
Bellisle, France; Hébel, Pascale; Colin, Justine; Reyé, Béatrice; Hopkins, Sinead
2014-11-28
The consumption of whole grain foods is associated with many nutritional, health and weight control benefits. The present study assessed whole grain intake in France on the basis of a 7 d dietary survey in a representative sample of children, adolescents and adults (Comportements et Consommations Alimentaires en France 2010 survey). Special care was taken to identify and assess the intake of all whole grains. All foods consumed were considered, with no lower limit on whole grain content. For the majority of foods, details regarding the whole grain contents were obtained from brand information and quantitative nutrient declarations on food labels. Over half of the respondents reported never consuming any whole grain. In participants who did, consumption levels were very low (about 9·1 g/d in children and 14·4 g/d in adults). The main food sources of whole grains were breakfast cereals in children and adolescents and bread in adults. Consumers of whole grains had higher daily intakes of fibre and several vitamins and minerals than non-consumers. In adults but not in children, the OR for overweight/obesity decreased significantly as the level of whole grain consumption increased. Although a majority of French consumers comply with the national recommendation to consume a starchy food with each meal, they do so with minimal consumption of whole grain foods.
Solidification Based Grain Refinement in Steels
2011-09-27
34Thermal Analysis Study of Heterogeneous Nuclei in Stainless Steels ," International Journal of Metalcasting Date: May, 2011 Status: Submitted...develop strength through the precipitation of carbide particles. The resulting mechanical properties can be strengths of 2,000 MPa, 80% elongation, and...by thermomechanical grain refinemeni and precipitation hardening. This is achieved by precipitating niobium carbides , which pin the austenite grains
Sequential Path Model for Grain Yield in Soybean
Directory of Open Access Journals (Sweden)
Mohammad SEDGHI
2010-09-01
Full Text Available This study was performed to determine some physiological traits that affect soybean,s grain yield via sequential path analysis. In a factorial experiment, two cultivars (Harcor and Williams were sown under four levels of nitrogen and two levels of weed management at the research station of Tabriz University, Iran, during 2004 and 2005. Grain yield, some yield components and physiological traits were measured. Correlation coefficient analysis showed that grain yield had significant positive and negative association with measured traits. A sequential path analysis was done in order to evaluate associations among grain yield and related traits by ordering the various variables in first, second and third order paths on the basis of their maximum direct effects and minimal collinearity. Two first-order variables, namely number of pods per plant and pre-flowering net photosynthesis revealed highest direct effect on total grain yield and explained 49, 44 and 47 % of the variation in grain yield based on 2004, 2005, and combined datasets, respectively. Four traits i.e. post-flowering net photosynthesis, plant height, leaf area index and intercepted radiation at the bottom layer of canopy were found to fit as second-order variables. Pre- and post-flowering chlorophyll content, main root length and intercepted radiation at the middle layer of canopy were placed at the third-order path. From the results concluded that, number of pods per plant and pre-flowering net photosynthesis are the best selection criteria in soybean for grain yield.
A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.
Directory of Open Access Journals (Sweden)
Wendy Kloezen
Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.
Transport properties of olivine grain boundaries from electrical conductivity experiments
Pommier, Anne; Kohlstedt, David L.; Hansen, Lars N.; Mackwell, Stephen; Tasaka, Miki; Heidelbach, Florian; Leinenweber, Kurt
2018-05-01
Grain boundary processes contribute significantly to electronic and ionic transports in materials within Earth's interior. We report a novel experimental study of grain boundary conductivity in highly strained olivine aggregates that demonstrates the importance of misorientation angle between adjacent grains on aggregate transport properties. We performed electrical conductivity measurements of melt-free polycrystalline olivine (Fo90) samples that had been previously deformed at 1200 °C and 0.3 GPa to shear strains up to γ = 7.3. The electrical conductivity and anisotropy were measured at 2.8 GPa over the temperature range 700-1400 °C. We observed that (1) the electrical conductivity of samples with a small grain size (3-6 µm) and strong crystallographic preferred orientation produced by dynamic recrystallization during large-strain shear deformation is a factor of 10 or more larger than that measured on coarse-grained samples, (2) the sample deformed to the highest strain is the most conductive even though it does not have the smallest grain size, and (3) conductivity is up to a factor of 4 larger in the direction of shear than normal to the shear plane. Based on these results combined with electrical conductivity data for coarse-grained, polycrystalline olivine and for single crystals, we propose that the electrical conductivity of our fine-grained samples is dominated by grain boundary paths. In addition, the electrical anisotropy results from preferential alignment of higher-conductivity grain boundaries associated with the development of a strong crystallographic preferred orientation of the grains.
Electronic and atomic structures of KFe2Se2 grain boundaries
International Nuclear Information System (INIS)
Fan, Wei; Liu, Da-Yong; Zeng, Zhi
2014-01-01
Highlights: •Twist grain boundary has lower grain-boundary energy. •Twist grain-boundary has similar electronic structure to that in crystal. •Charge and magnetic-moment fluctuations are large within tilt grain boundary. •Bi-collinear AFM is most stable even with existence of grain boundary. •Insulating Fe-vacancy phase is stable with existence of twist grain boundary. -- Abstract: The electronic and atomic structures of the twist and tilt grain boundaries (GB) of the iron-based superconductor KFe 2 Se 2 are studied based on the simulations of the first principles density functional theory. Our results have clarified that the Σ5[0 0 1] twist grain boundary of KFe 2 Se 2 with layered structure has the lower grain-boundary energy. The local structure and the main features of the basic electronic structure within the [0 0 1] twist grain-boundary region have small differences compared with those in KFe 2 Se 2 crystal. The large fluctuations of the charges and magnetic moments are found in the [0 0 1] tilt grain-boundary regions, especially the former are more prominent. The bi-collinear anti-ferromagnetic order is the most stable magnetic order even with grain boundaries in the bulk. The √(5)a×√(5)a superstructure of Fe-vacancies in K 2 Fe 4 Se 5 phase is intrinsically related to the coincident-site lattice of Σ5[0 0 1] twist grain boundary
GRAIN SIZE CONSTRAINTS ON HL TAU WITH POLARIZATION SIGNATURE
International Nuclear Information System (INIS)
Kataoka, Akimasa; Dullemond, Cornelis P; Muto, Takayuki; Momose, Munetake; Tsukagoshi, Takashi
2016-01-01
The millimeter-wave polarization of the protoplanetary disk around HL Tau has been interpreted as the emission from elongated dust grains aligned with the magnetic field in the disk. However, the self-scattering of thermal dust emission may also explain the observed millimeter-wave polarization. In this paper, we report a modeling of the millimeter-wave polarization of the HL Tau disk with the self-polarization. Dust grains are assumed to be spherical and to have a power-law size distribution. We change the maximum grain size with a fixed dust composition in a fixed disk model to find the grain size to reproduce the observed signature. We find that the direction of the polarization vectors and the polarization degree can be explained with the self-scattering. Moreover, the polarization degree can be explained only if the maximum grain size is ∼150 μm. The obtained grain size from the polarization is different from that which has been previously expected from the spectral index of the dust opacity coefficient (a millimeter or larger) if the emission is optically thin. We discuss that porous dust aggregates may solve the inconsistency of the maximum grain size between the two constraints
GRAIN SIZE CONSTRAINTS ON HL TAU WITH POLARIZATION SIGNATURE
Energy Technology Data Exchange (ETDEWEB)
Kataoka, Akimasa; Dullemond, Cornelis P [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Muto, Takayuki [Division of Liberal Arts, Kogakuin University, 1-24-2 Nishi-Shinjuku, Shinjuku-ku, Tokyo 163-8677 (Japan); Momose, Munetake; Tsukagoshi, Takashi, E-mail: kataoka@uni-heidelberg.de [College of Science, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan)
2016-03-20
The millimeter-wave polarization of the protoplanetary disk around HL Tau has been interpreted as the emission from elongated dust grains aligned with the magnetic field in the disk. However, the self-scattering of thermal dust emission may also explain the observed millimeter-wave polarization. In this paper, we report a modeling of the millimeter-wave polarization of the HL Tau disk with the self-polarization. Dust grains are assumed to be spherical and to have a power-law size distribution. We change the maximum grain size with a fixed dust composition in a fixed disk model to find the grain size to reproduce the observed signature. We find that the direction of the polarization vectors and the polarization degree can be explained with the self-scattering. Moreover, the polarization degree can be explained only if the maximum grain size is ∼150 μm. The obtained grain size from the polarization is different from that which has been previously expected from the spectral index of the dust opacity coefficient (a millimeter or larger) if the emission is optically thin. We discuss that porous dust aggregates may solve the inconsistency of the maximum grain size between the two constraints.
Study of rapid grain boundary migration in a nanocrystalline Ni thin film
International Nuclear Information System (INIS)
Kacher, Josh; Robertson, I.M.; Nowell, Matt; Knapp, J.; Hattar, Khalid
2011-01-01
Research highlights: → Abnormal growth is distributed randomly in the foil and initiates at different times. → Growth occurs from seemingly uncorrelated regions of the grain boundary. → Growth twins are created during all stages of abnormal grain growth. → Grain growth patterns are qualitatively similar to a vacancy diffusion model. → Grain boundaries and orientations evolve during growth to minimize system energy. - Abstract: Grain boundary migration associated with abnormal grain growth in pulsed-laser deposited Ni was studied in real time by annealing electron transparent films in situ in the transmission electron microscope. The resulting texture evolution and grain boundary types produced were evaluated by ex situ electron backscatter diffraction of interrupted anneals. The combination of these two techniques allowed for the investigation of grain growth rates, grain morphologies, and the evolution of the orientation and grain boundary distributions. Grain boundaries were found to progress in a sporadic, start/stop fashion with no evidence of a characteristic grain growth rate. The orientations of the abnormally growing grains were found to be predominately //ND throughout the annealing process. A high fraction of twin boundaries developed during the annealing process. The intermittent growth from different locations of the grain boundary is discussed in terms of a vacancy diffusion model for grain growth.
CREATION OF EXPORT-ORIENTED NETWORK OF GRAIN ELEVATORS IN UKRAINE
Directory of Open Access Journals (Sweden)
D. M. Kozachenko
2017-04-01
Full Text Available Purpose. The scientific paper highlights improving the efficiency of export rail transportation of grain cargoes in Ukraine by introducing shipper routing and concentration of loading at the terminal grain elevators. Methodology. According to the experience of the USA and Canada, one of the most effective ways to reduce costs in the grain to-port supply chain is a shipper routing of the rail traffic. Shipper routing for transportation of grain cargoes involves the concentration of their loading on the multiple junctions. The junctions are proposed to be selected with the use of cluster analysis methods. For the formation of the grain loading concentration areas the authors used methods of set theory and multi-criteria optimization. Findings. Based on agglomerative cluster analysis algorithm, the junctions on a network of Ukrainian railways are selected and the areas of possible concentration of grain loading are formed. DSU-algorithm allowed distinguishing the overlapping and non-overlapping areas of concentration. The problem of selecting non-overlapping areas of the grain loading concentration is formalized as the problem of multiobjective integer programming with boolean variables. The solution of this problem by a modified simplex algorithm allows selecting on the railway network of Ukraine 24 districts of possible grain loading concentration, which cover 70 stations and at minimal additional cost provide routing of about 7.5 million tons of grain per year. Originality. The originality of the work lies in the fact that the authors developed the mathematical procedure for selection of junctions and concentration areas of grain loading at the Ukrainian railway network, taking into account the economic efficiency of the process. Practicalvalue. Application of the developed method of grain loading concentration for the formation of unit trains will significantly reduce the logistics costs in the supply chain of grain to Ukrainian ports for
Fine-grained sediment dispersal along the California coast
Warrick, Jonathan A.; Storlazzi, Curt D.
2013-01-01
Fine-grained sediment (silt and clay) enters coastal waters from rivers, eroding coastal bluffs, resuspension of seabed sediment, and human activities such as dredging and beach nourishment. The amount of sediment in coastal waters is an important factor in ocean ecosystem health, but little information exists on both the natural and human-driven magnitudes of fine-grained sediment delivery to the coastal zone, its residence time there, and its transport out of the system—information upon which to base environmental assessments. To help fill these information gaps, the U.S. Geological Survey has partnered with Federal, State, and local agencies to monitor fine-grained sediment dispersal patterns and fate in the coastal regions of California. Results of these studies suggest that the waves and currents of many of the nearshore coastal settings of California are adequately energetic to transport fine-grained sediment quickly through coastal systems. These findings will help with the management and regulation of fine-grained sediment along the U.S. west coast.
Ensuring sustainable grain legume-cereal cropping systems
DEFF Research Database (Denmark)
Bedoussac, Laurent; Journet, E-P; Hauggaard-Nielsen, Henrik
2017-01-01
health makes them a key rotation crop in the sustainable intensification and diversification of smallholder farming. This makes grain legumes a key food security crop. However, yields in developing countries are low as a result of such factors as the need for improved varieties of seed, poor seed......Grain legumes are widely cultivated, particularly for their dry seeds (known as pulses). Grain legumes are an important crop for a number of reasons. They are a rich source of protein and fibre, minerals and vitamins. In addition, their rapid growth and ability to fix nitrogen and improve soil...... distribution, the impact of pests and diseases, as well as vulnerability to poor soils, drought and other effects of climate change. This chapter summarises data from over 50 field experiments undertaken since 2001 on cereal-grain legume intercropping in 13 sites in southern and western France as well...
Grain boundary engineering of highly deformable ceramics
International Nuclear Information System (INIS)
Mecartney, M.L.
2000-01-01
Highly deformable ceramics can be created with the addition of intergranular silicate phases. These amorphous intergranular phases can assist in superplastic deformation by relieving stress concentrations and minimizing grain growth if the appropriate intergranular compositions are selected. Examples from 3Y-TZP and 8Y-CSZ ceramics are discussed. The grain boundary chemistry is analyzed by high resolution analytical TEM is found to have a strong influence on the cohesion of the grains both at high temperature and at room temperature. Intergranular phases with a high ionic character and containing large ions with a relatively weak bond strength appear to cause premature failure. In contrast, intergranular phases with a high degree of covalent character and similar or smaller ions than the ceramic and a high ionic bond strength are the best for grain boundary adhesion and prevention of both cavitation at high temperatures and intergranular fracture at room temperature
Radiative Grain Alignment in Protoplanetary Disks: Implications for Polarimetric Observations
Energy Technology Data Exchange (ETDEWEB)
Tazaki, Ryo [Department of Astronomy, Graduate School of Science, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606–8502 (Japan); Lazarian, Alexandre [Department of Astronomy, University of Wisconsin, Madison, WI 53706 (United States); Nomura, Hideko, E-mail: rtazaki@kusastro.kyoto-u.ac.jp [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152–8551 (Japan)
2017-04-10
We apply the theory of radiative torque (RAT) alignment for studying protoplanetary disks around a T-Tauri star and perform 3D radiative transfer calculations to provide the expected maps of polarized radiation to be compared with observations, such as with ALMA. We revisit the issue of grain alignment for large grains expected in the protoplanetary disks and find that mm-sized grains at the midplane do not align with the magnetic field since the Larmor precession timescale for such large grains becomes longer than the gaseous damping timescale. Hence, for these grains the RAT theory predicts that the alignment axis is determined by the grain precession with respect to the radiative flux. As a result, we expect that the polarization will be in the azimuthal direction for a face-on disk. It is also shown that if dust grains have superparamagnetic inclusions, magnetic field alignment is possible for (sub-)micron grains at the surface layer of disks, and this can be tested by mid-infrared polarimetric observations.
GEMS Revealed: Spectrum Imaging of Aggregate Grains in Interplanetary Dust
Keller, L. P.; Messenger, S.; Christoffersen, R.
2005-01-01
Anhydrous interplanetary dust particles (IDPs) of cometary origin contain abundant materials that formed in the early solar nebula. These materials were transported outward and subsequently mixed with molecular cloud materials and presolar grains in the region where comets accreted [1]. GEMS (glass with embedded metal and sulfides) grains are a major component of these primitive anhydrous IDPs, along with crystalline Mg-rich silicates, Fe-Ni sulfides, carbonaceous material, and other trace phases. Some GEMS grains (5%) are demonstrably presolar based on their oxygen isotopic compositions [2]. However, most GEMS grains are isotopically solar and have bulk chemical compositions that are incompatible with inferred compositions of interstellar dust, suggesting a solar system origin [3]. An alternative hypothesis is that GEMS grains represent highly irradiated interstellar grains whose oxygen isotopic compositions were homogenized through processing in the interstellar medium (ISM) [4]. We have obtained the first quantitative X-ray maps (spectrum images) showing the distribution of major and minor elements in individual GEMS grains. Nanometer-scale chemical maps provide critical data required to evaluate the differing models regarding the origin of GEMS grains.
78 FR 58383 - Renewal of National Grain Car Council
2013-09-23
... of National Grain Car Council AGENCY: Surface Transportation Board, DOT. ACTION: Notice of intent to... of the National Grain Car Council (NGCC). ADDRESSES: A copy of the charter is available at the... solutions and recommendations to the STB on matters affecting grain transportation. The NGCC functions...
Grain yield and agronomic characteristics of Romanian bread wheat ...
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... Wheat is adapted to diverse environments, between the ... international collaborative studies many new varieties ... Stability of grain yield and quality characteristics over locations ... grain yield capacity and yield components of twelve .... Analysis of variance for grain yield and yield-related traits over two ...
Diffraction stress analysis of thin films; investigating elastic grain interaction
International Nuclear Information System (INIS)
Kumar, A.
2005-12-01
This work is dedicated to the investigation of specimens exhibiting anisotropic microstructures (and thus macroscopic elastic anisotropy) and/or inhomogeneous microstructures, as met near surfaces and in textured materials. The following aspects are covered: (i) Analysis of specimens with direction-dependent (anisotropic) elastic grain-interaction. Elastic grain-interaction determines the distribution of stresses and strains over the (crystallographically) differently oriented grains of a mechanically stressed polycrystal and the mechanical and diffraction (X-ray) elastic constants (relating (diffraction) lattice strains to mechanical stresses). Grain interaction models that allow for anisotropic, direction-dependent grain interaction have been developed very recently. The notion 'direction-dependent' grain-interaction signifies that different grain-interaction constraints prevail along different directions in a specimen. Practical examples of direction-dependent grain interaction are the occurrence of surface anisotropy in thin films and the surface regions of bulk polycrystals and the occurrence of grain-shape (morphological) texture. In this work, for the first time, stress analyses of thin films have been performed on the basis of these newly developed grain-interaction models. It has also been demonstrated that the identification of the (dominant) source of direction-dependent grain interaction is possible. The results for the grain interaction have been discussed in the light of microstructural investigations of the specimens by microscopic techniques. (ii) Analysis of specimens with depth gradients: Diffraction stress analysis can be hindered if gradients of the stress state, the composition or the microstructure occur in the specimen under investigation, as the so-called information depth varies in the course of a traditional stress measurement: Ambiguous results are thus generally obtained. In this work, a strategy for stress measurements at fixed
The bio refinery; producing feed and fuel from grain.
Scholey, D V; Burton, E J; Williams, P E V
2016-04-15
It is both possible and practicable to produce feed and fuel from grain. Using the value of grain to produce renewable energy for transport, while using the remaining protein content of the grain as a valuable protein source for livestock and for fish, can be seen as a complimentary and optimal use of all the grain constituents. Consideration must be given to maximise the value of the yeast components, as substantial yeast is generated during the fermentation of the grain starch to produce ethanol. Yeast is a nutritionally rich feed ingredient, with potential for use both as feed protein and as a feed supplement with possible immunity and gut health enhancing properties. Bioprocessing, with the consequent economies of scale, is a process whereby the value of grain can be optimised in a way that is traditional, natural and sustainable for primarily producing protein and oil for feed with a co-product ethanol as a renewable fuel. Copyright © 2015 Elsevier Ltd. All rights reserved.
OBSERVATIONS OF ENHANCED RADIATIVE GRAIN ALIGNMENT NEAR HD 97300
International Nuclear Information System (INIS)
Andersson, B-G; Potter, S. B.
2010-01-01
We have obtained optical multi-band polarimetry toward sightlines through the Chamaeleon I cloud, particularly in the vicinity of the young B9/A0 star HD 97300. We show, in agreement with earlier studies, that the radiation field impinging on the cloud in the projected vicinity of the star is dominated by the flux from the star, as evidenced by a local enhancement in the grain heating. By comparing the differential grain heating with the differential change in the location of the peak of the polarization curve, we show that the grain alignment is enhanced by the increase in the radiation field. We also find a weak, but measurable, variation in the grain alignment with the relative angle between the radiation field anisotropy and the magnetic field direction. Such an anisotropy in the grain alignment is consistent with a unique prediction of modern radiative alignment torque theory and provides direct support for radiatively driven grain alignment.
Basic aspects of high-Tc grain boundary devices
International Nuclear Information System (INIS)
Mannhart, J.; Moler, K.A.; Sigrist, M.
1996-01-01
Grain boundaries are extensively used as high-quality Josephson junctions in high-T c superconductors. Their superconducting characteristics can generally be well described by conventional models of strongly coupled Josephson junctions. Here, we report on highly anomalous critical current vs. magnetic field dependencies of grain boundaries in YBa 2 Cu 3 O 7-x . Direct imaging with scanning SQUID microscopy provides evidence of magnetic flux generated by single grain boundaries. Conventional Josephson junction models cannot explain these effects if a superconducting order parameter with a pure s-wave symmetry is assumed. The results have significant implications for our understanding of the properties of grain boundaries in high-T c superconductors and for their applications. (orig.)
Outcomes Following Traumatic Grain Elevator Injuries.
Tolefree, Sydnei; Truong, Anthony; Ward, Jeanette; Dong, Fanglong; Ablah, Elizabeth; Haan, James
2017-01-01
The absence of a comprehensive database of grain elevator-associated injuries hinders accurate evaluation of injury prevalence and may lead to discordant information about injury frequencies. The main purpose of this study was to identify the most common mechanisms of injury related to grain elevator events. Comparisons of hospital outcomes between patients who sustained traumatic injuries associated with grain elevators at Occupational Safety and Health Administration (OSHA)-regulated industrial sites versus those on OSHA-exempt farming operations were also made. A retrospective review was conducted of all patients' presenting with grain elevator-related injuries at a level-1 trauma center between January 1, 2003, and December 31, 2013. Data collected included demographics, mechanism of injury, injury severity, hospitalization details, and discharge disposition. Data were summarized, and comparisons were made between the groups. All patients (N = 18) in the study were male, with a mean age of 37 years. Falls and being caught in equipment each accounted for 27.8% of injuries. Among the 18 patients, there were a total of 37 injuries. The majority of injuries were either lower extremity (29.7%) or chest injuries (21.6%). The average hospital length of stay was 4 ± 4.5 days, and one patient required mechanical ventilation. There were no reported deaths. The literature reports entrapments as the leading cause of grain elevator-related injuries; however, this study found that falls and being caught in equipment were the most common mechanisms of injury. This suggests that a greater emphasis should be placed on fall prevention and equipment safety.
Cavitation-aided grain refinement in aluminium alloys
Atamanenko, T.V.
2010-01-01
This thesis deals with grain refinement under the influence of ultrasonic-driven cavitation in aluminium casting processes. Three major goals of this research were: (1) to identify the mechanism of the cavitation-aided grain refinement at different stages of solidification; (2) to reveal the
Grain boundaries of nanocrystalline materials - their widths, compositions, and internal structures
International Nuclear Information System (INIS)
Fultz, B.; Frase, H.N.
2000-01-01
Nanocrystalline materials contain many atoms at and near grain boundaries. Sufficient numbers of Moessbauer probe atoms can be situated in grain boundary environments to make a clear contribution to the measured Moessbauer spectrum. Three types of measurements on nanocrystalline materials are reported here, all using Moessbauer spectrometry in conjunction with X-ray diffractometry, transmission electron microscopy, or small angle neutron scattering. By measuring the fraction of atoms contributing to the grain boundary component in a Moessbauer spectrum, and by knowing the grain size of the material, it is possible to deduce the average width of grain boundaries in metallic alloys. It is found that these widths are approximately 0.5 nm for fcc alloys and slightly larger than 1.0 nm for bcc alloys.Chemical segregation to grain boundaries can be measured by Moessbauer spectrometry, especially in conjunction with small angle neutron scattering. Such measurements on Fe-Cu and Fe 3 Si-Nb were used to study how nanocrystalline materials could be stabilized against grain growth by the segregation of Cu and Nb to grain boundaries. The segregation of Cu to grain boundaries did not stabilize the Fe-Cu alloys against grain growth, since the grain boundaries were found to widen and accept more Cu atoms during annealing. The Nb additions to Fe 3 Si did suppress grain growth, perhaps because of the low mobility of Nb atoms, but also perhaps because Nb atoms altered the chemical ordering in the alloy.The internal structure of grain boundaries in nanocrystalline materials prepared by high-energy ball milling is found to be unstable against internal relaxations at low temperatures. The Moessbauer spectra of the nanocrystalline samples showed changes in the hyperfine fields attributable to movements of grain boundary atoms. In conjunction with SANS measurements, the changes in grain boundary structure induced by cryogenic exposure and annealing at low temperature were found to be
GIS-based spatial decision support system for grain logistics management
Zhen, Tong; Ge, Hongyi; Jiang, Yuying; Che, Yi
2010-07-01
Grain logistics is the important component of the social logistics, which can be attributed to frequent circulation and the great quantity. At present time, there is no modern grain logistics distribution management system, and the logistics cost is the high. Geographic Information Systems (GIS) have been widely used for spatial data manipulation and model operations and provide effective decision support through its spatial database management capabilities and cartographic visualization. In the present paper, a spatial decision support system (SDSS) is proposed to support policy makers and to reduce the cost of grain logistics. The system is composed of two major components: grain logistics goods tracking model and vehicle routing problem optimization model and also allows incorporation of data coming from external sources. The proposed system is an effective tool to manage grain logistics in order to increase the speed of grain logistics and reduce the grain circulation cost.
Grain orientation, deformation microstructure and flow stress
International Nuclear Information System (INIS)
Hansen, N.; Huang, X.; Winther, G.
2008-01-01
Dislocation structures in deformed metals have been analyzed quantitatively by transmission electron microscopy, high-resolution electron microscopy and Kikuchi line analysis. A general pattern for the microstructural evolution with increasing strain has been established and structural parameters have been defined and quantified. It has been found that two dislocation patterns co-exist in all grains, however, with very different characteristics dependent on grain orientation. This correlation with the grain orientation has been applied in modeling of the tensile flow stress and the flow stress anisotropy of fcc polycrystals. In conclusion some future research areas are briefly outlined
Statistical Theory of Normal Grain Growth Revisited
International Nuclear Information System (INIS)
Gadomski, A.; Luczka, J.
2002-01-01
In this paper, we discuss three physically relevant problems concerning the normal grain growth process. These are: Infinite vs finite size of the system under study (a step towards more realistic modeling); conditions of fine-grained structure formation, with possible applications to thin films and biomembranes, and interesting relations to superplasticity of materials; approach to log-normality, an ubiquitous natural phenomenon, frequently reported in literature. It turns out that all three important points mentioned are possible to be included in a Mulheran-Harding type behavior of evolving grains-containing systems that we have studied previously. (author)
Star-grain rocket motor - nonsteady internal ballistics
Energy Technology Data Exchange (ETDEWEB)
Loncaric, S.; Greatrix, D.R.; Fawaz, Z. [Ryerson University, Dept. of Aerospace Engineering, Toronto (Canada)
2004-01-01
The nonsteady internal ballistics of a star-grain solid-propellant rocket motor are investigated through a numerical simulation model that incorporates both the internal flow and surrounding structure. The effects of structural vibration on burning rate augmentation and wave development in nonsteady operation are demonstrated. The amount of damping plays a role in influencing the predicted axial combustion instability symptoms of the motor. The variation in oscillation frequencies about a given star grain section periphery, and along the grain with different levels of burn-back, also influences the means by which the local acceleration drives the combustion and flow behaviour. (authors)